Orthologs Set ID: EOG4003G8


Orthology Database
OrthoDB4
Gene Symbol(s)
ABCA3

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 20559 240, 505, 633, 767, 1068, 1185, 1306, 1480, 1665, 1809, 1942, 2097, 2253, 2464, 2615, 2717, 2904, 3208, 3482, 3687, 3907, 4066, 4239, 4368, 4563, 4751, 4922, 5113, 5187
Cavia porcellus 15563 240, 505, 633, 808, 1068, 1185, 1306, 1480, 1665, 1809, 1942, 2097, 2253, 2464, 2615, 2717, 2904, 3208, 3482, 3687, 3907, 4066, 4239, 4368, 4563, 4751, 4922, 5113, 5187
Dipodomys ordii 4073 23, 33, 60, 78, 87, 102, 163, 171, 240, 505, 633, 645, 702, 808, 1068, 1185, 1480, 1665, 1809, 1942, 2097, 2253, 2464, 2615, 2717, 2904, 3208, 3482, 3687, 3907, 4066, 4239, 4368, 4563, 4751, 4922, 5113, 5187
Gorilla gorilla 28689 240, 505, 633, 808, 1068, 1185, 1306, 1480, 1515, 1555, 1605, 1629, 1639, 1665, 1809, 1942, 2097, 2253, 2464, 2643, 2669, 2904, 3208, 3482, 3687, 3907, 4066, 4239, 4368, 4563, 4751, 4922, 5113, 5187
Homo sapiens 30539 240, 505, 633, 808, 1068, 1185, 1306, 1480, 1665, 1809, 1942, 2097, 2253, 2464, 2615, 2717, 2904, 3208, 3482, 3687, 3907, 4066, 4239, 4368, 4563, 4751, 4922, 5113, 5187
Microcebus murinus 6370 27, 36, 75, 123, 163, 177, 240, 505, 633, 808, 1068, 1185, 1480, 1665, 1809, 1942, 2097, 2253, 2464, 2615, 2717, 2904, 3208, 3482, 3687, 3907, 4066, 4239, 4368, 4563, 4751, 4922, 5117, 5187
Mus musculus 16778 240, 505, 633, 808, 1068, 1185, 1306, 1480, 1665, 1809, 1942, 2097, 2253, 2464, 2615, 2717, 2904, 3208, 3482, 3687, 3907, 4066, 4239, 4368, 4563, 4751, 4922, 5113, 5187
Ochotona princeps 13529 169, 180, 240, 505, 633, 808, 1068, 1185, 1480, 1665, 1809, 1942, 2097, 2253, 2464, 2615, 2717, 2904, 3208, 3482, 3687, 3907, 4066, 4239, 4368, 4563, 4751, 4922, 5113, 5187
Oryctolagus cuniculus 25012 240, 505, 633, 808, 1068, 1185, 1480, 1665, 1809, 1942, 2097, 2253, 2464, 2615, 2717, 2904, 3208, 3482, 3687, 3907, 4066, 4239, 4368, 4563, 4751, 4922, 5113, 5187
Otolemur garnettii 6861 29, 33, 36, 114, 138, 160, 240, 505, 633, 808, 1068, 1185, 1480, 1665, 1809, 1942, 2097, 2253, 2464, 2547, 2615, 2625, 2631, 2654, 2670, 2691, 2695, 2697, 2717, 2904, 3208, 3482, 3519, 3549, 3687, 3907, 4066, 4239, 4368, 4563, 4751, 4834, 4913, 4922, 5117, 5187
Pan troglodytes 13792 240, 505, 633, 808, 1068, 1185, 1306, 1480, 1665, 1809, 1942, 2097, 2253, 2464, 2615, 2717, 2904, 3208, 3482, 3687, 3907, 4066, 4239, 4368, 4563, 4751, 4922, 5113, 5187
Rattus norvegicus 5070 240, 505, 633, 808, 1068, 1189, 1239, 1306, 1480, 1665, 1809, 1942, 2097, 2253, 2464, 2615, 2717, 2904, 3208, 3482, 3687, 3907, 4066, 4239, 4368, 4563, 4751, 4922, 5113, 5187
Spermophilus tridecemlineatus 13217 24, 87, 99, 108, 163, 177, 240, 505, 633, 808, 1068, 1084, 1116, 1140, 1143, 1161, 1185, 1480, 1634, 1665, 1809, 1849, 1942, 2088, 2253, 2464, 2615, 2717, 2904, 3208, 3482, 3687, 3907, 4066, 4239, 4368, 4563, 4619, 4713, 4743, 4751, 4922, 4960, 5117, 5187
Tarsius syrichta 13855 1, 29, 36, 56, 129, 150, 163, 240, 505, 633, 808, 936, 950, 960, 986, 1068, 1185, 1480, 1665, 1809, 1942, 2091, 2253, 2464, 2614, 2615, 2717, 2904, 3208, 3296, 3320, 3339, 3483, 3687, 3907, 4066, 4239, 4368, 4563, 4751, 4922, 5113, 5181, 5187
Tupaia belangeri 17270 3, 21, 27, 39, 114, 162, 166, 180, 240, 505, 633, 808, 1068, 1185, 1518, 1596, 1665, 1809, 1942, 2097, 2253, 2464, 2615, 2717, 2904, 3208, 3482, 3687, 3907, 4066, 4239, 4323, 4368, 4425, 4443

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 20559 ENSCJAT00000029126 100402635 ENSCJAG00000014934 LOC100402635 calJac3
Cavia porcellus 15563 ENSCPOT00000008477 100734020 ENSCPOG00000008402 ABCA3 cavPor3
Dipodomys ordii 4073 ENSDORT00000001756 ENSDORG00000001756 Abca3 dipOrd1
Gorilla gorilla 28689 ENSGGOT00000029960 ENSGGOG00000014287 ABCA3 gorGor3
Homo sapiens 30539 ENST00000301732, NM_001089 21 ENSG00000167972 ABCA3 hg19,GRCh37
Microcebus murinus 6370 ENSMICT00000005937 ENSMICG00000005928 ABCA3 micMur1
Mus musculus 16778 ENSMUST00000039013, NM_013855 27410 ENSMUSG00000024130 Abca3 mm9
Ochotona princeps 13529 ENSOPRT00000008969 ENSOPRG00000008946 ABCA3 OchPri2.0
Oryctolagus cuniculus 25012 ENSOCUT00000005144 ENSOCUG00000005137 ABCA3 oryCun2.0
Otolemur garnettii 6861 ENSOGAT00000006626 100960279 ENSOGAG00000006611 ABCA3 otoGar1
Pan troglodytes 13792 ENSPTRT00000014106 453833 ENSPTRG00000007647 ABCA3 panTro2
Rattus norvegicus 5070 ENSRNOT00000060781 302973 ENSRNOG00000008322 E9PTI4_RAT rn4
Spermophilus tridecemlineatus 13217 ENSSTOT00000013218 101964223 ENSSTOG00000013206 Abca3 speTri1
Tarsius syrichta 13855 ENSTSYT00000004510 ENSTSYG00000004382 ABCA3 tarSyr1
Tupaia belangeri 17270 ENSTBET00000017271 ENSTBEG00000017245 ABCA3 tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 12957 ENSCJAP00000027555 100402635 ENSCJAG00000014934 LOC100402635 calJac3
Cavia porcellus 12221 ENSCPOP00000007553 100734020 ENSCPOG00000008402 ABCA3 cavPor3
Dipodomys ordii 3782 ENSDORP00000001643 ENSDORG00000001756 Abca3 dipOrd1
Gorilla gorilla 22264 ENSGGOP00000018236 ENSGGOG00000014287 ABCA3 gorGor3
Homo sapiens 73227 ENSP00000301732 21 ENSG00000167972 ABCA3 hg19,GRCh37
Microcebus murinus 5408 ENSMICP00000005415 ENSMICG00000005928 ABCA3 micMur1
Mus musculus 22691 ENSMUSP00000045285 27410 ENSMUSG00000024130 Abca3 mm9
Ochotona princeps 11798 ENSOPRP00000008210 ENSOPRG00000008946 ABCA3 OchPri2.0
Oryctolagus cuniculus 20249 ENSOCUP00000004456 ENSOCUG00000005137 ABCA3 oryCun2.0
Otolemur garnettii 5913 ENSOGAP00000005922 100960279 ENSOGAG00000006611 ABCA3 otoGar1
Pan troglodytes 3469 ENSPTRP00000013070 453833 ENSPTRG00000007647 ABCA3 panTro2
Rattus norvegicus 13279 ENSRNOP00000057509 302973 ENSRNOG00000008322 E9PTI4_RAT rn4
Spermophilus tridecemlineatus 11837 ENSSTOP00000011846 101964223 ENSSTOG00000013206 Abca3 speTri1
Tarsius syrichta 12704 ENSTSYP00000004132 ENSTSYG00000004382 ABCA3 tarSyr1
Tupaia belangeri 14995 ENSTBEP00000015017 ENSTBEG00000017245 ABCA3 tupBel1

multiple sequence alignment in CLUSTALW format


Tarsius_syrichta|13855              GCTCCCCCCACCCCATTGCCTTCCCTGCCTCTCCAGAGAGCAGCCACATCTATACCCCTC
Tupaia_belangeri|17270              GCTTCCCGTCCATCGCCTTCCCCTCCAGGCGAGGCAGCCTCTGCC------------ACT
Dipodomys_ordii|4073                ACAGGGACTCCTCCAGCTCCTTCCCTGCACCTCGCACCTCCAGGC------------CTA
Spermophilus_tridecemlineatus|13217 ACAGCTCCCCCGCCCCCGCCGCCTGCTGGGTCTGCACACCTCAAT------------GCC
Otolemur_garnettii|6861             GCTCCCCCTCCTCCATTGGCTTCCCTGCCTTTCTTCGTAGCTACA------------TTC
Microcebus_murinus|6370             GCTGCCCCTGCTCCATCGCCTTCCCTGCCTCTCCAGAGAGCAGCC------------GTG
Oryctolagus_cuniculus|25012         ------------------------------------------------------------
Ochotona_princeps|13529             ------------------------------------------------------------
Mus_musculus|16778                  ------------------------------------------------------------
Rattus_norvegicus|5070              ------------------------------------------------------------
Cavia_porcellus|15563               ------------------------------------------------------------
Callithrix_jacchus|20559            ------------------------------------------------------------
Gorilla_gorilla|28689               ------------------------------------------------------------
Homo_sapiens|30539                  ------------------------------------------------------------
Pan_troglodytes|13792               ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|13855              GGCCTCTGTGCCCTTGGCACTCAGAGCACGTTCCCTCTGTTTCCTTGGTGTCACAAGATC
Tupaia_belangeri|17270              GCCCTCCATGCCCTCCGCTGTCCGAAGGCGGCCCCTCTGTTCCCGGAGTGTTGCGGCGTC
Dipodomys_ordii|4073                GGCTTTTGGAACAGTCCTGTCTCCAGCTCCCTGGGCTTATTCCTA---------------
Spermophilus_tridecemlineatus|13217 CTCAGCTTTAGGAAAGAAGTTCTGACAGGGTGTCATGCCTACCTGGGCGTC---------
Otolemur_garnettii|6861             ACACACCTTAGCTCCCATACCCTCAGCCTTCAGTGCACGTTCCTTCTGTGTCCTTATCAC
Microcebus_murinus|6370             TCCACGCAGCCCAGCCCTGCCCTCAGCCTTCAGAGCAAGTTCCTTCTGCGTCCTGCGTGC
Oryctolagus_cuniculus|25012         ------------------------------------------------------------
Ochotona_princeps|13529             ------------------------------------------------------------
Mus_musculus|16778                  ------------------------------------------------------------
Rattus_norvegicus|5070              ------------------------------------------------------------
Cavia_porcellus|15563               ------------------------------------------------------------
Callithrix_jacchus|20559            ------------------------------------------------------------
Gorilla_gorilla|28689               ------------------------------------------------------------
Homo_sapiens|30539                  ------------------------------------------------------------
Pan_troglodytes|13792               ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|13855              TACCTATAC---------------GTCAGAACTCCTCTAACAGAGCTGGTGCCCTCCTGG
Tupaia_belangeri|17270              TACCTGAAC------------TCGGTCAGACCGCCCGCTTCTGCAGTGCTGGCCGCTCTT
Dipodomys_ordii|4073                ---------------------------CCTACTTCCCCAACAGTGCTGGCACCCACCGGA
Spermophilus_tridecemlineatus|13217 ---------------------AGACCACCTACTTCACCAACAGTGCTGGGCGTCCCTGGC
Otolemur_garnettii|6861             AGGGTGTACCTGGGCTATAGTCCACCTAATTCTCTAGCAGGGCAGGACAACCCTCCCAGC
Microcebus_murinus|6370             CGC------------------GGTCCACCTACTTCTCCGGCAGCGCTGGGCGTGCCTGGT
Oryctolagus_cuniculus|25012         ---------------------------------CTGGCTGCAGGCCGCCGTCCCCTGCTG
Ochotona_princeps|13529             ------------------------------------------------CTGCCCGCCCCT
Mus_musculus|16778                  ------------------------------------------------------------
Rattus_norvegicus|5070              ------------------------------------------------------------
Cavia_porcellus|15563               ------------------------------------------------------------
Callithrix_jacchus|20559            ------------------------------------------------------------
Gorilla_gorilla|28689               ------------------------------------------------------------
Homo_sapiens|30539                  ------------------------------------------------------------
Pan_troglodytes|13792               ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|13855              GAGAAGATGGCTGTGTTCAGGCAGCTGGTGCTCCTTCTGTGGAAAAACTACACTCTGCAG
Tupaia_belangeri|17270              GTGAAGATGGCGGTGCCCAGGCAGCTGCTGCTGCTCCTCTGGAAGAACTACACACTGCAG
Dipodomys_ordii|4073                GGGAGGATGTCGGTGTTGCGGCAGCTGGCCCTCCTGCTCTGGAAGAACTATACTCTGAAG
Spermophilus_tridecemlineatus|13217 GAGAGGATGGCGGTGCTGCAGCAGCTGGCCCTCCTGCTGTGGAAGAACTACACCTTGCAG
Otolemur_garnettii|6861             GAGAAGATGGCAGTGCTCCGTCACCTGGCACTCCTCCTCTGGAAGAACTATACACTGAAG
Microcebus_murinus|6370             GAGAAGATGGCCGTGCTCAGGCAGCTGGCGCTCCTCCTCTGGAAGAACTACACCCTGCAG
Oryctolagus_cuniculus|25012         GCGAAGATGGCCGTGCTCCGGCAGCTGGCACTGCTGCTCTGGAAGAACTACACCCTGCAG
Ochotona_princeps|13529             GAGAAGATGGCTGCGCTCCGACAGCTGGCGCTGCTGCTCTGGAAGAACTATACCCTGCAG
Mus_musculus|16778                  ------ATGGCAGTGCTGCGGCAGCTCACCCTCCTACTCTGGAAGAACTATACCCTGAAG
Rattus_norvegicus|5070              ------ATGGTGGTGCTGCGGCAGCTCAGGCTCCTACTCTGGAAGAACTATACTCTGAAG
Cavia_porcellus|15563               ------ATGGCAGTGCTACGGCAGCTGGTGCTCCTTCTGTGGAAGAACTACACTTTGCAG
Callithrix_jacchus|20559            ------ATGGCTGTGCTCAGGCAGCTGGCGCTCCTCCTCTGGAAGAACTACACCCTACAG
Gorilla_gorilla|28689               ------ATGGCTGTGCTCAGGCAGCTGGCGCTTCTCCTCTGGAAGAACTACACCCTGCAG
Homo_sapiens|30539                  ------ATGGCTGTGCTCAGGCAGCTGGCGCTCCTCCTCTGGAAGAACTACACCCTGCAG
Pan_troglodytes|13792               ------ATGGCTGTGCTCAGGCAGCTGGCGCTCCTCCTCTGGAAGAACTACACCCTGCAG
                                          ***   * *   .. ** **    ** ** ** *****.***** **  *..**

Tarsius_syrichta|13855              AAGCGAAAGGTCCTAGTGACAGTCCTGGAACTCTTCCTGCCATTGCTGTTTTCTGGGATC
Tupaia_belangeri|17270              AAACGGAAGGTGCTGGTGACAGCCCTGGAACTCTTCCTGCCATTACTGTTTTCTGGGATC
Dipodomys_ordii|4073                AAGCGGAAGGTTCTGGTGACAATCCTGGAGCTCCTCCTGCCCCTGTTGTTTTCTGGGATC
Spermophilus_tridecemlineatus|13217 AAGCGGAAGGTTCTAGTGACAGTCCTGGAACTCTTTCTGCCCTTACTGTTTTCTGGGATC
Otolemur_garnettii|6861             AAGCGGAAGGTTCTAGTGACAGTCCTGGAACTCTTTCTGCCTTTGCTGTTTTCTGGAATC
Microcebus_murinus|6370             AAGCGGAAGGTTCTAGTGACAGTCCTGGAGCTCTTCCTGCCGTTACTGTTTTCTGGAATC
Oryctolagus_cuniculus|25012         AAGCGGAAGGTGCTGGTGACCGCCCTGGAACTCTTCCTGCCGTTGCTGTTTTCCGGGATC
Ochotona_princeps|13529             AAGCGGAAGGTTCTGGTGACGGCCCTGGAGCTTCTCCTGCCATTGCTGTTTTCTGGGATC
Mus_musculus|16778                  AAACGGAAGGTTCTAGTGACAGTCCTGGAGCTCTTCCTGCCCCTGCTGTTTTCTGGGATC
Rattus_norvegicus|5070              AAACGGAAGGTCCTAGTGACAGTCTTGGAGCTTTTCCTGCCCCTGCTGTTTTCTGGGATC
Cavia_porcellus|15563               AAGAGGAAGGTCCTAGTGACAGTCCTGGAACTCCTTCTACCCCTGCTGTTTTCTGGGATC
Callithrix_jacchus|20559            AAGCGGAAGGTCGTGGTAACGGTCCTGGAACTCTTCCTGCCATTGCTGTTTTCTGGGATC
Gorilla_gorilla|28689               AAGCGGAAAGTCCTGGTGACGGTCCTGGAACTCTTCCTGCCATTGCTGTTTTCTGGGATC
Homo_sapiens|30539                  AAGCGGAAGGTCCTGGTGACGGTCCTGGAACTCTTCCTGCCATTGCTGTTTTCTGGGATC
Pan_troglodytes|13792               AAGCGGAAGGTCCTGGTGACGGTCCTGGAACTCTTCCTGCCATTGCTGTTTTCTGGGATC
                                    **..*.**.**  *.**.** . * ****.**  * **.**  *. ******* **.***

Tarsius_syrichta|13855              CTGATTTGGCTTCGCCTGAAGATTCAGTCAGAAAATGTGCCCAACGCCACTATCTACCCC
Tupaia_belangeri|17270              CTGATTTGGCTCCGCTTGAAGATTCAGTCAGAAAACGTGCCCAACGCCACCGTCTACCCT
Dipodomys_ordii|4073                CTGATTTGGCTTCGCTTGAAGATTCAGTCAGAAAATGTGCCCAACGCTACTGTCTACCCC
Spermophilus_tridecemlineatus|13217 CTGATTTGGCTTCGTTTGAAGATCCAGTCAGAAAATGTGCCCAATGCTACGGTCTACCCT
Otolemur_garnettii|6861             TTAATTTGGCTTCGCTTGAAGATTCAGTCAGAAAATGTGCCCAATGCCACCATCTACCCT
Microcebus_murinus|6370             CTGATTTGGCTCCGCTTGAAGATTCAGTCTGAAAACGTGCCCAACGCCACCATCTACCCC
Oryctolagus_cuniculus|25012         CTGATCTGGCTTCGCTTGAAGATCCAGTCGGAAAACGTGCCCAACGCCACCGTCTACCCG
Ochotona_princeps|13529             CTGATTTGGCTGCGCTTGAAGATCCAGTCGGAAAACGTGCCCAATGCCACCGTCTACCCG
Mus_musculus|16778                  CTGATTTGGCTTCGCTTGAAGATCCAGTCGGAGAATGTGCCCAATGCCACTGTTTACCCG
Rattus_norvegicus|5070              CTGATTTGGCTTCGCTTGAAGATCCAGTCGGAGAATGTGCCCAATGCTACTGTTTACCCA
Cavia_porcellus|15563               CTGATTTGGCTTCGCTTGACGATCCAATCAGAAAATGTGCCCAATGCTACTGTCTACCCT
Callithrix_jacchus|20559            CTGATCTGGCTTCGCTTGAAGATTCAGTCGGAAAATGTGCCCAATGCCACCATCTACCCG
Gorilla_gorilla|28689               CTCATCTGGCTCCGCTTGAAGATTCAGTCGGAAAATGTGCCCAACGCCACCATCTACCCG
Homo_sapiens|30539                  CTCATCTGGCTCCGCTTGAAGATTCAGTCGGAAAATGTGCCCAACGCCACCATCTACCCG
Pan_troglodytes|13792               CTCATCTGGCTCCGCTTGAAGATTCAGTCGGAAAATGTGCCCAACGCCACCATCTACCCG
                                     * ** ***** **  ***.*** **.** **.** ******** ** ** .* ***** 

Tarsius_syrichta|13855              GACCAGTCCATTCAAGAGCTGCCTCTGTTCTTCACCTTCCCTCCACCGGGAGACACTTGG
Tupaia_belangeri|17270              GGCCAGTCCATCCAGGTGCTGCCGCTGTTCTTCACCATCCCCCCGCCGGGAGACGCCTGG
Dipodomys_ordii|4073                AGCCAGTCCATCCAGCAGCTGCCTTTTTTCTTCACTTTAGCCCCATCAGTGGGCACCTGG
Spermophilus_tridecemlineatus|13217 GGTCAGTCCATCCAGGAGCTGCCCCTGTTTTTCACCTTCCCTCCGCCAGGGGACACCTGG
Otolemur_garnettii|6861             GGCCAGTCCATCCAGGAGCTGCCTCTGTTCTTCACCTTCCCTCCACCAGGAGACAGCTGG
Microcebus_murinus|6370             GGCCAGTCCATTCAGGAGCTGCCCCTGTTCTTCACCTTCCCCCCGCCCGGGGGCACCTGG
Oryctolagus_cuniculus|25012         GGCCAGTCCATCCAGGAGCTGCCCTTGTTCTTCAACTTCCCGCCACCAGGGGACGCCTGG
Ochotona_princeps|13529             GAGCAGTCCATCCAGGAGCTGCCCCTGTTCTTCACTTTCCCTCCGCCAGGGGGCACCTGG
Mus_musculus|16778                  GACCAGTCCATCCAGGAGCTGCCCCTGTTTTTCTCATTCCCTCCACCTGGGGGGACCTGG
Rattus_norvegicus|5070              GACCAGCACATCCAGGAGCTGCCCCTGTTTTTCTCATTCCCTCCACCTGGGGGGAGCTGG
Cavia_porcellus|15563               GGCCAGTCCATCCAGGAGCTGCCCCTGTTCTTCAGCTTTCCTCCGCTAGGGGGAACCTGG
Callithrix_jacchus|20559            GGCCAGTCCATCCAGGAGCTGCCTCTGTTCTTCACCTTCCCTCCACCAGGAGACACCTGG
Gorilla_gorilla|28689               GGCCAGTCCATCCAGGAGCTGCCTCTGTTCTTCACCTTCCCTCCGCCAGGAGACACCTGG
Homo_sapiens|30539                  GGCCAGTCCATCCAGGAGCTGCCTCTGTTCTTCACCTTCCCTCCGCCAGGAGACACCTGG
Pan_troglodytes|13792               GGCCAGTCCATCCAGGAGCTGCCTCTGTTCTTCACCTTCCCTCCGCCAGGAGACACCTGG
                                    .. *** .*** **. :******  * ** ***:  :*  * **.   * .*. .  ***

Tarsius_syrichta|13855              GAGCTTGCCTACATCCCTTCCCACAGTGATGCCGCCAAGACCGTCACCGAGACGGTTCGA
Tupaia_belangeri|17270              GAGCTCGCCTACATCCCTTCCCACAGCGAGGCCGCCAGGACGGTCACCGAGGCAGCCAGG
Dipodomys_ordii|4073                GAACTTGCCTATGTCCCTTCCCACAGCGAAGCTGCCAGAACAGTCACTGAGACAGTGAAG
Spermophilus_tridecemlineatus|13217 GAGCTCGCCTACATCCCTTCCCACTCTGAGGCTGCCAAGACCATCACTGAGACTGTGAGA
Otolemur_garnettii|6861             GAGCTCGCCTTCATCCCTTCCCACAGTGATGCTGCCAAAACCATCACTGAGACAGTGAGA
Microcebus_murinus|6370             GAGCTCGCCTTTGTCCCCTCCCACAGCGACACCGCCAGAGCCATCACCCAGACAGTGAGG
Oryctolagus_cuniculus|25012         GAGCTCGCCTACATCCCTTCCCACAGTGACGCTGCCAGGGCCATCACCGAGTGGGCCAGG
Ochotona_princeps|13529             GAGCTCGCCTACGTGCCTTCCCACAGTGATGCCGCCAGAACCATCACTGAATCGGCCAGG
Mus_musculus|16778                  GAGCTCGCCTATGTCCCTTCCCACAGCGATGCTGCCAGGACCATCACGGAGACGGTGAAA
Rattus_norvegicus|5070              GAGCTCGCCTATGTCCCTTCCCACAGCGATGCTGCCAGGACCATCACAGAGGCAGTGAGA
Cavia_porcellus|15563               GAGCTGGCCTATGTTCCTTCCCACAGTGCTGCTGCTAAAACCATCACAGAGTCTGTGAGA
Callithrix_jacchus|20559            GAGCTCGCCTACATCCCTTCCCACAGTGACGCTGCCAAGACTGTCACTGAGACTGTGCGC
Gorilla_gorilla|28689               GAGCTCGCCTACATCCCTTCTCACAGTGACGCTGCCAAGACCGTCACTGAGACAGTGCGC
Homo_sapiens|30539                  GAGCTTGCCTACATCCCTTCTCACAGTGACGCTGCCAAGACCGTCACTGAGACAGTGCGC
Pan_troglodytes|13792               GAGCTCGCCTACATCCCTTCTCACAGTGACGCTGCCAAGACCGTCACTGAGACAGTGCGC
                                    **.** ****: .* ** ** ***:  *. .* ** *...* .****  *.   *  .. 

Tarsius_syrichta|13855              AGGGCACTTGTGATCAACATGAGAGTCCGTGGTTTTCCCTCCGAGAAAGACTTCGAGGAC
Tupaia_belangeri|17270              AAGGCACTGGTGATCAACATGAGAGTCCGCGGCTTCCCCTCTGAGAAGGACTTCGAGGAC
Dipodomys_ordii|4073                AGGGCACTGCAGGTCAACATAAGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|13217 AAGTCCCTAGTGATCAACATGAGAGTGCGTGGCTTTCCCTCTGAGAAGGACTTCGAGGAC
Otolemur_garnettii|6861             AGGGAGCTAGTGATCAACATGAGGGTTCGTGGCTTTCCCTCTGAGAAGGACTTTGAGGAC
Microcebus_murinus|6370             AGGGAGCTGGTGATCAACATGAGAGTTCGTGGCTTTCCCTCCGAGAAGGACTTTGAGGAC
Oryctolagus_cuniculus|25012         AGGGCGCTGGTGGTCAACATGAAAGTCCGTGGCTTTCCCTCGGAGAAGCACTTTGAGGAC
Ochotona_princeps|13529             AGAGCGCTGCTGATCAACATGAGAGTTCGCGGCTTTCCCTCGGACAAGCACTTCGAGGAC
Mus_musculus|16778                  AGGGAATTCATGATCAAGATGAGAGTGCACGGCTTCTCCTCTGAGAAGGACTTCGAGGAC
Rattus_norvegicus|5070              AGGGAATTCATGATCAAGATGAGAGTGCACGGCTTTTCCTCTGAGAAGGACTTCGAGGAC
Cavia_porcellus|15563               AGGGCGCTGGTGATCAACATGAGAGTACACGGCTTTCCCACTGAAAAAGACTTCGAGGAC
Callithrix_jacchus|20559            AGGGCACTTGGGATCAACATGCGAGTGCGCGGCTTTCCCGCCGAGAAGGCCTTCGAGGAC
Gorilla_gorilla|28689               AGGGCACTTGTGATCAACATGCGAGTGCGCGGCTTTCCCTCCGAGAAGGACTTTGAGGAC
Homo_sapiens|30539                  AGGGCACTTGTGATCAACATGCGAGTGCGCGGCTTTCCCTCCGAGAAGGACTTTGAGGAC
Pan_troglodytes|13792               AGGGCACTTGTGATCAACATGCGAGTGCGCGGCTTTCCCTCCGAGAAGGACTTTGAGGAC
                                    *.. .  *   *.**** **....*.    .. ..       .        .. . ..  

Tarsius_syrichta|13855              TACATTCGGTACGACAACCACTCTTCCAACGTGCTGGCCGCTGTGGTGTTTGAGCACACC
Tupaia_belangeri|17270              CACGTGCGCTATGACAACCACTCTGCCAATGTGCTGGCCGCCGTGGTGTTCCAGCACACC
Dipodomys_ordii|4073                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|13217 TACGTTCGGTACGACAACCACTCCTCCAATGTACTGGCTGCCGTGGTGTTCCAGCTGGCC
Otolemur_garnettii|6861             TATATTAGGTATGATAACCACTCTTCCAATGTGCTGGCTGCCGTGGTGTTTGAGCACACC
Microcebus_murinus|6370             TACATTAGGTACGACAACCACTCTACCAACGTGCTGGCCGCTGTGGTGTTCGAGCACACC
Oryctolagus_cuniculus|25012         TACATCAGGTACGACAACCGCTCCTCCAACGTGCTGGCCGCCCTGGTGTTCGAAAACGAA
Ochotona_princeps|13529             TACATCCGGTACGACAACCGCTCTTCCAACGTGCTGGCCGCCGTGGTGTTCGAGCACGAG
Mus_musculus|16778                  TACATTCGCTATGACAACCACTCCTCCAGCGTGCTGGCAGCTGTGGTATTTGAGCACAGC
Rattus_norvegicus|5070              TACGTTCGCTATGACAACCACTCCTCCAACGTGCTGGCAGCTGTGGTATTTGAGCACACC
Cavia_porcellus|15563               TACATTCGGTATGACAATCACTCCTCCAATGTGCTGGCTGCTGTGGTGTTTGAGAACGCC
Callithrix_jacchus|20559            TACATTAGGTATGACAACCGCTCATCCAGCGTGCTGGCCGCGGTGGTGTTCGAGCACCCC
Gorilla_gorilla|28689               TACATTAGGTACGACAACCGCTCGTCCAGCGTGCTGGCCGCCGTGGTCTTCGAGCACCCC
Homo_sapiens|30539                  TACATTAGGTACGACAACTGCTCGTCCAGCGTGCTGGCCGCCGTGGTCTTCGAGCACCCC
Pan_troglodytes|13792               TACATTAGGTACGACAACCGCTCGTCCAGCGTGCTGGCAGCCGTGGTCTTCGAGCACCCT
                                        .  . .  .        .        ..  ...  .   .... ..          

Tarsius_syrichta|13855              TTCAACCATAGCAAGGAGCCCCTGCCGCTGGCGGTGAAATATCACCTACGGTTCAGTTAT
Tupaia_belangeri|17270              TTCAACCACAGCAAGGACCCCCTGCCGCTGGCGGTGAAGTACCACCTCCGGTTCAGTTGC
Dipodomys_ordii|4073                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTGAAATACCAC---CGCTTCAGTTGT
Spermophilus_tridecemlineatus|13217 TCCAACCACAGCAAGGAGCCCCTGCCGCTGGCGGTGAAATATCACCTACGCTTCAGCTAC
Otolemur_garnettii|6861             TTCAACCACAGCAAGGACACCCTACCACTGGCGGTGAAATATCACCTACGGTTCAGTTAC
Microcebus_murinus|6370             TTCAACCACAGCAAGGACCCCCTGCCGCTGGCGGTGAAGTACCACCTACGGTTCAGTTAC
Oryctolagus_cuniculus|25012         TTCAGCCACAGCACGGACCCCCTGCCCCTGGCGGTGAAATACCACCTGCGGTTCAGTTAC
Ochotona_princeps|13529             TTCAGTCACAGCACGGACCCCCTGCCCCTGGCGGTGAAATACCACCTGCGCTTCAGTTAC
Mus_musculus|16778                  TTCAACCACAGCCAGGACCCCCTGCCGCTGGCGGTGAAATACCACCTGCGCTTCAGTTAC
Rattus_norvegicus|5070              TTCAACCACAGCAAGGACCCCCTGCCATTGGCGGTGAGATACCACCTACGCTTCAGTTAC
Cavia_porcellus|15563               TCCAACCACAGCAAGGAGCCCCTGCCGCTGACTGTAAAATATCACCTACGCTTCAGTCAT
Callithrix_jacchus|20559            TTCAACCACAGCAAGGAGCCCCTGCCGCTGGCGGTGAAATACCACCTGCGGTTCAGTTAC
Gorilla_gorilla|28689               TTCAACCACAGCAAGGAGCCCCTGCCGCTGGCGGTGAAATATCACCTACGGTTCAGTTAC
Homo_sapiens|30539                  TTCAACCACAGCAAGGAGCCCCTGCCGCTGGCGGTGAAATATCACCTACGGTTCAGTTAC
Pan_troglodytes|13792               TTCAACCACAGCAAGGAGCCCCTGCCGCTGGCGGTGAAATATCACCTACGGTTCAGTTAC
                                    .         .   ..      .     ..   **.*..** ***   ** *****  . 

Tarsius_syrichta|13855              ACACGAAGAAATTACATGTGGACCCAGACAGGCTCCCTTCTCCTGAAAGAGACGGAAGGC
Tupaia_belangeri|17270              ACACGGAGGAACTACATGTGGACCCAGGCAGGCTCCGTCTTCCTGAAGGAGGCCGAGGGC
Dipodomys_ordii|4073                GCACGAAGAAATTACATATGGACCCAAACAGGCAACTTTTTC---AAAGAAACAGATGGC
Spermophilus_tridecemlineatus|13217 ACACGAAGGAATTACATGTGGACCCAAACTGGCAACTTCTTCCTGAAAAAGACAGAGGGC
Otolemur_garnettii|6861             ACACGAAGAAACTACATGTGGACCCAAACGGGCTCCTTTTTCCTGAAGGAGACAGAAGGC
Microcebus_murinus|6370             ACAAGGAGAAACTACATGTGGACCCAGACGGGCTCCTTTTTCCTGAAGGAGACGGAAGGC
Oryctolagus_cuniculus|25012         ACGCGGAGAAACTACATGTGGACCCAGTCAGGCACCTTTCTCCTGAGAGACACCGAGGGC
Ochotona_princeps|13529             ACGCGGAGGAATTACATTTGGACCCAGTCGGGCTCCTTCCTCCTCAAGGAGACTGAGGGC
Mus_musculus|16778                  ACACGAAGAAATTACATGTGGACCCAAACAGGAAATATTTTCCTAAAAGAGACTGAAGGC
Rattus_norvegicus|5070              ACGCGAAGAAATTACATGTGGACCCAAACAGGAAATCTTTTCCTCAAAGAGACTGAAGGC
Cavia_porcellus|15563               ACCCGGAGAAATTACATGTGGACTCAAACAGGCAACTTTTTCCTGAAAGAGACGGAGGGC
Callithrix_jacchus|20559            ACACGGAGAAATTACTTGTGGACGCAAACAGGCTCCTTTTTCCTGAAAGAGACGGATGAC
Gorilla_gorilla|28689               ACACGGAGAAATTACATGTGGACCCAAACAGGCTCCTTTTTCCTGAAAGAGACAGAAGGC
Homo_sapiens|30539                  ACACGGAGAAATTACATGTGGACCCAAACAGGCTCCTTTTTCCTGAAAGAGACAGAAGGC
Pan_troglodytes|13792               ACACGGAGAAATTACATGTGGACCCAAACAGACTCCTTTTTCCTGAAAGAGACAGAAGGC
                                    .* .*.**.** ***:* ***** **. * *..:.  *  **   *...* .* ** *.*

Tarsius_syrichta|13855              TGGCACACCACTTCCCTTTTCCCACTTTTCCCAAACCCA---------GGACCGAGAGAA
Tupaia_belangeri|17270              TGGTATACCACCTCCCTCTTCCCGCTTTTCCCAAACCCA---------GGGCCAAGGGAG
Dipodomys_ordii|4073                TGGCACACCAATTCCCTTTTTCCACTTTTCCCAAACCCA---------GGACCAAGGGAA
Spermophilus_tridecemlineatus|13217 TGGCACACCACTTCCCTTTTTCCACTTTTCCCAAACCCA---------GGACCAAGGGAA
Otolemur_garnettii|6861             TGGCACACTACTTCCCTTTTTCCACTTTTCCCAAACCCA---------GGACCGAGGGAA
Microcebus_murinus|6370             TGGCACACCACGTCCCTCTTTCCACTTTTCCCAAACCCG---------GGACCGAGGGAA
Oryctolagus_cuniculus|25012         TGGCACACCAACTCCCTCTTCCCACTGTTCCCGAACCCG---------GGACCGAGGGAG
Ochotona_princeps|13529             TGGCATACCACCTCCCTTTTTCCGCTCTTCCCGAACCCA---------GGACCAAGGGAG
Mus_musculus|16778                  TGGCATACCACTTCACTTTTTCCACTTTTTCCAAGCCCC---------GGACCGCGGGAA
Rattus_norvegicus|5070              TGGCACACCGCTTCTCTTTTCCCGCTTTTCCCAAGCCCA---------GGACCAAGGGAA
Cavia_porcellus|15563               TGGCACACCACTTCCCTTTTTCCACTTTTCCCAAGCCCA---------GGACCACGGGAG
Callithrix_jacchus|20559            TGGCACACTACTTCCCTTTTC---CTCTTTCCCAAACCCAGGACCAACTCCTCGAGGTGG
Gorilla_gorilla|28689               TGGCACACTACTTCCCTTTTCCCGCTTTTCCCAAACCCG---------GGACCAAGGGAA
Homo_sapiens|30539                  TGGCACACTACTTCCCTTTTCCCGCTTTTCCCAAACCCA---------GGACCAAGGGAA
Pan_troglodytes|13792               TGGCACACTACTTCCCTTTTCCCGCTTTTCCCAAACCCA---------GGACCAAGGGAA
                                    *** * ** .. ** ** **    ** ** ** *..**              *..*. ..

Tarsius_syrichta|13855              CCTACATCCCCTGATGGTGGAGAACCGGGGTACATCAAAGAAGGATTTCTGACTGTACAG
Tupaia_belangeri|17270              CCTACGTCCCCCGACGGCGGAGAGCCAGGGTATATCCGAGAAGGCTTCCTGGCTGTGCAG
Dipodomys_ordii|4073                CCCACATCCCCTGATGGTGGGGAACCTGGGTACATTCGCGAAGGCTTCCTGGTGGTGCAG
Spermophilus_tridecemlineatus|13217 CCTGCATTCCCTGATGGTGGGGAACCTGGATACATCCGCGAAGGCTTCTTGGCAGTGCAA
Otolemur_garnettii|6861             CCTACGTCCCCTGATGGTGGAGAACCTGGATACATCCGAGAAGGCTTCTTGGCTGTGCAG
Microcebus_murinus|6370             CCTACGTCCGCTGACGGCGGAGAACCCGGGTACATCCGAGAGGGTTTCTTGGCTGTGCAG
Oryctolagus_cuniculus|25012         CCTGCGTCGCCCGACGGCGGAGAGCCCGGGTACGTCCGGGAGGGCTTCCTGGCCGTGCAG
Ochotona_princeps|13529             CCTTCGTCCCCCGACGGCGGAGAGCCCGGGTACATCCGGGAGGGCTTCCTGGCTGTCCAG
Mus_musculus|16778                  CCTTCATCACCTGATGGCGGTGAACCTGGATACATTCGGGAAGGCTTCCTGGCCATGCAA
Rattus_norvegicus|5070              CCTTCATCACCTGATGGCGGTGAACCGGGGTACATCCGTGAGGGCTTCCTGGCAGTGCAA
Cavia_porcellus|15563               CCTGCATCCCCTGATGGTGGGGAGCCTGGGTACATCCACGAGGGCTTCCTGGCAGTGCAG
Callithrix_jacchus|20559            CCGGGCCGTCCTCTGCTCCCGCACACAGGGTACATCCGGGAAGGCTTCCTGGCCGTGCAG
Gorilla_gorilla|28689               CCTACATCCCCTGATGGCGGAGAACCTGGGTACATCCGGGAAGGCTTCCTGGCCGTGCAG
Homo_sapiens|30539                  CCTACATCCCCTGATGGCGGAGAACCTGGGTACATCCGGGAAGGCTTCCTGGCCGTGCAG
Pan_troglodytes|13792               CCTACATCCCCTGATGGCGGAGAACCTGGGTACATCCGGGAAGGCTTCCTGGCCGTGCAG
                                    **        *  :        * .* **.** .* .. **.** **  **.  .* **.

Tarsius_syrichta|13855              CATTCCTTAGATAAGGCCATCATGGTATATCACAATGGCAGAGCCATAGAAAGGATATTT
Tupaia_belangeri|17270              CATGCCGTGGACAGAGCCATCATGCACTACCACGCAAACACCTCCGCGCACCAGCTGTTC
Dipodomys_ordii|4073                CATGCTGTGGACAAAGCCATCATGCACTACCATGCCAATGCCTCCACACAGCAGCTCTTC
Spermophilus_tridecemlineatus|13217 CACGCCGTGGACAAGGCCATCATGTACTACCACGCCAATGCCTCTGCGCATCAGCTGTTC
Otolemur_garnettii|6861             CATGCCGTGGACAGAGCCATCATGCAGTACCATGCAGAAGCAGCCACGCACCAGCTTTTC
Microcebus_murinus|6370             CATGCTGTGGACAGAGCCATCATGCAGTACCACGCGGACGCCGCCACGCGCCAGCTGTTC
Oryctolagus_cuniculus|25012         CACGCCGTGGACAGAGCCATCATGCACTATCACGCCAACGCCTCTGCCCAGCAGCTCCTG
Ochotona_princeps|13529             CACGCAGTGGACCGAGCCATCATGCAGTATCACGCCAACGCATCCGCACACCAGCTCTTC
Mus_musculus|16778                  CATGCTGTAGACAAAGCCATCATGCGTTACCATGCCAACACCTCTGCACAGCAGCTGTTC
Rattus_norvegicus|5070              CACGCTGTAGACAAAGCCATCATGCATTACCATGCCAACGCCTCTGCACACCAGCTGTTC
Cavia_porcellus|15563               CATGCCGTGGACCGAGCCATCATGCAGTACCATGCCAACACGTCAGCACACCAGCTCTTC
Callithrix_jacchus|20559            CACGCCGTGGACCGAGCCATCATGCAGTACCATGCCGATGCTGCCACGCACCAGCTGTTC
Gorilla_gorilla|28689               CATGCTGTGGACCGGGCCATCATGGAGTACCATGCCGATGCCACCACACGCCAGCTGTTC
Homo_sapiens|30539                  CATGCTGTGGACCGGGCCATCATGGAGTACCATGCCGATGCCGCCACACGCCAGCTGTTC
Pan_troglodytes|13792               CATGCCGTGGACCGGGCCATCATGGAGTACCATGCCGATGCCGCCACACGCCAGCTGTTC
                                    **  *  *.** ...*********   ** ** .. .. .   * .   . ..*.*  * 

Tarsius_syrichta|13855              GATAATGTCACCATTCTTGTTAAGAGATTTCCATACCTG---CTTATTATAGATTCCTTT
Tupaia_belangeri|17270              CAGAAGCTCACGGTGATGGCAAAGAGGTTCCCGTACCCACCCTTCATCTCGGACCCCTTC
Dipodomys_ordii|4073                CAGAAACTCACGGTCAAGGCAAAGAGGTTCCCTTTCCCACCATACATCTCAGACCCCTTC
Spermophilus_tridecemlineatus|13217 CAGAAACTCACTGTGGTCGCCAAGAGATTCCCGTTTCCACCATTTATCTCAGACCCCTTC
Otolemur_garnettii|6861             CAGAAGCTCACAGTGATGGCAAAGAGGTTCCCATACCCACCATTCATCTCAGACCCCTTC
Microcebus_murinus|6370             CAGAACCTCACCGTGATTGCGAAGAGGTTCCCATACCCGCCATTTATCTCGGACCCCTTC
Oryctolagus_cuniculus|25012         CAGCAGCTCACGGTGACCGTGAAGAGGTTCCCGTACCCGCCCTTCATCTCCGACCCCTTC
Ochotona_princeps|13529             CAGAAGCTCACGGTGGTTGTCAAGAGGTTCCCGTACCCACCCTTCATCCAGGACCCCTTC
Mus_musculus|16778                  CAGAAGCTCATGGTGATCACCAAAAGGTTCCCGTTCCCACCATACATCTCAGATCCATTC
Rattus_norvegicus|5070              CAGAAGCTCACGGTGATCACCAAAAGGTTCCCGTTCCCGCCATACATCTCAGACCCATTC
Cavia_porcellus|15563               CAGAAGCTCACAGTGACCGCAAAGAGGTTCCCATTCCCCCCGTTTATTTCAGACCCCTTT
Callithrix_jacchus|20559            CAGAGGCTGACCGTCGCCATCAAGAGGTTCCCGTACCCACCGTTTATCGCGGACCCCTTC
Gorilla_gorilla|28689               CAGAGACTGACGGTGACCATCAAGAGGTTCCCGTACCCGCCATTCATCGCAGACCCCTTC
Homo_sapiens|30539                  CAGAGACTGACGGTGACCATCAAGAGGTTCCCGTACCCGCCGTTCATCGCAGACCCCTTC
Pan_troglodytes|13792               CAGAGACTGACGGTGACCATCAAGAGGTTCCCGTACCCGCCATTCATCGCAGACCCCTTC
                                     * ..  * *  .*    .  **.**.** ** *: *      : **    **  *.** 

Tarsius_syrichta|13855              GTGGGCATTTTTGGCTTTCTTCTCTTGACACTTTTATTTATATTTTTTCAA---AATTCA
Tupaia_belangeri|17270              CTCATCGCCATCCAGTACCAGCTGCCACTGCTGCTCACGCTGAGCTTTACCTACACCTCG
Dipodomys_ordii|4073                CTTATCGCCATCCAGTACCAGCTTCCCCTGCTACTCATGCTGAGCTTCACCTACACTTCC
Spermophilus_tridecemlineatus|13217 CTTGTTGCCATCCAGTACCAGCTGCCCCTGCTGCTCATGTTGAGCTTCACCTACACCTCC
Otolemur_garnettii|6861             CTAGTTGCCATCCAGTACCAGCTCCCACTGCTGCTGATGCTCAGCTTCACCTATTCCTCA
Microcebus_murinus|6370             CTGGCTGCCATCCAGTACCAGCTCCCGCTGCTTCTCATGCTCAGCTTCACCTATGCCTCG
Oryctolagus_cuniculus|25012         CTGGTGGCCATCCAGTACCAGCTGCCCCTGCTGCTGCTGCTGAGCTTCACCTACGCCTCG
Ochotona_princeps|13529             CTGGTGGCCATCCAGTACCAGCTGCCCCTGCTGCTCATGCTCAGCTTCACCTACGCCTCC
Mus_musculus|16778                  CTCATTGCCATCCAGTACCAGCTTCCTCTGCTGCTCATGCTGAGTTTCACCTACACCTCC
Rattus_norvegicus|5070              CTCATTGCCATCCAGTACCAGCTTCCTCTGCTGCTCATGCTGAGCTTCACCTACACCTCC
Cavia_porcellus|15563               CTCGTTGCCATCCAGTACCAGCTTCCCCTGCTACTCATGCTGAGCTTCACCTACACATCC
Callithrix_jacchus|20559            CTCGTGGCCATCCAGTACCAGCTGCCCCTGCTGCTGCTGCTCAGCTTCACCTACACCACA
Gorilla_gorilla|28689               CTCGTGGCCATCCAGTACCAGCTGCCCCTGCTGCTGCTGCTCAGCTTCACCTACACCGCG
Homo_sapiens|30539                  CTCGTGGCCATCCAGTACCAGCTGCCCCTGCTGCTGCTGCTCAGCTTCACCTACACCGCG
Pan_troglodytes|13792               CTCGTGGCCATCCAGTACCAGCTCCCCCTGCTGCTGCTGCTCAGCTTCACCTACACCGCG
                                     * .  .  :*  . *: *: **    . .**  *     * :  ** ...    .  * 

Tarsius_syrichta|13855              CTTTCCCTCATCCAGACCATTGCAACAGAAAAGGAAAAGAAATTAAAGNNNNNNNNNNNN
Tupaia_belangeri|17270              CTGGCCATCATCCGGGCCGTGGTGCAGGAGAAGGAGAGGAAGCTGAAGNNNNNNNNNNNN
Dipodomys_ordii|4073                CTCACCATCATCCGGTCCGTGGTGCAGGAGAAAGAGAGAAAACTAAAGGAGTACATGCAC
Spermophilus_tridecemlineatus|13217 CTCTCCATCATCCGGGCTGTGGTGCAGGAGAAAGAGAGAAGACTAAAGGAGTACATGCGC
Otolemur_garnettii|6861             CTCACCATCACACGGGCTATCGTGCAGGAGAAAGAGAGGAAGCTGAAGGAGTACATGCGC
Microcebus_murinus|6370             CTCACCATCACGCGGGCCGTCGTGCAGGAGAAAGAGAGGAAGCTGAAGGAGTACATGCGC
Oryctolagus_cuniculus|25012         CTCACCATCATCCGGGCGGTGGTGCAGGAGAAGGAGCGCAAGCTGAAGGAGTACATGCGC
Ochotona_princeps|13529             CTCACCATCGTCCGGGCCCTGGTGCAGGAGAAGCAGCACAAGCTGAAGGAGTACATGCGC
Mus_musculus|16778                  CTCACCATCATCCGGGCTGTGGTGCAGGAGAAGGAGAAAAAACTAAAGGAGTACATGCGC
Rattus_norvegicus|5070              CTCACCATCATCCGGGCTGTGGTGCAGGAGAAAGAGAAAAAACTAAAGGAGTACATGCGC
Cavia_porcellus|15563               CTCACCATCATCCGGGCTGTGGTGCAGGAGAAAGAGAGAAAATTGAAGGAGTACATGCGC
Callithrix_jacchus|20559            CTCACCATTGCCCGCGCTGTCGTGCAGGAGAAGGAGAGGAGGCTGAAGGAGTACATGCGC
Gorilla_gorilla|28689               CTCACCATTGCCCGTGCTGTCGTGCAGGAGAAGGAAAGGAGGCTGAAGGAGTACATGCGC
Homo_sapiens|30539                  CTCACCATTGCCCGTGCTGTCGTGCAGGAGAAGGAAAGGAGGCTGAAGGAGTACATGCGC
Pan_troglodytes|13792               CTCACCATTGCCCGTGCTGTCGTGCAGGAGAAGGAAAGGAGGCTGAAGGAGTACATGCGC
                                    **  **.* .  *.  *  * * ....**.**. *... *.. *.***. ..   ..   

Tarsius_syrichta|13855              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17270              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|4073                ATGATGGGGCTCAGCAGCTGGCTGCACTGGACCGCATGGTTCCTCATGTTCTTCTTCTTC
Spermophilus_tridecemlineatus|13217 ATGANNNNNNNNNNCAGCTGGCTGCACTGGAGCGCT------------------CTCATG
Otolemur_garnettii|6861             ATGATGGGGCTCAGCAACTGGCTGCACTGGAGCGCTTGGTTCCTCCTCTTCTTCCTCTTC
Microcebus_murinus|6370             ATGATGGGGCTCAGCAACTGGCTGCACTGGAGCGCTTGGTTCCTCCTTTTCTTCCTCTTC
Oryctolagus_cuniculus|25012         ATGCTGGGGCTGGACAGCTGGGTGCACTGGAACGCATGGTTCCTCATGTTCTTCCTTGTC
Ochotona_princeps|13529             ATGCTGGGGCTGGACAGCTGGCTGCACTGGAGCGCATGGTTCCTCGTGTTCTTCCTCGTC
Mus_musculus|16778                  ATGATGGGGCTTAACAGCTGGCTACACTGGAGCGCTTGGTTCCTCATGTTCTTCCTATTC
Rattus_norvegicus|5070              ATGATGGGGCTCAGCAGCTGGCTACACTGGAGCGCTTGGTTCCTCATGTTCCTCCTGTTC
Cavia_porcellus|15563               ATGATGGGGCTCAGCAGCTGGCTTCACTGGAGTGCCTGGTTCCTCATGTTCTTCCTCTTC
Callithrix_jacchus|20559            ATGATGGGGCTCAGCAGCTGGCTGCACTGGAGCGCCTGGTTCCTCGTGTTCTTCCTCTTC
Gorilla_gorilla|28689               ATGATGGGGCTCAGCAGCTGGCTGCACTGGAGTGCCTGGTTCCTCTTGTTCTTCCTCTTC
Homo_sapiens|30539                  ATGATGGGGCTCAGCAGCTGGCTGCACTGGAGTGCCTGGTTCCTCTTGTTCTTCCTCTTC
Pan_troglodytes|13792               ATGATGGGGCTCAGCAGCTGGCTGCACTGGAGTGCCTGGTTCCTCTTGTTCTTCCTCTTC
                                     .. ..... .       ... .    ...   .                     .  . 

Tarsius_syrichta|13855              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17270              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|4073                CTCCTCATCGCAGTCTCCTTCATGACCTTTCTCCTGTGCATCAAGGTGAAAAAGGACATA
Spermophilus_tridecemlineatus|13217 CTCCTCCTCATCGTGGTCTCCATGACCCTGCTCTTCTGCGTCAAGGTGAAGAAGGACGTG
Otolemur_garnettii|6861             CTCCTCATCACCGTCTCTTTCATGACCCTGCTCTTTTGCATCAAGGTGAAAAAGGATGTG
Microcebus_murinus|6370             CTCCTCGTGGCTGTCTCCCTGATGACCCTGCTTCTCTGTATCAAGGTGAAGAAGGATGTG
Oryctolagus_cuniculus|25012         CTCCTCGTCGTGGTCTCCTTCATGACGCTTCTCTTCTGCGTCAAGGTGAAGACGGGCGTG
Ochotona_princeps|13529             CTGCTGGTCGTGGTCTCCCTCATGACCCTGCTCTTCTGTATCAGGGTGAAGAAGGGTGTG
Mus_musculus|16778                  TTCCTCATCGTGGTCTCCTTCATGACCCTCCTGTTCTGTGTCAAAGTGAAGAAGGACATA
Rattus_norvegicus|5070              TCCCTCATCGTGGTCTCCTTCATGACCCTCCTGTTCTGTGTCAAAGTAAGGGAAGAAGAG
Cavia_porcellus|15563               CTCCTCATCGCAGTGTCCTTCATGACGCTCCTCTTCTGTGTCAAGGTGAAGAAGGATGTG
Callithrix_jacchus|20559            CTCCTCATCGCCTCCTCCTTCATGACTCTGCTATTCTGTGTCAAGGTGAAGCCAGATGCG
Gorilla_gorilla|28689               CTCCTCATCGCCGCCTCCTTCATGACCCTGCTCTTCTGTGTCAAGGTGAAGCCAGATGTA
Homo_sapiens|30539                  CTCCTCATCGCCGCCTCCTTCATGACCCTGCTCTTCTGTGTCAAGGTGAAGCCAAATGTA
Pan_troglodytes|13792               CTCCTCATCGCCGCCTCCTTCATGACCTTGCTCTTCTGTGTCAAGGTGAAGCCAAATGTA
                                        .  .              ..    .  .  . ..  .    ..             

Tarsius_syrichta|13855              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17270              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|4073                GCAGTGCTCTCAAGCAGTGACCCTTCTCTGGTGCTGGTCTTCCTATTGTGCTTTGCCATC
Spermophilus_tridecemlineatus|13217 GCAGTGCTCTCAAGCAGTGACCCCTCCCTGGTGCTGGCCTTCCTGCTGTGTTTTGCCATC
Otolemur_garnettii|6861             GCTGTACTGTCACACAGTGAGCCCTCACTGGTGCTGGCCTTTCTCGTGTGCTTTGCCATC
Microcebus_murinus|6370             GCGGTGCTGGCTCACAGCGAGCCCTCTCTGGTGCTGGCCTTCCTGGTGTGCTTTGCCGTC
Oryctolagus_cuniculus|25012         GCCGTGCTGACCAACAGTGACCCCTCCCTGGTGCTGGCCTTCCTGCTCTGCTTCGCCACC
Ochotona_princeps|13529             GCCGTGCTGACCAGCAGCGACCCTTCACTGGTGCTAGCCTTCCTGCTATGTTTCGCCATC
Mus_musculus|16778                  GCAGTCCTTTCCAACAGCGACCCCTCCCTGGTCCTGGCGTTCCTGCTGTGTTTTGCAATC
Rattus_norvegicus|5070              GGTGCAGAGAGCTCCACAACCCCTGAGCTCAGGGCAAGTNTCCTGCTGTGTTTTGCAATC
Cavia_porcellus|15563               GCAGTACTCTCGAGGAGTGACCCCTCTCTGGTACTGGTCTTCCTGTTGTGTTTTGCCATT
Callithrix_jacchus|20559            GCCGTGCTGTCCCGCAGCAACCCCTCCCTGGTGCTGGCCTTCCTGCTCTGCTTCGCCGTC
Gorilla_gorilla|28689               GCCGTGCTGTCCCGCAGCGACCCCTCCCTGGTGCTGGCCTTCCTGCTGTGCTTCGCCATC
Homo_sapiens|30539                  GCCGTGCTGTCCCGCAGCGACCCCTCCCTGGTGCTCGCCTTCCTGCTGTGCTTCGCCATC
Pan_troglodytes|13792               GCCGTGCTGTCCCGCAGCGACCCGTCCCTGGTGCTCGCCTTCCTGCTGTGCTTCGCCATC
                                    .  .                        .          ..  .  . .. .. .     

Tarsius_syrichta|13855              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------------
Tupaia_belangeri|17270              NNN---------------------------------------------------------
Dipodomys_ordii|4073                TCCTCCATCTCCTTCAGCTTCATGGTCAGCACTTTCTTCAAT------------------
Spermophilus_tridecemlineatus|13217 TCCTCCATCTCCTTTAGCTTCATGGTCAGCACCTTCTTCAGC------------------
Otolemur_garnettii|6861             TCCTCCATCTCCTTCAGCTTCATGGTCAGCACCTTCTTCAAT------------------
Microcebus_murinus|6370             GCCTCCATCTCCTTCAGCTTCATGGTCAGCACCTTCTTCAGT------------------
Oryctolagus_cuniculus|25012         TCTTCCATCTCCTTCAGCTTCATGGTCAGCACCTTCTTCAGT------------------
Ochotona_princeps|13529             TCCTCCATCTGCTTCAGCTTCATGGTCAGCACCTTCTTCAGT------------------
Mus_musculus|16778                  TCCTCCATTTCCTTCAGCTTCATGGTCAGCACCTTCTTCAGTAAAGCCAACATAGCAGCA
Rattus_norvegicus|5070              TCCTCCATTTCCTTCAGCTTCATGGTCAGCACCTTCTTCAGTAAAGCCAACATGGCAGCA
Cavia_porcellus|15563               TCCTCCATCTCCTTCAGCTTCATGGTCAGCACATTCTTCAGTAAAGCCAACATGGCAGCG
Callithrix_jacchus|20559            TCTACCATCTCTTTCAGCTTCATGGTCAGCACCTTCTTCAGCAAAGCCAACATGGCGGCA
Gorilla_gorilla|28689               TCTACCATCTCCTTCAGCTTCATGGTCAGCACCTTCTTCAGCAAAGCCAACATGGCAGCA
Homo_sapiens|30539                  TCTACCATCTCCTTCAGCTTCATGGTCAGCACCTTCTTCAGCAAAGCCAACATGGCAGCA
Pan_troglodytes|13792               TCTACCATCTCCTTCAGCTTCATGGTCAGCACCTTCTTCAGCAAAGCCAACATGGCAGCA
                                                                                                

Tarsius_syrichta|13855              ------------------------------------------------------------
Tupaia_belangeri|17270              ------------------------------------------------------------
Dipodomys_ordii|4073                ------------------------------------------------------------
Spermophilus_tridecemlineatus|13217 ------------------------------------------------------------
Otolemur_garnettii|6861             ------------------------------------------------------------
Microcebus_murinus|6370             ------------------------------------------------------------
Oryctolagus_cuniculus|25012         ------------------------------------------------------------
Ochotona_princeps|13529             ------------------------------------------------------------
Mus_musculus|16778                  GCCGTGGGTGGCTTCCTGTACTTCTTCACCTATACCCCCTACTTTTTCGTGGCTCCTCGG
Rattus_norvegicus|5070              ACCGTGGGCGGCTTCCTTTACTTCTTCACCTACACCCCTTACTTTTTCGTGGCTCCTCGG
Cavia_porcellus|15563               GCTGTGGGCGGCTTCCTGTACTTCTTCACATATATTCCCTACTTCTTCGTGGCTCCCCAC
Callithrix_jacchus|20559            GCCTTCGGCGGCTTCCTCTATTTCTTCACCTACATTCCCTACTTCTTTGTGGCCCCTCGG
Gorilla_gorilla|28689               GCCTTCGGAGGCTTCCTCTACTTCTTCACCTACATCCCCTACTTCTTCGTGGCCCCTCGG
Homo_sapiens|30539                  GCCTTCGGAGGCTTCCTCTACTTCTTCACCTACATCCCCTACTTCTTCGTGGCCCCTCGG
Pan_troglodytes|13792               GCCTTCGGAGGCTTCCTCTACTTCTTCACCTACATCCCCTACTTCTTCGTGGCCCCTCGG
                                                                                                

Tarsius_syrichta|13855              ------------------------------------------------------------
Tupaia_belangeri|17270              ------------------------------------------------------------
Dipodomys_ordii|4073                ------------------------------------------------------------
Spermophilus_tridecemlineatus|13217 ------------------------------------------------------------
Otolemur_garnettii|6861             ------------------------------------------------------------
Microcebus_murinus|6370             ------------------------------------------------------------
Oryctolagus_cuniculus|25012         ------------------------------------------------------------
Ochotona_princeps|13529             ------------------------------------------------------------
Mus_musculus|16778                  TACAACTGGATGACACTGAGTCAAAAGCTCTTGTCCTGTCTCCTATCTAATGTTGCCATG
Rattus_norvegicus|5070              TACAACTGGATGACACTGAGTCAGAAGCTCTTGTCCTGCCTCCTATCTAATGTTGCCATG
Cavia_porcellus|15563               TACAACTGGATGACCCTGAGCCAGAAGCTCTTGTCCTGTCTCCTGTCCAATGTTGCCATG
Callithrix_jacchus|20559            TACAACTGGATGACTCTGAGCCAGAAGCTCTGCTCCTGCCTCCTGTCCAACGTCGCCATG
Gorilla_gorilla|28689               TACAACTGGATGACTCTGAGCCAGAAGCTCTGCTCCTGCCTCCTGTCTAACGTCGCCATG
Homo_sapiens|30539                  TACAACTGGATGACTCTGAGCCAGAAGCTCTGCTCCTGCCTCCTGTCTAATGTCGCCATG
Pan_troglodytes|13792               TACAACTGGATGACTCTGAGCCAGAAGCTCTGCTCCTGCCTCCTGTCTAACGTCGCCATG
                                                                                                

Tarsius_syrichta|13855              ------------------------------------NNNNGCACAGGCATCCAGTGGCGA
Tupaia_belangeri|17270              ------------------------------------NNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|4073                ------------------------------------AAAGNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|13217 ------------------------------------AAAGNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|6861             ------------------------------------AAAGGCACAGGCATCCAGTGGCAA
Microcebus_murinus|6370             ------------------------------------AAAGGCACAGGCATCCAGTGGCGA
Oryctolagus_cuniculus|25012         ------------------------------------AAAGGCACGGGCATCCAGTGGCGA
Ochotona_princeps|13529             ------------------------------------AAAGGCACGGGCATCCAGTGGCGA
Mus_musculus|16778                  GCAATGGGAGCCCAGCTCATAGGAAAATTCGAAGCCAAAGGCACTGGCATCCAGTGGCGG
Rattus_norvegicus|5070              GCGATGGGAGCCCAGCTCATCGGAAAATTTGAAGCCAAAGGCACTGGCATCCAGTGGTGT
Cavia_porcellus|15563               GCAATGGGAGCCCAGCTCATAGGAAAATTTGAAGCCAAAGGCACAGGCATCCAGTGGCAA
Callithrix_jacchus|20559            GCAATGGGAGCCCAGCTCATTGGGAAATTTGAGGCGAAAGGCGTGGGCATCCAGTGGCAA
Gorilla_gorilla|28689               GCAATGGGAGCCCAGCTCATTGGGAAATTTGAGGCGAAAGCCAGCTTCCTGAGACATTCA
Homo_sapiens|30539                  GCAATGGGAGCCCAGCTCATTGGGAAATTTGAGGCGAAAGGCATGGGCATCCAGTGGCGA
Pan_troglodytes|13792               GCAATGGGAGCCCAGCTCATTGGGAAATTTGAGGCGAAAGGCATGGGCATCCAGTGGCGA
                                                                           .         .          

Tarsius_syrichta|13855              GACCTCCTAAGTCCTGTCAATGTGGATGACGACTTCTGCTTCGGGCAAGTGCTGGGGATG
Tupaia_belangeri|17270              NNNNNNNNNNNNNNNNNNAGCGTGGGAGGGGAGTTCAACTTCACGCAGGTGCTGCTAATG
Dipodomys_ordii|4073                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|13217 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|6861             GACCTCCTGAGCCCTGTCAGCGTGGACGATGACTTCTGCTTTGGGCATGTGCTTGGGATG
Microcebus_murinus|6370             GACCTCCTGAGCCCTGTCAGCGTGGACGATGACTTCTGCTTCGGGCAAGTGCTGGGGATG
Oryctolagus_cuniculus|25012         GACCTCCTGAGTCCGGTCAGCGTGGACGATGACTTCTGCTTTGGCCACGTATTGGGGCTG
Ochotona_princeps|13529             GACCTCCTGAGCCCAGTCAGTGTGGACGACGACTTCTGCTTTGGGCAAGTGCTGGGAATG
Mus_musculus|16778                  GACCTCCTCAACCCTGTCAACGTGGACGACAATTTCTGCTTTGGACAAGTGCTGGGGATG
Rattus_norvegicus|5070              GACCTCCTGAACCCTGTCAACGTAGATGATGATTTCTGCTTTGGACAAGTGCTGGGGATG
Cavia_porcellus|15563               AACCTCCTGAGTCCTGTGAATGTGGACGATGATTTCTGCTTTGGTCAAGTGCTAGGAATG
Callithrix_jacchus|20559            GACCTCCTGAGTCCCGTCAACGTGGATGATGACTTCTGCTTCGGGCAGGTGCTGGGAATG
Gorilla_gorilla|28689               AAATTATTACATCAGCTGGGTTTCGAGGAC---TTTTCATCAACCACTGCTCTTGCCATG
Homo_sapiens|30539                  GACCTCCTGAGTCCCGTCAACGTGGACGACGACTTCTGCTTCGGGCAGGTGCTGGGGATG
Pan_troglodytes|13792               GACCTCCTGAGTCCCGTCAACGTGGACGACGACTTCTGCTTTGGGCAGGTGCTGGGGATG
                                        .  .        .     . .  .     ..    .        .   .     ..

Tarsius_syrichta|13855              CTGCTGCTGGACTCTGTGCTCTACGGCCTGGTGACCTGGTACGTGGAGGCCGTCTTCCCA
Tupaia_belangeri|17270              CTCCTGCCGGACTCCCTGCTCTACTGCCTGCTCACC---TACGTGGAGTCCGTCCTCCCC
Dipodomys_ordii|4073                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|13217 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|6861             CTGCTGTTAGACTCTGTGCTCTATGGTCTGGCTACCTGGTACGTGGAAGCCGTCTTCCCT
Microcebus_murinus|6370             CTGCTGCTGGACTCTGTGCTCTACGGCATGGCCGCCTGGTACGTGGAGGCCGTCTTCCCA
Oryctolagus_cuniculus|25012         CTGCTGCTGGACTCCGTGCTCTATGGCCTGGTCACCTGGTACGTGGAGGCTGTCTTCCCG
Ochotona_princeps|13529             CTGCTGCTGGACTCCGTGCTCTACGGCCTGGTCACCTGGTACGTGGAGGCCGTCTTCCCT
Mus_musculus|16778                  CTGCTGCTGGACTCAGCACTCTATGGCCTGGTGACCTGGTACGTGGAGGCTGTCTTCCCA
Rattus_norvegicus|5070              CTGCTGCTGGATTCAGTACTCTATGGCCTGGTGACCTGGTACGTGGAGGCCGTCTTCCCA
Cavia_porcellus|15563               CTGTTGCTGGACTCTGTGCTATATGGTCTGGTGACCTGGTACATGGAGGCCGTTTTCCCA
Callithrix_jacchus|20559            CTGCTGCTGGACTCCGTGCTCTACGGCCTGGTGGCCTGGTATGTGGAGGCCGTCTTCCCA
Gorilla_gorilla|28689               CAGTTCCTAGCTGCAGCTTGCAAAGGTCTGGGTCTGTGGAAGGAGATATCTGTGTTTCCA
Homo_sapiens|30539                  CTGCTGCTGGACTCTGTGCTCTATGGCCTGGTGACCTGGTACATGGAGGCCGTCTTCCCA
Pan_troglodytes|13792               CTGCTGCTGGACTCTGTGCTCTATGGCCTGGTGACCTGGTACATGGAGGCCGTCTTCCCA
                                        .    .               .  ..              .      ..  .    

Tarsius_syrichta|13855              GGGCAGTTCGGTGTGCCCCAGCCCTGGTACTTCTTC---GTCATGCGCTCTTACTGGTTT
Tupaia_belangeri|17270              GGGAAGTACGGGACGCCCAAGCCCTGGTACTTCTTC---CTTCTGCCCTCGTATTGGCGC
Dipodomys_ordii|4073                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNCCCTCCTACTGGTGC
Spermophilus_tridecemlineatus|13217 NNNNNNNNNNNNNNGCCCCAGCCCTGGTACTTCTTC---CTCATGCCCTCCTACTGGTGT
Otolemur_garnettii|6861             GGGCAGTTTGGTGTGCCCCAGCCCTGGTACTTCTTT---GTCATGCCCTCATATTGGTGT
Microcebus_murinus|6370             GGGCAGTTCGGCGTGCCCCAGCCCTGGTACTTCTGC---GTCCTGCCCTCATATTGGTTC
Oryctolagus_cuniculus|25012         GGGCAGTTCGGCGTGCCGCAGCCATGGTACTTCTTC---ATCATGCCCTCGTACTGGTGT
Ochotona_princeps|13529             GGGCAGTTCGGCATGCCCCAGCCATGGTACTTCTTC---ATCATGCCCTCATACTGGTGC
Mus_musculus|16778                  GGCCAGTTTGGCGTACCCCAGCCCTGGCACTTCTTC---CTTATGCCCTCCTACTGGTGT
Rattus_norvegicus|5070              GGCCAGTTTGGCGTGCCCCAGCCCTGGTACTTCTTC---CTTATGCCCTCCTACTGGTGT
Cavia_porcellus|15563               GGCCAGTTTGGTGTGCCCCAGCCCTGGTACTTCTTC---CTCCTGCCATCCTACTGGTGT
Callithrix_jacchus|20559            GGGCAGTTCGGTGTGCCTCAGCCCTGGTACTTCTTC---ATCATGCCCTCCTATTGGTGT
Gorilla_gorilla|28689               TGTTTACTCGGGATCGGGGTTCCACAAGTATTTATCAAGTGTCCACCCTCCTATTGGTGT
Homo_sapiens|30539                  GGGCAGTTCGGCGTGCCTCAGCCCTGGTACTTCTTC---ATCATGCCCTCCTATTGGTGT
Pan_troglodytes|13792               GGGCAGTTTGGCGTGCCTCAGCCCTGGTACTTCTTC---ATCATGCCCTCCTATTGGTGT
                                     .       ..                   ..             * .** ** ***   

Tarsius_syrichta|13855              GGGGAATCA---------TCTGAGAAAAAAACTGAAAAAAATCAATCTTATGAGACATTT
Tupaia_belangeri|17270              GGGAGCCCACGGACGGCCCTGGGGAAGGAAGACGATGACAGCGACCCTGAGAAAGTTCTG
Dipodomys_ordii|4073                GGGAGCCCAAGAACAGTGGTTGGAAAAGAGGAAGAAGACAGTGACCCTGAGAAAGCTCTC
Spermophilus_tridecemlineatus|13217 GGGAACCCGAGGACAGTTGTTGGGAAAGAAGAAGAAGACAGTGACCCTGAGAAAGCTCTC
Otolemur_garnettii|6861             GGGAACCCAAGGACAGTCATAGGGAAAGAGGAAGAAGACAGCGACCCTGAAAAAGTACTT
Microcebus_murinus|6370             GGGACCCCGAGGACGGTCGTGGGGAAAAAGGAAGAAGACAATGACCCTGAGAAAGCGCTC
Oryctolagus_cuniculus|25012         GGGAGCCCACGGACAGCCTTGGGGAAAGAA---GAGGACGCCGACCCAGAGAAGGCTCTC
Ochotona_princeps|13529             GCGAGCCCCAGGACAGCCACAGGGAAGGAG---GAGGACGCCGACCCCGAGAAGGGCATC
Mus_musculus|16778                  GGGAACCCAAGAACTGTCGTAGGGAAGGAAGAGGAAGGCAGCGACCCAGAGAAAGCTCTC
Rattus_norvegicus|5070              GGGAACCCAAGAACGGTCGTAGGGAAGGAAGAGGAAGGCGGCGACCCAGAAAAGGCTTTC
Cavia_porcellus|15563               GGAAACCCAAGGATGGTTGTGAGGAAAGAGGAAGAAGACAGTGACCCTGAAAAAGCGTTT
Callithrix_jacchus|20559            GGGAAGCCAAGGACGGTCACGGGGAAGGAGGACGAGGACAGTGACCCCGAGAAGGCGCTG
Gorilla_gorilla|28689               GGGAAGCCAAGGGCGGTTGCAGGGAAGGAGGAAGAAGACAGTGACCCCGAGAAAGCACTC
Homo_sapiens|30539                  GGGAAGCCAAGGGCGGTTGCAGGGAAGGAGGAAGAAGACAGTGACCCCGAGAAAGCACTC
Pan_troglodytes|13792               GGGAAGCCAAGGGCGGTTGCAGGGAAGGAGGAAGAAGACAGTGACCCCGAGAAAGCACTC
                                    * ..   *             ...**..*.   ** ....   *. *  * .*..   * 

Tarsius_syrichta|13855              CAAAGCAAGTATTTTGAAGCTGAACCTACTGATCTGATAGCAGGTATCCAGATCAATCAT
Tupaia_belangeri|17270              CGGACAGAGTTCTTCGAGGCTGAGCCCGAGGACCTGGTGGCCGGGATCAAGATCAAGCAC
Dipodomys_ordii|4073                AGAACGGAGTACTTTGAAGCAGAGCCAGAAGACCTGGTAGCCGGGCTCAAGATCAAGCAT
Spermophilus_tridecemlineatus|13217 AGAACCGAGTACTTTGAAGCTGAGCCCGAGGACTTGGTGGCAGGGATCAAGATCAAGCAT
Otolemur_garnettii|6861             GGGACAGAGTACTTTGAAGCTGAGCCAGAAGACCTGGTGGCTGGAATCAAGATCAAGCAT
Microcebus_murinus|6370             AGGACGGAGTACTTTGAAGCTGAGCCAGAGGACCTGGTGGCCGGGATCAAGATTAAGCAT
Oryctolagus_cuniculus|25012         CCCACGGAGCACTGTGAGGCCGAACCCGAGGCCCTGGTGGCCGGCATCAAGATCAAACAC
Ochotona_princeps|13529             CCCACAGAGCACTGTGAGGCCGAGCCCGAGGCCCTGCTGCCCGGCATCAAGATCAAGCAT
Mus_musculus|16778                  AGGAACGAGTACTTTGAAGCCGAGCCAGAGGACTTGGTAGCTGGAATCAAGATCAAGCAT
Rattus_norvegicus|5070              AGAACCGAGTACTTTGAAGCTGAGCCGGAGGACTTGGCAGCTGGGATCAAGATCAAGCAC
Cavia_porcellus|15563               AGAAGTGAATACTTCGAAGCTGAGCCTGAGGACCTGGTAGCTGGAATCAAGATCAAGCAT
Callithrix_jacchus|20559            AGAACCGAGTACTTTGAAGCTGAGCCAGAGGACCTGGTAGCGGGGATCAAGATCAAGCAC
Gorilla_gorilla|28689               AGAAACGAGTACTTTGAAGCCGAGCCAGAGGACCTGGTGGCGGGGATCAAGATCAAGCAC
Homo_sapiens|30539                  AGAAACGAGTACTTTGAAGCCGAGCCAGAGGACCTGGTGGCGGGGATCAAGATCAAGCAC
Pan_troglodytes|13792               AGAAACGAGTACTTTGAAGCCGAGCCAGAGGACCTGGTGGCGGGGATCAAGATCAAGCAC
                                       *  .*. : *  **.** **.** .. *.  **  . * ** .**.**** ** ** 

Tarsius_syrichta|13855              TTGTGCAAGGTGTTTCACAGAGGAAAAACTAAACACATAGCAGTCAAAGGCCTGACT---
Tupaia_belangeri|17270              TTGTCCAAGGTGTTCCGGGTGGGGGGTGAGGACAAGGCTGCCGTCAGAGACCTGAAC---
Dipodomys_ordii|4073                CTGTCCAAGGTGTTCCGAGTGGGAAATAAGGACAAGGCAGTTGTCAGAGACCTGAAC---
Spermophilus_tridecemlineatus|13217 CTGTCCAAGGTGTTCCAAGTGGGGAATAAGGACAAGACAGCTGTCAGGGACCTAGAACGC
Otolemur_garnettii|6861             CTGTCCAAGGTGTTCAGAGTGGGGAATAAGGACAAAGCGGCTGTCAAAGACCTGAAC---
Microcebus_murinus|6370             CTCTCCAAGGTGTTCAGAGTGGGGAATAAGGAACAGGCGGCTGTCTGGGACCTGAAC---
Oryctolagus_cuniculus|25012         CTGTCCAAGGTGTTCCGCGTGGGGAACAAGGACAGGGCAGCGGTCAGAGATCTGAAC---
Ochotona_princeps|13529             CTGTCCAAGGTGTTCCAAGTGGGGCACAAGGACAGAGCAGCTGTCAGAGACCTGAGC---
Mus_musculus|16778                  CTCTCCAAGGTGTTCCAAGTGGGCAATAAGGACAAGATGGGCATCAGAGACCTGACC---
Rattus_norvegicus|5070              CTGTCCAAGGTGTTCCAAGTGGGTAATAAGGACAAGATGGGCATCAGAGACCTGACG---
Cavia_porcellus|15563               CTGTCCAAGGTCTTTCAAGTGGGAAATAAGGAAAAGGCAGCTGTCAGGGACCTGAGC---
Callithrix_jacchus|20559            CTGTCCAAGGTGTTCAGGGTGGGAAATAAGGACCGGGCGGCCGTCAGAGACCTGAAC---
Gorilla_gorilla|28689               CTGTCCAAGGTGTTCAGGGTGGGGAATAAGGACAGGGCGGCCGTCAGAGACCTGAAC---
Homo_sapiens|30539                  CTGTCCAAGGTGTTCAGGGTGGGAAATAAGGACAGGGCGGCCGTCAGAGACCTGAAC---
Pan_troglodytes|13792               CTGTCCAAGGTGTTCAGGGTGGGAAATAAGGACAGGGCGGCCGTCAGAGACCTGAAC---
                                     * * ****** ** .. . .**  . .. .*... .  *  .**:..*. **..     

Tarsius_syrichta|13855              GTGAATATATACAGAGGGCAGATCACTGTTCTTCTGGGACACAATGGAACAGGAAAAACT
Tupaia_belangeri|17270              TTGAACCTGTACGAGGGGCAGATCACGGTCCTGCTAGGCCACAACGGCGCGGGGAAGACC
Dipodomys_ordii|4073                TTGAACCTGTACGAGGGCCAGATCACTGTCCTGCTGGGTCACAATGGTGCAGGGAAGACT
Spermophilus_tridecemlineatus|13217 GTGAACTTGTATGAGGGGCAGATCACCGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|6861             CTGAACCTGTATGAGGGGCAGATCACTGTCCTGCTAGGCCACAACGGTGCAGGGAAGACC
Microcebus_murinus|6370             CTGAACCTGTATGAAGGGCAGATCACCGTCCTGCTGGGCCACAATGGCGCTGGGAAGACC
Oryctolagus_cuniculus|25012         CTGAACCTGTACGAGGGGCAGGTGACTGTCCTGCTGGGACACAATGGCGCGGGGAAGACC
Ochotona_princeps|13529             CTGAACCTGTACGAGGGGCAGATCACTGTCCTACTGGGCCACAACGGCGCGGGCAAGACC
Mus_musculus|16778                  CTGAACCTCTACGAAGGACAGATAACAGTCCTCCTGGGCCACAATGGTGCTGGGAAGACC
Rattus_norvegicus|5070              CTGAACCTGTATGAAGGACAGATAACAGTCCTCCTGGGCCACAACGGTGCTGGGAAGACC
Cavia_porcellus|15563               CTAAACCTATATGAAGGACAGATTACTGTCCTGCTGGGCCACAATGGAGCAGGAAAGACC
Callithrix_jacchus|20559            CTGAACCTGTACGAGGGGCAGATCACTGTCCTACTGGGCCACAATGGCGCCGGGAAGACC
Gorilla_gorilla|28689               CTCAACCTGTACGAGGGACAGATCACCGTCCTGCTGGGCCACAACGGTGCCGGGAAGACC
Homo_sapiens|30539                  CTCAACCTGTACGAGGGACAGATCACCGTCCTGCTGGGCCACAACGGTGCCGGGAAGACC
Pan_troglodytes|13792               CTCAACCTGTACGAGGGACAGATCACCGTCCTGCTGGGCCACAACGGCGCCGGGAAGACC
                                     * **  * ** ...** ***.* ** **  .  . ..       ..    ..       

Tarsius_syrichta|13855              GCTACCTGCTTTATGCTCACAGGTCTCTATACTGCTACCAGTGGAAATGCCTATATTAAT
Tupaia_belangeri|17270              ACCACGCTGTCCATGCTCACAGGTCTCTTCCCCCCTACCAGTGGACGGGCCTATATTAGT
Dipodomys_ordii|4073                ACCACCCTTTCTGTCCTCACAGGTCTCTATCCTCCTACCAGTGGGCGTGTGTACATCAGT
Spermophilus_tridecemlineatus|13217 NNNNNNNNNNNNNNNNNNNNNNGTCTCTATCCTTCAACCAGTGGAGAGGCCTATGTTTAT
Otolemur_garnettii|6861             ACCACCCTGTCCATGCTCACAGGTCTCTTTCCCCCTACCAGTGGACAGGCGTATATCAGT
Microcebus_murinus|6370             ACCACCTTGTCCATGCTCACTGGTCTCTTTCCCCCTACCAGCGGACAGGCGTACATCAGC
Oryctolagus_cuniculus|25012         ACCACCCTGTCCATGCTCACAGGTCTCTTTCCCCCCACCAGCGGACAGGCGTACATCAGC
Ochotona_princeps|13529             ACCACCCTGTCCATGCTCACAGGTCTCTTTCCCCCTACCAGTGGACAGGCATACATCCGT
Mus_musculus|16778                  ACGACCATGTCTCTGCTGACAGGCCTCTTCCCCCCTACCAGTGGACATGCTTATATTCAT
Rattus_norvegicus|5070              ACGACCATGTCTATGCTGACAGGTCTCTTCCCCCCTACCAGTGGGCATGCTTATATTCGT
Cavia_porcellus|15563               ACCACCCTGTCGATGCTCACAGGACTCTTCCCCCCTACTAGTGGACGTGCCTATATTAGT
Callithrix_jacchus|20559            ACCACCCTTTCCATGCTTACAGGTCTCTTTCCCCCTACCAGTGGACGGGCATATATCAGC
Gorilla_gorilla|28689               ACCACCCTCTCCATGCTCACAGGTCTCTTTCCCCCCACCAGTGGACGGGCATACATCAGC
Homo_sapiens|30539                  ACCACCCTCTCCATGCTCACAGGTCTCTTTCCCCCCACCAGTGGACGGGCATACATCAGC
Pan_troglodytes|13792               ACCACCCTCTCCATGCTCACAGGTCTCTTTCCCCCCACCAGTGGACGGGCATACATCAGC
                                             .   .  .    .* ****: .*  * ** ** **. . *  ** .*  . 

Tarsius_syrichta|13855              GGATATGACATCTCAAAGCAAATGGTCCAGATTAGGAAATCCTTAGGCTTGTGTCCCCAG
Tupaia_belangeri|17270              GGGTACGAGATTTCCCGGGACATGGTTCAGATCCGGAAGAACCTAGGCCTGTGCCCCCAG
Dipodomys_ordii|4073                GGATATGAAATCTCCCAAGACATGGCTCTGATCCGGAAGAGCTTGGGCCTGTGCCCCCAG
Spermophilus_tridecemlineatus|13217 GGATATGAGATCTCACAACACATGACAGAAATCAGGAAATTCTTGGGCTTATGTCCCCAA
Otolemur_garnettii|6861             GGGTATGAAATTTCCCAAGACATGGTTCAGATCCGGAAGAGCTTGGGTCTGTGCCCCCAG
Microcebus_murinus|6370             GGGTATGAAATTTCCCAGGACATGGTCCAGATTCGGAAGAGCTTGGGTCTGTGCCCGCAG
Oryctolagus_cuniculus|25012         GGGTACGAGATTTCCCAGGACATGCCCCAGATCCGGAAGAGCCTGGGCCTGTGCCCCCAG
Ochotona_princeps|13529             GGCTACGAGATCTCCCAGGACATGGCTTGTATCCGCAAGAGCCTGGGCCTGTGCCCACAG
Mus_musculus|16778                  GGGTACGAAATTTCCCAAGACATGGCTCAGATCCGCAAGAGTTTGGGCCTGTGTCCCCAG
Rattus_norvegicus|5070              GGGTACGAGATTTCCCAAGACATGGTTCAGATCCGCAAGAGTCTGGGCCTGTGCCCCCAG
Cavia_porcellus|15563               GGGTATGAAATTTCCCAAGACATGGTTCAAATCCGGAAGAGCTTGGGCCTGTGCCCCCAG
Callithrix_jacchus|20559            GGGTATGAAATTTCCCAAGACATGGTTCAGATCCGGAAGAGCCTGGGCCTGTGCCCGCAG
Gorilla_gorilla|28689               GGGTATGAAATTTCCCAGGACATGGTTCAGATCCGGAAGAGCCTGGGCCTGTGCCCGCAG
Homo_sapiens|30539                  GGGTATGAAATTTCCCAGGACATGGTTCAGATCCGGAAGAGCCTGGGCCTGTGCCCGCAG
Pan_troglodytes|13792               GGGTATGAAATTTCCCAGGACATGGTTCAGATCCGGAAGAGCCTGGGCTTGTGCCCACAG
                                    ** ** ** ** **.... *.***      ** .* **.:   *.**  *.** ** **.

Tarsius_syrichta|13855              CATGACCTATTGTTTAATCACTTGACAGTGTCAGAACACCTTTATTTCTAT------ATA
Tupaia_belangeri|17270              CACGATGTCCTGTTTGACAACCTGACGGTCACAGAGCACCTCTACTTCTACGCCCAGCTG
Dipodomys_ordii|4073                CATGATGTCCTGTTTGACAACCTGACAGTAGCAGAACATCTCTACTTCTATGCGCAGCTG
Spermophilus_tridecemlineatus|13217 CAGAACCTGTTGTATAACTACTTGACTGTTTCAGAGCACCTTTACCTC---------TTG
Otolemur_garnettii|6861             CATGACATCTTGTTTGACAACCTCACAGTTGTAGAACATCTTTATTTCTACGCTCAGCTG
Microcebus_murinus|6370             CACGACATCCTGTTTGACAACCTCACAGTCGCAGAACATCTTTACTTCTACGCTCAGCTG
Oryctolagus_cuniculus|25012         CACGACGTCCTGTTTGACAACCTGACCGTGGAAGAGCACCTCTCCTTCTACGCCCAGCTG
Ochotona_princeps|13529             CATGACATCCTGTTTGACAACCTCACGGTGGCCGAACATCTTTCCTTTTATGCTCAGCTG
Mus_musculus|16778                  CATGATGTACTGTTTGACAACCTGACAGTTGCCGAACATCTTTACTTCTATGCACAGCTG
Rattus_norvegicus|5070              CATGATGTCCTGTTTGACAACCTGACAGTTGCAGAACACCTTTACTTCTACGCACAGTTG
Cavia_porcellus|15563               CATGATGTCCTGTTTGACAACCTGACAGTTGCAGAACATCTTTGCTTCTATGCACAGCTG
Callithrix_jacchus|20559            CATGACATCCTGTTTGACGGCTTGACAGTTGAAGAGCACCTTTATTTCTATGCCCAGCTG
Gorilla_gorilla|28689               CACGACATCCTGTTTGACAACTTGACAGTCGCAGAGCACCTTTATTTCTACGCCCAGCTG
Homo_sapiens|30539                  CACGACATCCTGTTTGACAACTTGACAGTCGCAGAGCACCTTTATTTCTACGCCCAGCTG
Pan_troglodytes|13792               CACGACATCCTGTTTGACAACTTGACAGTCGCAGAGCACCTTTATTTCTACGCCCAGCTG
                                    ** .*  *  ***:*.*  .* * ** **   .**.** ** *   *           *.

Tarsius_syrichta|13855              AAAGGAATACCTCTAAAGATGCAACCTGTGGAAATTGACCACATGCTGTCTGCATTTAAC
Tupaia_belangeri|17270              AAAGGCTTGTCACGCCAGAAGTGCCCCGAAGAAGTCAAACAGATGCTGCACACCCTGGGC
Dipodomys_ordii|4073                AAAGGCCTGTCACCCCAAAAGTGTCCTGAAGAAGTGAAGCACATGCTGTACGCCCTCAAT
Spermophilus_tridecemlineatus|13217 AAAGGCCTGTCTCAGCAGAAGTGCCCTGAAGAAGTCGAGCAGATGCTGCACATCCTCAAT
Otolemur_garnettii|6861             AAAGGCTTATCGCGCCAGAAGTGCCCTGAAGAAGTCAAGAAGATGCTGCACATCCTCGGT
Microcebus_murinus|6370             AAAGGCTTGTCACGCCAGAAGTGCCCTGAGGAAGTGAAGCAGATGCTGCACATCCTCAGT
Oryctolagus_cuniculus|25012         AAAGGCCTGTCGCCCCACAAGTGCCCCGAGGAAGTCAAGCAGATGCTGCACGTGCTGAGC
Ochotona_princeps|13529             AAAGGCTTGTCGCGCCACAAGTGCCCCGAGGAGGTCAAGCAGATGCTGCATGCGCTCGGC
Mus_musculus|16778                  AAAGGCCTCTCTCTCCAGAAGTGTCCTGAGGAAGTCAAGCAGATGCTACACATCCTCAGC
Rattus_norvegicus|5070              AAAGGCCTCTCTGTCCAGAAGTGTCCTGAAGAGGTCAAGCAGATGCTGCACACCCTCGGG
Cavia_porcellus|15563               AAAGGCTTGTCTCGCCAGAAATGCCCTGAAGAAGTCAAGCAGATGCTACATATCCTTAGT
Callithrix_jacchus|20559            AAGGGCCTGTCGCGCCAGAAATGCCCTGAAGAAGTCAAGGAGATGCTGCACACCCTCGGC
Gorilla_gorilla|28689               AAGGGCCTGTCACGTCAGAAGTGCCCTGAAGAAGTCAAGCAGATGCTGCACATCATCGGC
Homo_sapiens|30539                  AAGGGCCTGTCACGTCAGAAGTGCCCTGAAGAAGTCAAGCAGATGCTGCACATCATCGGC
Pan_troglodytes|13792               AAGGGCCTGTCACGTCAGAAGTGCCCTGAAGAAGTCAAGCAGATGCTGCACATCATCGGC
                                    **.**. *  *    .* *:. . ** *:.**..* .*  * *****. . .   * .. 

Tarsius_syrichta|13855              CTGCTAGAAAAGCGTAATGCGTTTTCACAGACACTGAGTGGAGGAATGAAGCGCAAACTC
Tupaia_belangeri|17270              CTGGAGGACACGCGGGACTCCCGCAGCAGGTTTCTGAGCGGGGGCATGAGGCGCAGGCTC
Dipodomys_ordii|4073                ATGGAGGACAAGCGGAATTCGCCATGCAAGTACCTGAGTGGAGGGATGAAGCGCAAGCTC
Spermophilus_tridecemlineatus|13217 CTGGAGGACAAGCGCAACTCACAGTCCAAGTTCCTGAGTGGAGGCATGAAGCGCAAGCTG
Otolemur_garnettii|6861             CTGGAGGACAAGTGGGCCTCCCGGAGCAGGTTCCTGAGTGGGGGGATGAAGCGCAAGCTC
Microcebus_murinus|6370             CTGGAGGACAAGTGGGACTCCCGGAGCCGGTACCTGAGCGGGGGCATGAAGCGCAAGCTC
Oryctolagus_cuniculus|25012         CTGGAGGACAAGCGTGACTCCCGCTGCCGGTTCCTGAGCGGGGGGATGAAGCGCAAGCTG
Ochotona_princeps|13529             CTGGAGGACAAGCGCCACACCCGGTGCAAGCTGCTGAGTGGGGGGATGAAGCGCAAGCTG
Mus_musculus|16778                  CTGGAGGACAAGCGTGACTTACGGTCCAAGTTCCTGAGTGGGGGCATGAAGCGCAAGCTC
Rattus_norvegicus|5070              CTGGAAGACAAGCGGGACTCAAGGTCCAAGTTCCTGAGCGGGGGGATGAAGCGCAAGCTC
Cavia_porcellus|15563               CTGGAGGACAAGCGGAACTCACTGTGCAGGTTCCTCAGTGGGGGCATGAAGCGCAAGCTT
Callithrix_jacchus|20559            CTGGACGACAAGCGGGACTCACCGAGCCGCTTCCTGAGCGGGGGCACGAGGCGCAAGCTC
Gorilla_gorilla|28689               CTGGAGGACAAGTGGAACTCACGGAGCCGCTTCCTGAGCGGGGGCATGAGGCGCAAGCTC
Homo_sapiens|30539                  CTGGAGGACAAGTGGAACTCACGGAGCCGCTTCCTGAGCGGGGGCATGAGGCGCAAGCTC
Pan_troglodytes|13792               CTGGAGGACAAGTGGAACTCACGGAGCCGCTTCCTGAGCGGGGGCATGAGGCGCAAGCTC
                                    .** : **.*.* *  .       : ...    ** ** **.** * **.*****..** 

Tarsius_syrichta|13855              TCCATTATTATAGCACTTATAGGGGGCTCCAAGGTGGTGATACTTGATGAGCCAACATCT
Tupaia_belangeri|17270              TCCATCGGCATCGCTCTCATCGCAGGCTCCAAGGTGTTGCTGCTGGACGAGCCCACAGCG
Dipodomys_ordii|4073                TCCATCGGCATTGCCCTCATAGCGGGTTCCAAGTTGTTGATTCTGGACGAGCCCACCTCG
Spermophilus_tridecemlineatus|13217 TCCATCGGCATCGCCCTCATAGCAGGCTCCAAGGTGCTGATGCTAGACGAGCCCACCTCA
Otolemur_garnettii|6861             TCCATTGGCATCGCCCTCATAGCAGGCTCCAAGGTGTTGATACTGGATGAGCCCACCTCA
Microcebus_murinus|6370             TCCATCGGCATCGCCCTCATAGCGGGCTCCAAGGTGTTGATGCTGGACGAGCCCACCTCA
Oryctolagus_cuniculus|25012         TCCGTCGGCATCGCCCTCATCGCGGGCTCCAAGGTGCTGATGCTGGACGAGCCCACCTCG
Ochotona_princeps|13529             TCCATCGGCATCGCCCTCATCGCGGGCTCCAAGGTGCTGATGCTGGACGAGCCCACCTCA
Mus_musculus|16778                  TCCATTGGCATCGCCCTCATAGCGGGCTCTAAGGTGCTGATGTTAGATGAGCCCACCTCA
Rattus_norvegicus|5070              GCCATCGGCATCGCCCTCATAGCGGGCTCTAAGGTGCTGATGTTAGATGAGCCCACCTCA
Cavia_porcellus|15563               TCCATTGGCATTGCCCTCATTGCAGGCTCTAAGGTATTGATGCTAGACGAGCCCACCTCA
Callithrix_jacchus|20559            TCCATCGGCATCGCGCTTATTGCAGGCTCCAAGGTGCTGATGCTGGACGAGCCCACCTCG
Gorilla_gorilla|28689               TCCATCGGCATCGCCCTCATCGCAGGCTCCAAGGTGCTGATACTGGACGAGCCCACCTCG
Homo_sapiens|30539                  TCCATCGGCATCGCCCTCATCGCAGGCTCCAAGGTGCTGATACTGGACGAGCCCACCTCG
Pan_troglodytes|13792               TCCATCGGCATCGCCCTCATCGCAGGCTCCAAGGTGCTGATACTGGACGAGCCCACCTCG
                                     **.* .  ** ** ** ** * .** ** *** *. **.*  * ** *****.**. * 

Tarsius_syrichta|13855              GGCATGGACCCAGCTTCAAGAAGGGTCACCTGGGATCTTCTTCAGCACTATAAACAGAAT
Tupaia_belangeri|17270              GGCATGGATGCCATCTCCAGGAGGGCCATCTGGGACCTTCTGCAGCAGCAGAAAAGCGAC
Dipodomys_ordii|4073                GGCATGGACGCCATCTCCAGGAGGGCCATCTGGGACCTTCTTCAGCAGCAGAAGAGTGAC
Spermophilus_tridecemlineatus|13217 GGCATGGACGCCATCTCCAGGAGGGCCATCTGGGACCTTCTTCAGCAGCAGAAGAGTGAC
Otolemur_garnettii|6861             GGCATGGATGCCATCTCTAGGAGAGCCATTTGGGACCTTCTTCAGCAGCAGAAAAGTGAC
Microcebus_murinus|6370             GGCATGGACGCCATCTCCAGGAGGGCCATCTGGGACCTTCTTCAGCAGCAGAAAAGTGAC
Oryctolagus_cuniculus|25012         GGCATGGACGCCATCTCCAGGAGGGCTGTCTGGGACCTGCTGCAGCAGCAGAAGAGCGAC
Ochotona_princeps|13529             GGCATGGACGCCATCTCCAGGAGGGCTGTCTGGGACCTGCTGCAGCAGCAGAAAACTGAC
Mus_musculus|16778                  GGCATGGATGCAGTGTCCAGAAGGGCCATCTGGGACCTTCTCCAGCAGCAGAAGAGTGAC
Rattus_norvegicus|5070              GGCATGGATGCAGTGTCCAGGAGGGCCATCTGGGACCTTCTTCAGCAGCAGAAGAGTGAC
Cavia_porcellus|15563               GGAATGGATGCCATCTCCAGGAGGGCCATCTGGGACCTGCTTCAGCAGCAGAAAAATGAC
Callithrix_jacchus|20559            GGCATGGACGCCATCTCCAGGAGGGCCATCTGGGACCTTCTTCAGCAGCAGAAACGTGAC
Gorilla_gorilla|28689               GGCATGGACGCCATCTCCAGGAGGGCCATCTGGGATCTTCTTCAGCGGCAGAAAAGTGAC
Homo_sapiens|30539                  GGCATGGACGCCATCTCCAGGAGGGCCATCTGGGATCTTCTTCAGCGGCAGAAAAGTGAC
Pan_troglodytes|13792               GGCATGGACGCCATCTCCAGGAGGGCCATCTGGGATCTTCTTCAGCGGCAGAAAAGTGAC
                                    **.*****  *..  ** **.**.*  .  ***** ** ** ****.  * **..  .* 

Tarsius_syrichta|13855              CGTACTATTTTACTGACAACCCACTACATGGATGAAGCTGATATCCTGGGTGACCGCATA
Tupaia_belangeri|17270              CACACCATCCTGCTGACCACCCACTTCATGGACGAGGCCGACCTGCTGGGGGACCGCATC
Dipodomys_ordii|4073                CGCACCATCCTGCTGACCACACACTTCATGGACGAGGCTGACCTGCTGGGGGACCGCATC
Spermophilus_tridecemlineatus|13217 CGCACCATCCTCCTGACCACCCATTTCATGGATGAGGCTGACCTGCTGGGGGACCGCATT
Otolemur_garnettii|6861             CGCACCATCCTACTGACCACCCACTTCATGGAGGAGGCTGACCTACTGGGGGACCGCATT
Microcebus_murinus|6370             CGCACCATCCTGCTGACCACCCACTTCATGGATGAGGCCGACCTGCTGGGGGACCGCATC
Oryctolagus_cuniculus|25012         CGCACCATCCTGTTAACCACCCACTTCATGGACGAGGCCGACCTGCTGGGGGACCGCATC
Ochotona_princeps|13529             CGCACCATCCTGCTGACCACCCACTTCATGGACGAGGCCGACCTGCTGGGGGACCGCATC
Mus_musculus|16778                  CGCACCGTCCTGCTGACCACTCACTTCATGGACGAAGCTGACCTGCTGGGAGACCGCATC
Rattus_norvegicus|5070              CGCACTGTCCTGCTGACCACTCACTTCATGGATGAAGCTGACCTGCTGGGAGACCGCATT
Cavia_porcellus|15563               CGCACCATCCTGCTGACCACTCACTTCATGGATGAAGCAGACCTGCTGGGAGACCGCATT
Callithrix_jacchus|20559            CGCACCATCGTGTTGACCACCCACTTCATGGACGAGGCTGACCTGCTGGGAGATCGCATC
Gorilla_gorilla|28689               CGCACCATCGTGCTGACCACCCACTTCATGGACGAGGCTGACCTGCTGGGAGACCGCATC
Homo_sapiens|30539                  CGCACCATCGTGCTGACCACCCACTTCATGGACGAGGCTGACCTGCTGGGAGACCGCATC
Pan_troglodytes|13792               CGCACCATCGTGCTGACCACCCACTTCATGGACGAGGCTGACCTGCTGGGAGACCGCATC
                                    *. ** .*  *  *.**.** ** *:****** **.** ** .* ***** ** ***** 

Tarsius_syrichta|13855              GCCATCATGGTCGAAGGATCCCTACGATGCTGTGGCTCTTCAATTTTCCTGAAAAAAACA
Tupaia_belangeri|17270              GCCATCATGGCCAAGGGGGAGCTGCAGTGCTGTGGCTCGTCGCTGTTCCTCAAGCAGAAG
Dipodomys_ordii|4073                GCCATCATGGCGGATGGGGAGCTGCAGTGCTGTGGGTCGTCTCTGTTCCTCAAGCAGAAA
Spermophilus_tridecemlineatus|13217 GCCATCATGGCCAAGGGGGAGCTGCAGTGCTGTGGGTCATCACTGTTCCTCAAACAGAAA
Otolemur_garnettii|6861             GCCATCATGGCCAAGGGGGAGCTGCAGTGCTGTGGGTCATCACTGTTCCTCAAGCAGAAG
Microcebus_murinus|6370             GCCATCATGGCCAAGGGGGAGCTGCAGTGCTGTGGGTCGTCCCTGTTCCTCAAGCAGAAA
Oryctolagus_cuniculus|25012         GCCATCATGGCCAAGGGGGAGCTACAGTGCTGCGGGTCACCGCTGTTCCTCAAGCAGAAA
Ochotona_princeps|13529             GCCATCATGGCCAAGGGGGAGCTGCAGTGCTGTGGGTCCCCACTGTTCCTCAAGCAGAAA
Mus_musculus|16778                  GCCATCTTGGCCAAGGGGGAGCTCCAGTGCTGCGGGTCTTCACTATTTCTCAAGCAGAAA
Rattus_norvegicus|5070              GCCATCTTGGCCAAGGGAGAGCTCCAGTGCTGTGGGTCTTCACTGTTCCTCAAGCAGAAA
Cavia_porcellus|15563               GCCATCATGGCCAAGGGTGAACTGCAGTGCTGTGGATCCTCTCTGTTCCTCAAGCAGAAA
Callithrix_jacchus|20559            GCCATCATGGCCAAGGGGGAGCTGCAGTGCTGCGGGTCCCCGCTGTTCCTGAAGCAGAAA
Gorilla_gorilla|28689               GCCATCATGGCCAAGGGGGAGCTGCAGTGCTGCGGGTCCTCGCTGTTCCTCAAGCAGAAA
Homo_sapiens|30539                  GCCATCATGGCCAAGGGGGAGCTGCAGTGCTGCGGGTCCTCGCTGTTCCTCAAGCAGAAA
Pan_troglodytes|13792               GCCATCATGGCCAAGGGGGAGCTGCAGTGCTGCGGGTCCTCGCTGTTCCTCAAGCAGAAA
                                    ******:***  .* **  . ** *..***** ** **  * .* ** ** **..*.*..

Tarsius_syrichta|13855              TATGGTGCAGGCTACCACATGACGCTGGTGAAGGAGCCACACTGCAACCCTGAAAGCATC
Tupaia_belangeri|17270              TACGGTGCAGGCTACCACATGACGCTGGTGAAGGAGCCACACTGCAACCTCGAAGGTGTC
Dipodomys_ordii|4073                TATGGTGCTGGCTACCATATGACCCTAGTGAAAGAACCACACTGTAATCCTGAAGCCATC
Spermophilus_tridecemlineatus|13217 TATGGTGCTGGCTATCACATGACGCTGGTAAAGGAGCCACACTGCAACCCTGAAGGCATC
Otolemur_garnettii|6861             TACGGTGCGGGTTACCACATGACACTGGTGAAGGAGCCACACTGCAACCCCGAAGGCATC
Microcebus_murinus|6370             TACGGCGCAGGCTACCACATGACACTGGTAAAGGAGCCACACTGCAACCCTGAAGGCGTC
Oryctolagus_cuniculus|25012         TACGGCGCCGGCTATCACATGACGCTGGTGAAGGAGCCGCACTGCAACCCCGCAGGCGTG
Ochotona_princeps|13529             TATGGCGCTGGGTACCACATGACGTTGGTGAAGGAGCCGCACTGCAACCCTGCCAGCGTC
Mus_musculus|16778                  TACGGAGCTGGCTACCACATGACGCTGGTAAAAGAACCGCACTGCAATCCTGAAGGAATC
Rattus_norvegicus|5070              TATGGAGCTGGCTACCACATGACACTGGTGAAAGAACCACACTGCAATCCTGAAGGTATC
Cavia_porcellus|15563               TATGGTGCTGGCTACCACATGACACTAGTGAAGGAGCCACATTGCAACCCCAAAGCCATC
Callithrix_jacchus|20559            TACGGTGCTGGCTACCACATGACGCTGGTGAAGGAGCCGCACTGCAACCCCGAAGGTATC
Gorilla_gorilla|28689               TACGGTGCCGGCTATCACATGACGCTGGTGAAGGAGCCGCACTGCAACCCGGAAGACATC
Homo_sapiens|30539                  TACGGTGCCGGCTATCACATGACGCTGGTGAAGGAGCCGCACTGCAACCCGGAAGACATC
Pan_troglodytes|13792               TACGGTGCCGGCTATCACATGACGCTGGTGAAGGAGCCGCACTGCAATCCGGAAGACATC
                                    ** ** ** ** ** ** *****  *.**.**.**.**.** ** ** *  ....  .* 

Tarsius_syrichta|13855              TCCCAGCTGGTTCGCCACCATGTCCCCAATGCCACACTGGAAAGCAATGCTGGGGCTGAG
Tupaia_belangeri|17270              TCCCAGCTGGTCCCTCACCACGTCCCCAATGCCACGCTGCAGAGCAGCGCCGGGGCTGAG
Dipodomys_ordii|4073                TCCCAACTGGTGCACCGCCATGTCCCCAACGCCACACTGGAGAGCCATGCTGGGGCTGAG
Spermophilus_tridecemlineatus|13217 TCCCAGCTGGTGCACCACCATGTCCCCAATGCCACACTGGAAAGCAGTGTTGGGGCTGAG
Otolemur_garnettii|6861             TCCCAGCTTGTCTACCACCACGTCCCCAATGCCACACTGGAGAGCAATGCTGGAGCAGAG
Microcebus_murinus|6370             TCCCAGCTGGTCTACCACCACGTGCCCAACGCCACGCTGGAAAGCAGTGCTGGAGCTGAG
Oryctolagus_cuniculus|25012         TCCCAGCTGGTGCGCCACCACGTCCCCAACGCCACCCTGGAGAGCAGCGCCGGGGCCGAG
Ochotona_princeps|13529             ATGCAGCTGGTGTATCAGCACATCCCCAATGCCACGCTGCAGAGCAACGCCGGCGCTGAG
Mus_musculus|16778                  TCTCAGCTGGTGCACCACCATGTCCCCAATGCCATGCTGGAGAGCCATGCTGGGGCTGAG
Rattus_norvegicus|5070              TCTCAGCTGGTGCACCACCATGTCCCCAATGCCATGCTGGAGAGCCATGCTGGGGCCGAG
Cavia_porcellus|15563               TCCCAGCTGGTGTACCACCACATCCCCAATGCCACTCTGGAAAGTAGCGCTGGGGCTGAG
Callithrix_jacchus|20559            TCCCAGCTGGTCCATCACCACGTCCCCAATGCCACTCTGGAGAGCAGCGCTGGGGCTGAG
Gorilla_gorilla|28689               TCCCAGCTGGTCCACCACCACGTGCCCAACGCCACGCTGGAGAGCAGCGCTGGGGCCGAG
Homo_sapiens|30539                  TCCCAGCTGGTCCACCACCACGTGCCCAACGCCACGCTGGAGAGCAGCGCTGGGGCCGAG
Pan_troglodytes|13792               TCCCAGCTGGTCCACCACCACGTGCCCAACGCCACGCTGGAGAGCAGCGCTGGGGCTGAG
                                    :  **.** **    *. ** .* ***** ****  *** *.** .. *  ** ** ***

Tarsius_syrichta|13855              CTGTCCTTCATTCTTCCCAAGGAGAGCACACACAGNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17270              CTGTCGTTCGTTCTTCCCAAGGAGAGCACACACAGNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|4073                CTGTCCTTTATTCTTCCTAAGGAGAGCACACACAGATTTGAAGGTCTTTTTGCCAAACTG
Spermophilus_tridecemlineatus|13217 CTGTCCTTTATACTTCCCAAGGAGAGCACGCACAGGTTTGAAAGTCTTTTCACTAAACTG
Otolemur_garnettii|6861             CTGTCCTTTATTCTTCCCAAAGAGAGCACACACAGGTTTGAAAGTTTTGTTCCG------
Microcebus_murinus|6370             CTGTCCTTTATTCTTCCCAAGGAGAGCACTCACAGGTTCGAAAGCCTTTTTACGAAGCTG
Oryctolagus_cuniculus|25012         CTCTCCTTTATCCTCCCCAAGGAGAGCACGCACAGGTTTGAAAGCCTCTTTGCCAAGCTG
Ochotona_princeps|13529             CTCTCCTTCGTCCTCCCCAAGGAGAGCACACACAGGTTTGAAAGTCTCTTTGGCAAGTTG
Mus_musculus|16778                  CTGTCCTTTATTCTTCCCAAGGAGAGCACGCACAGGTTTGAAAGTCTGTTTGCTAAACTG
Rattus_norvegicus|5070              TTGTCCTTTATTCTTCCCAAGGAAAGCACACACAGGTTTGAAAGTCTGTTTGCTAAACTG
Cavia_porcellus|15563               CTGTCCTTTATTCTTCCCAAGGAGAGCACACACAGGTTTGAAAGTCTTTTTGCTAAATTG
Callithrix_jacchus|20559            CTGTCCTTCATCCTTCCCAGAGAGAGCACTCACAGGTTTGAAGGTCTCTTTGCCAAACTG
Gorilla_gorilla|28689               CTGTCTTTCATCCTTCCCAGAGAGAGCACGCACAGGTACGCCTCCCAGGGAGGGCACGCA
Homo_sapiens|30539                  CTGTCTTTCATCCTTCCCAGAGAGAGCACGCACAGGTTTGAAGGTCTCTTTGCTAAACTG
Pan_troglodytes|13792               CTGTCTTTCATCCTTCCCAGAGAGAGCACGCACAGGTTTGAAGGTCTCTTTGCTAAACTG
                                     * ** ** .* ** ** *..**.***** ***** .  .                    

Tarsius_syrichta|13855              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17270              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|4073                GAGAAGAAGCAGAAGGAATTGGGCATTGCCAGCTTTGGGGCTTCAGTTACCACTATGGAA
Spermophilus_tridecemlineatus|13217 GAAAATAAGCAGAAGGAATTGGGCATCGCCAGCTTCGGGGCCTCTGTCACCACCATGGAG
Otolemur_garnettii|6861             GGAAAGAAGCAGAAAGAGCCTGGGCTCGCC---TTTGGGGCCTCCGGTACCACCATGGAA
Microcebus_murinus|6370             GAAAAGAAGCAGAAGGAGCTGGGCATCGCCAGCTTTGGGGCCTCCGTCACCACCATGGAG
Oryctolagus_cuniculus|25012         GAGAAGCGGCAGAAGGAGTTGGGCATCGCCAGCTTCGGGGCCTCCGTCACCACCATGGAG
Ochotona_princeps|13529             GAGAAGCGGCAGAAGGAGCTGGGCATCGCCAGCTTCGGGGCCTCCGTCACCACTATGGAA
Mus_musculus|16778                  GAAAAGAAGCAGAAGGAGTTGGGCATCGCAAGCTTCGGGGCCTCGGTCACCACCATGGAG
Rattus_norvegicus|5070              GAAAAGAAGCAGAAGGAACTGGGCATTGCAAGCTTCGGGGCCTCTGTCACCACCATGGAG
Cavia_porcellus|15563               GAAAAGAAGCAGAAAGAATTGGGCATTGCCAGCTTCGGAGCCTCTGTCACCACCATGGAG
Callithrix_jacchus|20559            GAGAAGAAGCAGAAAGAGCTGGGCATTGCCAGCTTCGGGGCCTCCGTCACCACCATGGAG
Gorilla_gorilla|28689               CAGAGGGACTCAAACCATATGAATCTCACCCGCCCGGGGAGCTGGGTCCTGACCGGTCCC
Homo_sapiens|30539                  GAGAAGAAGCAGAAAGAGCTGGGCATTGCCAGCTTTGGGGCATCCATCACCACCATGGAG
Pan_troglodytes|13792               GAGAAGAAGCAGAAAGAGCTGGGCATTGCCAGCTTTGGGGCGTCCATCACCACCATGGAG
                                                             .          ..    .                 

Tarsius_syrichta|13855              NNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17270              NNNNNNNNN---NNNNNGGTCGGCAAGCTGGTAGACAGCAGCATGGACATCCAAGCCGTC
Dipodomys_ordii|4073                GAGGTTTTC---CTCCGGGTTGGCAAGCTAGTGGACACCAGCATGGATATCCAAGCCATC
Spermophilus_tridecemlineatus|13217 GAAGTCTTC---CTTCGGGTTGGCAAGTTGGTAGACACCAGCATGGACATCCAAGCCATC
Otolemur_garnettii|6861             ---GTCTTC---TTTTGGGTTGGGAAGCTGGTGGACACCAGCATGGACATGCAGGCCATC
Microcebus_murinus|6370             GAGGTCTTC---CTTCGGGTTGGGAAGCTGGTGGACACCAGCATGGACATGCAGGCCATC
Oryctolagus_cuniculus|25012         GAGGTCTTC---CTGCGGGTCGGCAAGCTGGTGGACACCAGCATGGACATCCAGGCCGTC
Ochotona_princeps|13529             GAGGTCTTC---CTCCGGGTCGGCAAGCTGGTAGACAGCAGCATGGACATCCAGGCTGTC
Mus_musculus|16778                  GAAGTCTTC---CTTCGGGTTGGTAAGCTGGTGGACACCAGCATGGACATTCAAGCCATT
Rattus_norvegicus|5070              GAGGTCTTC---CTTCGGGTTGGTAAGCTGGTGGACACCAGCATGGACATTCAAGCCATC
Cavia_porcellus|15563               GAAGTCTTT---CTTCGGGTTGGTAAATTGGTAGACACCAGCATGGACATCCAAGCCATC
Callithrix_jacchus|20559            GAAGTCTTC---CTTCGGGTCGGGAAGCTAGTGGACAGTAGCATGGACATCCAGGCCATC
Gorilla_gorilla|28689               TGTGTGTATCGGCACAGGGTCGGGAAGCTGGTGGACAGCAGTATGGACATCCAGGCCATC
Homo_sapiens|30539                  GAAGTCTTC---CTTCGGGTCGGGAAGCTGGTGGACAGCAGTATGGACATCCAGGCCATC
Pan_troglodytes|13792               GAAGTCTTC---CTTCGGGTCGGGAAGCTGGTGGACAGCAGTATGGACATCCAGGCCATC
                                       .. .         .... ..     . .. .      .  ...   .    .   . 

Tarsius_syrichta|13855              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17270              CAGCTCCCGGCCCTGCAGTACCAGCACGAGAGGCGGGCCAGCGACTGGNNNNNNNNNNNN
Dipodomys_ordii|4073                CAGCTCCCTGCCCTGCAGTACCAACACGAGAGGCGGGCAAGCGACTGGGCGGTAGACAGC
Spermophilus_tridecemlineatus|13217 CAGCTCCCTGCCCTGCAGTACCAGCACGAGAGGCGGGCGAGCGACTGGGCTGTGGACAGC
Otolemur_garnettii|6861             CAGCTGCCTCCCCTGCAGTACCAGCATGAGAGGCGGGCAAGTGACTGGGCTGTGGACAGC
Microcebus_murinus|6370             CAGCTCCCTGCCCTGCAGTACCAGCACGAGAGGCGGGCGAGCGACTGGGCAGTGGACAGC
Oryctolagus_cuniculus|25012         CAGCTGCCTGCCCTACAGTACCAGCACGAGAGGAGGGCCAGTGACTGGGCTGTGGACAGC
Ochotona_princeps|13529             CAGCTTCCTGCCCTGCAGTACCAGCACGAGAGGAGGGCCAGTGACTGGGCTCTGGACAGC
Mus_musculus|16778                  CAGCTTCCTGCTCTGCAGTACCAGCATGAGAGGCGGGCAAGCGACTGGGCTTTGGACAGT
Rattus_norvegicus|5070              CAGCTTCCTGCTCTGCAGTACCAGCATGAGAGGCGGGCAAGCGACTGGGCTCTGGATAGT
Cavia_porcellus|15563               CAGCTTCCTGCCCTGCAGTACCAGCATGAGAGGCGGGCAAGTGATTGGGCTGTGGACAGC
Callithrix_jacchus|20559            CAGCTCCCTGCCCTGCAGTACCAGCACGAGAGGCGCGCCAGCGACTGGGCCGTGGATAGC
Gorilla_gorilla|28689               CAGCTCCCTGCCCTGCAGTACCAGCACGAGAGGCGCGCCAGTGACTGGGCTGTGGACAGC
Homo_sapiens|30539                  CAGCTCCCTGCCCTGCAGTACCAGCACGAGAGGCGCGCCAGCGACTGGGCTGTGGACAGC
Pan_troglodytes|13792               CAGCTCCCTGCCCTGCAGTACCAGCACGAGAGGCGCGCCAGCGACTGGGCTGTGGACAGC
                                      . .        .   ..        . . .. . .   . .  ....   . .   . 

Tarsius_syrichta|13855              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17270              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|4073                AACCTGTGTGGGGTGATGGACCCCACGGATGGCATCGGTGGCCTCATGGAGGAGGACCAC
Spermophilus_tridecemlineatus|13217 AATCTGTGCGGAGTGATGGACCCAACTGACGGCATCGGCACCCTCATTGAGGAGGAGCAC
Otolemur_garnettii|6861             AACTTGTGTGGGGCCATGGACCCAACCGATGGCATCGGTGCCCTTATTGAAGAACAGTGC
Microcebus_murinus|6370             AACCTGTGCGGGGCCATGGACCCAACCGACGGCATCGGCGCCCTCATCGAGGAAGAGCGT
Oryctolagus_cuniculus|25012         AGCCTGTGTGGCGCCTTGGACCCCACGGATGGCATCGGCGCCCTCATTGAGGAGGAGCCC
Ochotona_princeps|13529             AACCTGTGTGGGCTCTTGGACCCAACGGACGGCGTGGGCACCCTCATCGAGGAGGAGCCC
Mus_musculus|16778                  AACCTGTGTGGGGTGATGGACCCAACGAATGGCATTGGAGCCCTCATAGAGGAAGAGGAA
Rattus_norvegicus|5070              AACTTGTGTGGGGTGATGGACCCAACGAACGGCATTGGAGCCCTCATAGAGGAAGAAGAA
Cavia_porcellus|15563               AACCTGTGTGGAGTGATGGACCCCACTGATGGCATCGGTACCCTCATTGAGGAGGAGCAT
Callithrix_jacchus|20559            AACCTCTGCGGTGCCATGGACCCCACCGACGGCATTGGGGCCCTCATTGAGGAGGAGCAC
Gorilla_gorilla|28689               AACCTCTGTGGGGCCATGGACCCCTCCGACGGCATTGGAGCCCTCATCGAGGAGGAGCGC
Homo_sapiens|30539                  AACCTCTGTGGGGCCATGGACCCCTCCGACGGCATTGGAGCCCTCATCGAGGAGGAGCGC
Pan_troglodytes|13792               AACCTCTGTGGGGCCATGGACCCCTCCGACGGCATTGGAGCCCTCATTGAGGAGGAGCGC
                                        . .. ..     ...           ..  . ..     .  . .  .        

Tarsius_syrichta|13855              NNNNNNNNNNNNNNNNNNNNNNNNCTTGCCCTGCACTGTCAGCAGTTCTGGGCCATGTTC
Tupaia_belangeri|17270              NNNNNNNNNNNNNNNNNNNNNNNNCTCGCCCTCCACTGCCAGCAGTTCTGGGCCATGCTC
Dipodomys_ordii|4073                ACCATGGTCAAGCTCAACACCGGGCTTTCCCTCCACTGCCAGCAGCTGTGGGCCATGTTC
Spermophilus_tridecemlineatus|13217 ACTGTGGTCAAGCTCAACACTGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|6861             GCCACTGTCAAGCTCAACACTGGGCTTGCCCTGCACTGCCAGCAATTCTGGGCCATGTTC
Microcebus_murinus|6370             GCCGCCGTCAAGCTCAACACTGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Oryctolagus_cuniculus|25012         AGCATGGTCAAGCTCAACACTGGGCTGGCCCTGCACTGGCAGCAGTTCTGGGCCATGTTC
Ochotona_princeps|13529             GCCATGGTCAAGCTCAACAGCGGGCTGGCTCTGCACTGGCAGCAGTTCTGGGCCATGTTC
Mus_musculus|16778                  GTTTTGGTCAAGCTCAACACAGGGCTTGCCCTCCACTGCCAGCAGTTCTGGGCCATGTTC
Rattus_norvegicus|5070              GTTTTGGTCAAGCTCAACACCGGGCTTGCCCTCCACTGCCAGCAGTTCTGGGCCATGTTC
Cavia_porcellus|15563               GCAGTGGTCCAGCTCAATACTGGGCTTGCCCTCCACTGCCAGCAATTCTGGGCCATGTTC
Callithrix_jacchus|20559            ACCGCTGTCACGCTCAACACTGGGCTCACCCTGCACTGCCAGCAGTTCTGGGCCATGTTC
Gorilla_gorilla|28689               ACCGCTGTCAAGCTCAACACTGGGCTCGCCCTGCACTGCCAGCAGTTCTGGGCCATGTTC
Homo_sapiens|30539                  ACCGCTGTCAAGCTCAACACTGGGCTCGCCCTGCACTGCCAGCAATTCTGGGCCATGTTC
Pan_troglodytes|13792               ACCGCTGTCAAGCTCAACACTGGGCTCGCCCTGCACTGCCAGCAGTTCTGGGCCATGTTC
                                          ..   . .       ... .     .    ..   .    . ....   .. . 

Tarsius_syrichta|13855              CTGAAGAAGGCCGCGTACAGCTGGCGGGAATGGAAGATGGTGGTGGCCCAGGTCCTGGTC
Tupaia_belangeri|17270              CTGAAGAAGGCCTCATACAGCTGGCGGGAGTGGAAGATGGTGGCGGCTCAGGTCCTGGTC
Dipodomys_ordii|4073                CTGAAGAAGGCTGCGTACAGCTGGCGCGAGTGGAAGATGCTGGCAGCCCAGGTCGTTGTC
Spermophilus_tridecemlineatus|13217 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|6861             CTGAAAAAGGCCACGTACAGCTGGCGGGAGTGGAAGATGGTGGCAGCCCAGGTCCTGGTC
Microcebus_murinus|6370             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Oryctolagus_cuniculus|25012         CTGAAGAAGGCCACGTACAGCTGGCGGGAGTGGAAGATGCTGGCCGCCCAGATCCTCGTG
Ochotona_princeps|13529             CTGAAGAAAGCCACCTACAGCTGGCGGGAGTGGAAGATGCTGGCCGCCCAGGTCCTCGTG
Mus_musculus|16778                  CTGAAGAAGGCTGCATACAGCTGGCGGGAATGGAAGATGGTGGCAGCTCAGGTCCTGGTC
Rattus_norvegicus|5070              CTGAAGAAGGCTGCGTACAGCTGGCGGGAATGGAGGATGGTAGCCGCTCAGATCCTGGTC
Cavia_porcellus|15563               TTGAAGAAAGCCACATACAGCTGGCGGGAGTGGAAGATGGTAGCAGCACAGATTCTGGTC
Callithrix_jacchus|20559            CTGAAGAAGGCTGCATACAGCTGGCGTGAGTGGAAGATGGTGGCGGCCCAGGTCCTGGTG
Gorilla_gorilla|28689               CTGAAGAAGGCCGCATACAGCTGGCGTGAGTGGAAAATGGTGGCGGCACAGGTCCTGGTG
Homo_sapiens|30539                  CTGAAGAAGGCCGCATACAGCTGGCGCGAGTGGAAAATGGTGGCGGCACAGGTCCTGGTG
Pan_troglodytes|13792               CTGAAGAAGGCCGCATACAGCTGGCGCGAGTGGAAAATGGTGGCGGCACAGGTCCTGGTG
                                     ..      .     .   . ... . .  ...    .. . .  .    . .  . .. 

Tarsius_syrichta|13855              CCTCTAACCTGCATCACCCTGGCACTGCTAGCCATCAACTACTCCTCAGAGATCTTTGAT
Tupaia_belangeri|17270              CCTCTGACCTGCGTCACCTTGGCCCTCCTGGCCATCAACTACTCCTCCGAGATCTTGGAT
Dipodomys_ordii|4073                CCCCTGACCTGCATCACCCTGGCCCTCCTGGCCATCAGCTACTCAACCGAGCTCTTCGAC
Spermophilus_tridecemlineatus|13217 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|6861             CCACTGACCTGTGTCACCCTGGGCCTGCTGGCTGTCAACTACTCCTCTGAGATCTTCGAT
Microcebus_murinus|6370             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Oryctolagus_cuniculus|25012         CCCCTGACCTGTGTCACCCTGGCCCTGCTGGCCATCAACTACTCCTCGGAGATCCTCGAC
Ochotona_princeps|13529             CCCCTGACGGTTGTCACCTTGGCCCTTCTGGCCATTAACTATTCTTCCGAGATCTTGGAT
Mus_musculus|16778                  CCCCTGACCTGCCTCACCCTGGCCCTCCTGGCTATCCACTACACCTCAGAGATCTTTGAT
Rattus_norvegicus|5070              CCCGTGACCTGCCTCACCCTGGCCCTCCTGGCTATCAACTACACCTCAGAGATCTTTGAT
Cavia_porcellus|15563               CCCCTGACCTGTGTCACTCTGGCCCTCTTGGCCATCAACTACTCCTCAGAGGTCTTTGAC
Callithrix_jacchus|20559            CCTGTGACCTGTGTCACCCTGGCCCTCCTGGCCATCAACTACTCCTCAGAGCTGTTCGAC
Gorilla_gorilla|28689               CCTCTGACCTGCGTCACCCTGGCCCTCCTGGCCATCAACTACTCCTCGGAGCTCTTCGAC
Homo_sapiens|30539                  CCTCTGACCTGCGTCACCCTGGCCCTCCTGGCCATCAACTACTCCTCGGAGCTCTTCGAC
Pan_troglodytes|13792               CCTCTGACCTGCGTCACCCTGGCCCTCCTGGCCATCAACTACTCCTCGGAGCTCTTCGAC
                                        .        .     ...   .  . .   .    .        . . .  . .  

Tarsius_syrichta|13855              GACCCTCCCCTGAAGCTGACCTTGGGCGAGTATGGCAGAACTGTGGTGCCCTTCTCTGTT
Tupaia_belangeri|17270              GACCCCGTCCTGAAGCTGACCCTGGGCGAGTACGGCAGGACTGTCGTGCCTTTCTCGGCT
Dipodomys_ordii|4073                GACCCGCTCCTGAGGCTGAGTCTGGGCGAGTACGGCAGAACCGTGGTGCCCTTCTCGGTC
Spermophilus_tridecemlineatus|13217 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|6861             GACCCCATCTTGAAGCTGATCTTGGGCGCCTATGGCAGAACCGTGGTGCCCTTCTCAGTT
Microcebus_murinus|6370             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Oryctolagus_cuniculus|25012         GACCCCCTGCTGAGGTTGACCCTGGGCGAGTACGGCCGAACCGTGGTGCCCTTCTCCGTT
Ochotona_princeps|13529             GACCCCCTGCTGCAGCTGACCCTCAGCGAGTACGGCCGCACCGCCGTGCCCTTCTCTGCC
Mus_musculus|16778                  GACCCTCTCCTGAAGCTAAGCCTGAACGAGTATGGTAGAACGGTTGTGCCCTTCTCGGTC
Rattus_norvegicus|5070              GACCCTCCCCTGAAGCTAAGCCTGAACGAGTATGGTACAACAGTTGTGCCCTTCTCAGTC
Cavia_porcellus|15563               GACCCTATCCTGAAGCTGAGCTTGAGCGAGTATGGAAGAACCATTGTACCCTTCTCAGTC
Callithrix_jacchus|20559            GACCCCATGCTGAGGCTGACCCTGGGCGAGTATGGCAGAACCGTCGTGCCTTTCTCGATT
Gorilla_gorilla|28689               GACCCCATGCTGAGGCTGACCTTGGGCGAGTATGGCAGAACCGTCGTGCCCTTCTCAGTT
Homo_sapiens|30539                  GACCCCATGCTGAGGCTGACCTTGGGCGAGTACGGCAGAACCGTCGTGCCCTTCTCAGTT
Pan_troglodytes|13792               GACCCCATGCTGAGGCTGACCTTGGGCGAGTATGGCAGAACCGTCGTGCCCTTCTCAGTT
                                    .         ..  . .     .    .  .  ..          ..    .. .     

Tarsius_syrichta|13855              CCTGGGACCTCCCGGCTAGATCAGCAGCTGTCAGAGCATCTGAAGGACATGCTGCAGGCA
Tupaia_belangeri|17270              CCCGAGACCTCCCGGCGGGGCCGGCAGCTGTCCGAGCTCCTGAAGGACATGCTGCAGGCC
Dipodomys_ordii|4073                TCTAGCACCTCTCGTTTGGATCAGCAGCTGTCGGAGCTCCTGAGAGACATGCTACAGGCC
Spermophilus_tridecemlineatus|13217 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|6861             CCTGGTACCTCCCGACTGGGTCAGCAGCTGTCAGAGCACTTGAAGGACATGCTGCAGGCA
Microcebus_murinus|6370             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Oryctolagus_cuniculus|25012         CCTGGGACGTCCAGGCTGGACCAGCAGCTGTCGGAGCGTTTGAAAGACATGCTGCAGGCC
Ochotona_princeps|13529             CCTGGGGCCTCCAGGCTGGGCCAGCAGCTGTCGGAGCATCTGAAGGACATGCTGCAGGCT
Mus_musculus|16778                  CCAGGCACATCCAGGCTGGCTCAGCAGCTGTCTGAGAATCTAAGGGACATGCTGCAGGCT
Rattus_norvegicus|5070              CCAGGCACATCCAGGCTGGGCCAGCAGCTGTCTGAGCATCTAAGAGACATGCTGCAGGCT
Cavia_porcellus|15563               CCTGGCACCTCACAGCTGGATCAGCAGCTGTCAGAGCACTTGAGGGACATGCTTCAGGCA
Callithrix_jacchus|20559            CCTGGGACCTCCCGGTTGGGTCAGCAGCTGTCAGAGCATCTGAAAGACTCACTGCAGGCT
Gorilla_gorilla|28689               CCCGGGACCTCCCAGCTGGGTCAGCAGCTGTCAGAGCATCTGAAAGACGCACTGCAGGCT
Homo_sapiens|30539                  CCCGGGACCTCCCAGCTGGGTCAGCAGCTGTCAGAGCATCTGAAAGACGCACTGCAGGCT
Pan_troglodytes|13792               CCCGGGACCTCCCAGCTGGGTCAGCAGCTGTCAGAGCATCTGAAAGACGCACTGCAGGCT
                                             .        .    .  . ...  . .    .    .      .   ..  

Tarsius_syrichta|13855              GAGGGGCAGGAGCCCCGCGAGGTGCTCGGTGACCTGGAAGAGTTCCTGATTTTCAGGGCC
Tupaia_belangeri|17270              GAGGGGCAGGAGCCCCGCGAGGTGCTGGGCGACCTGGAGGAGTTCCTGATTTTCAGGGCC
Dipodomys_ordii|4073                GAGGGCCAGGAGCCCCGCGAGGTGCTGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|13217 NNNNNNNNNNNNNNNNNNNNNNNNNNNNGTGACCTGGAGGAGTTCCTGGTTTTCAGGGCA
Otolemur_garnettii|6861             GAGGGGCAGGAGCCACGTGAGGTGCTAGGTGACCTGGAGGAGTTCCTAATTTTTAGGGCC
Microcebus_murinus|6370             NNNNNNNNNNNNNNNNNNNNNNNNNNNNGTGACCTGGAGGAGTTTCTGATTTTCAGGGCC
Oryctolagus_cuniculus|25012         CAAGGACAGGAGCCCCGAGAGGTGCTGGGTGACCTGGAGGAGTTCCTGATTTTCAGGGCC
Ochotona_princeps|13529             GAAGGACAGGAGCCCCGAGAGGTGCTGGGTGACCTGGAGGAGTTCCTTATTTTCAGGGCC
Mus_musculus|16778                  GAGAGGCAGGAGCCCCGGGAAGTGCTAGGTGACCTAGAGGAGTTCCTGGTTTTCAGGGCC
Rattus_norvegicus|5070              GAGAGGCAGGAGCCCCGTGAAGTGCTAGGTGACCTAGAGGAGTTCCTGGTTTTCAGGGCC
Cavia_porcellus|15563               GCAGGACAGGAACCCCGTGAGGTGCTAGGTGACTTGGAAGAGTTCCTGGTTTTCAGGGCC
Callithrix_jacchus|20559            GAGGAACAGGAGCCCCGGGAGGTGCTCGGTGACCTAGAGGAGTTCTTGATCTTCAGGGCC
Gorilla_gorilla|28689               GAGGGACAGGAGCCCCGCGAGGTGCTCGGTGACCTGGAGGAGTTCTTGATCTTCAGGGCC
Homo_sapiens|30539                  GAGGGACAGGAGCCCCGCGAGGTGCTCGGTGACCTGGAGGAGTTCTTGATCTTCAGGGCT
Pan_troglodytes|13792               GAGGGACAGGAGCCCCGCGAGGTGCTCGGTGACCTGGAGGAGTTCTTGATCTTCAGGGCC
                                            ..      . .  ... . .. .   . .  . ...  .  . ..  ...  

Tarsius_syrichta|13855              TCAGTGGAGGGGGGCGGCTTCAGCGATCGGTGCCTCATAAAGTCATCCTTCCAAAATGAG
Tupaia_belangeri|17270              TCCGTGGAGGGGGGCGGCTTCAACGAGCGCTGCCTTGTGGCGGCATCCTTCAGGGACGTC
Dipodomys_ordii|4073                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|13217 TCAGTAGAAGGAGGCGGCTTTAATGAGCGGTGCCTGGTGGCAACATCCTTCAGAGATGTG
Otolemur_garnettii|6861             TCAGTGGAAGGGGGAGGCTTTAACGAGCGGTGCCTTGTAGCGGTGTCCTTCAGAGATGTG
Microcebus_murinus|6370             TCGGTGGAAGGGGGAGGCTTTAACGAGCGGTGCCTTGTGGCGGTGTCCTTCAGAGACGTG
Oryctolagus_cuniculus|25012         TCGGTGGAGGGGGGCGGCTTCAACGAGCGGTGCCTGGTGGCCATGTCCTTCGGAGATGCA
Ochotona_princeps|13529             TCAGTGGAGGGGGGCGGCTTTAACGAGCGGTGCCTGGTGGCCACGTCCTTCAGAGATGTG
Mus_musculus|16778                  TCAGTGGAAGGAGGCGGCTTTAATGAGCGGTGCCTAGTAGCAACATCCTTCAAAGACAGA
Rattus_norvegicus|5070              TCAGTGGAAGGGGGCGGCTTTAATGAGAGGTGCCTGGTAGCGACATCCTTCAAAGACAGT
Cavia_porcellus|15563               TCAGTGGAGGGAGGAGGCTTTAATGAGCGGTGTCTGGTGGCAGTGTCCTTCAGAGATGAA
Callithrix_jacchus|20559            TCTGTCGAGGGGGGCGGCTTTAATGAGCGGTGCCTCGTGGCAGTGTCCTTCAGAGACGTG
Gorilla_gorilla|28689               TCTGTGGAGGGGGGCGGCTTTAATGAGCGGTGCCTTGTGGCAGCGTCCTTCAGAGACGTG
Homo_sapiens|30539                  TCTGTGGAGGGGGGCGGCTTTAATGAGCGGTGCCTTGTGGCAGCGTCCTTCAGAGATGTG
Pan_troglodytes|13792               TCTGTGGAGGGGGGCGGCTTTAATGAGCGGTGCCTTGTGGCAGCGTCCTTCAGAGATGTG
                                    .  .. .  .. .. .. ..    .   . ..  .  .       .  ..          

Tarsius_syrichta|13855              GAAAAGCAGAACAGCATCACTACCTTGGTCAAAAACAAG------CACTCCAAAGCG---
Tupaia_belangeri|17270              GGCGAGCGCACGGTCGTCACCGCCCTGTTCAACAACCAGGCGTACCACTCCCCCGCCACC
Dipodomys_ordii|4073                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|13217 GGAGAGCGGACAGTGGTCACCGCCTTATTCAACAACCAGGCCTACCACTCCCCAGCCACC
Otolemur_garnettii|6861             GGAGAACAGATGGTCGTCACTGCACTGTTCAACAACCAAGCATACCACTCCCCAGCCACT
Microcebus_murinus|6370             GGAGAACGGACGGTTGTCACTGCCCTGTTCAACAACCAGGCGTACCACTCCCCAGCCACC
Oryctolagus_cuniculus|25012         GGGGAGCACACGGTGGTCACCGCCCTGTTCAACAACCAGGCCTACCACTCCCCAGCCACC
Ochotona_princeps|13529             GGGGAGCGGATGGTGGTCACCGCCCTGTTCAACAACCAGGCGTACCATTCCCCGGCCACC
Mus_musculus|16778                  GGAGAGCTGACCGTGGTCACTGCCCTGTTCAACAACCAGGCATACCACTCCCCAGCCACT
Rattus_norvegicus|5070              GGAGAGCGGACAGTGGTCACTGCCCTGTTCAACAACCAGGCATACCACTCCCCAGCCACT
Cavia_porcellus|15563               GTAGAGAGAACTGTGGTCACCGCCCTGTTCAACAACCAGGCATACCACTCCCCGGCCACC
Callithrix_jacchus|20559            GGAGAGCGCACA---GTCACCGCCTTATTCAACAACCAGGCGTACCACTCCCCGGCCACC
Gorilla_gorilla|28689               GGAGAGCGCACGGTCGTCACCGCCTTGTTCAACAACCAGGCGTACCACTCTCCAGCCACT
Homo_sapiens|30539                  GGAGAGCGCACGGTCGTCAACGCCTTGTTCAACAACCAGGCGTACCACTCTCCAGCCACT
Pan_troglodytes|13792               GGAGAGCGCACGGTCGTCACCGCCTTGTTCAACAACCAGGCGTACCACTCTCCAGCCACT
                                    .               .        .  .                   .     .     

Tarsius_syrichta|13855              ------------------------------------------------------------
Tupaia_belangeri|17270              GCGCTGGCCGTCGTGGACAACCTCCTGTTCAGGCTGCTGTGTGGCCCTCGGGCCTCCATC
Dipodomys_ordii|4073                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|13217 GCCCTGGCCATCGTGGACAACCTTCTATTCAAGCTGCTGTGTGGCCCTCGGGCCTCCATC
Otolemur_garnettii|6861             GCCCTGGCCATTGTGGATAATCTTCTCTTCAAGCTGCTATGTGGTCCTCTGGCCTCCATC
Microcebus_murinus|6370             GCCCTGGCCGTCGTGGACAACCTTCTCTTCAAGCTGCTATGCAGCCCCCAGGCCTCCATT
Oryctolagus_cuniculus|25012         GCCCTGGCCGTCGTCGACAACCTCCTGTTCCAGCTCCTATGCGGCCCCCGCGCCTCCATC
Ochotona_princeps|13529             GCTCTGACCGTCGCAGACAACCTGCTGTTCCGGCTTCTGTGCGGCCCCCGGGCCTCCATC
Mus_musculus|16778                  GCCCTGGCCATCGTGGACAACCTTCTGTTCAAGCTATTGTGTGGCCCTCAGGCCTCCATT
Rattus_norvegicus|5070              GCCCTGGCCATTGTGGACAACCTTCTGTTCAAGCTTCTGTGTGGCCCTCGGGCCTCCATT
Cavia_porcellus|15563               GCGCTGGCCATCGTGGACAACCTTCTGTTCAAGCTACTGTGTGGCCCCCAGGCCTCCATC
Callithrix_jacchus|20559            GCCCTGGCCGTCGTGGACAACCTTCTGTTCAAGCTGCTGTGCGGGCCTCACGCCTCCATC
Gorilla_gorilla|28689               GCCCTGGCCGTCGTGGACAACCTTCTGTTCAAGCTGCTGTGCGGGCCTCACGCCTCCATT
Homo_sapiens|30539                  GCCCTGGCCGTCGTGGACAACCTTCTGTTCAAGCTGCTGTGCGGGCCTCACGCCTCCATT
Pan_troglodytes|13792               GCCCTGGCCGTCGTGGACAACCTTCTGTTCAAGCTGCTGTGCGGGCCTCACGCCTCCATT
                                                                                                

Tarsius_syrichta|13855              ------------------------------------------------------TTTGCC
Tupaia_belangeri|17270              GTGGTCTCCAACCACCCCCAGCCACGGAGCGCCCTGCAGGCTGCCAAGGACCAGTTCAAC
Dipodomys_ordii|4073                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|13217 GTGGTCTCCAACTACCCCCAGCCCCGGAGTGCCCTACAGGCTGCCAAGGACCAGTTCAAT
Otolemur_garnettii|6861             ATGGTCTCCAACTACCCCCAGCCCCGGAGTGCCCTCCAGGCTGCCAAGGACCAGTTCAAC
Microcebus_murinus|6370             GTGGTCTCCAACTACCCCCAGCCCCGGAGCGCCCTGCAGGCTGCCAAGGACCAGTTCAGC
Oryctolagus_cuniculus|25012         GAGGTCTCCAACTACCCCCAGCCCCGGAGCGCCCTGCAGGCTGCCAAGGACCAGTTCAGC
Ochotona_princeps|13529             GTGGTCTCCAACTACCCCCAGCCCCGGAGCGCCCTGCAGGCCGCCAAGGACCAGTTCAGC
Mus_musculus|16778                  GAGATCTCCAACTACCCCCAGCCCCGGAACACCCTGCAGGTCGCCAAGGACCACTTCAAT
Rattus_norvegicus|5070              GAGATCTCCAACTATCCCCAGCCCCGGAGCACCCTGCAGGTCGCCAAGGACCAGTTCAAC
Cavia_porcellus|15563               GAGGTCTCCAACTACCCCCAGCCCCGGAGCGCCCTCCAGGCCGCCAAGGACCAGTTCAGC
Callithrix_jacchus|20559            GTGGTCTCTAACTTCCCCCAGCCCCGGAGTGCCCTGCAGGCCGCCAAGGACCAGTTCAAC
Gorilla_gorilla|28689               GTGGTCTCCAACTTCCCCCAGCCCCGGAGCGCCCTGCAGGCTGCCAAGGACCAGTTCAAC
Homo_sapiens|30539                  GTGGTCTCCAACTTCCCCCAGCCCCGGAGCGCCCTGCAGGCTGCCAAGGACCAGTTTAAC
Pan_troglodytes|13792               GTGGTCTCCAACTTCCCCCAGCCCCGGAGCGCCCTGCAGGCTGCCAAGGACCAGTTCAAC
                                                                                          ..    

Tarsius_syrichta|13855              ATGGGCCGGAAGGGATTTGACATCGCCCTCAACCTGCTCTTTGCCATGGCTTTCTTGGCC
Tupaia_belangeri|17270              GAGGGCCGGGAGGGCTTCGACATCACCCTCAACCTGCTCTTCGCCATGGCGTTCTTGGCC
Dipodomys_ordii|4073                NNGGGCCGGAAAGGATTTGACATCGCCCTCAACTTGCTCTTCGCCATGGCATTTCTGGCC
Spermophilus_tridecemlineatus|13217 GAGGGCCGAAAGGGGTTCGACATTGCCCTCAATTTGCTATTTGCCATGGCATTCCTGGCC
Otolemur_garnettii|6861             GAGGGCCGGAAGGGGTTTGACATCGCCCTCAATTTGCTC---GCCATGGCATTCCTGGCC
Microcebus_murinus|6370             GAGGGCCGAAAGGGCTTTGACATCGCCCTCAATTTGCTCTTCGCCATGGCCTTCTTGGCC
Oryctolagus_cuniculus|25012         GAGGGCCGGAAGGGCTTTGACATCGCCCTCAACCTGCTCTTTGCCATGGCCTTCCTGACC
Ochotona_princeps|13529             GAGGGCCGGAAGGGCTTCGACATCGCCCTCAATCTGCTCTTTGCCATGGCCTTCCTGGCC
Mus_musculus|16778                  GAGGGCCGGAAGGGATTTGACATTGCCCTCAATTTGCTCATCGCCATGGCATTTCTGGCC
Rattus_norvegicus|5070              GAGGGCCGGAAGGGATTTGACATTGCCCTCAATTTGCTCATCGCCATGGCATTTCTGGCC
Cavia_porcellus|15563               GAGGGCCGAAAGGGATTTGACATTGCCCTCAATTTGCTCTTTGCCATGGCATTCCTAGCT
Callithrix_jacchus|20559            GAGGGCCGGAAGGGATTTGACATTGCCCTCAACCTGCTCTTCGCCATGGCATTCTTGGCC
Gorilla_gorilla|28689               GAGGGCCGGAAGGGATTCGACATTGCCCTCAACCTGCTCTTCGCCATGGCATTCTTGGCC
Homo_sapiens|30539                  GAGGGCCGGAAGGGATTCGACATTGCCCTCAACCTGCTCTTCGCCATGGCATTCTTGGCC
Pan_troglodytes|13792               GAGGGCCGGAAGGGATTCGACATTGCCCTCAACCTGCTCTTTGCCATGGCATTCTTGGCC
                                      ******..*.** ** ***** .*******  ****.   ******** **  *..* 

Tarsius_syrichta|13855              AGCACATTTTCCATTCTGGCGGTCAGCGAGAGAGCCGTCCAGGCCAAGCATGTCCAGTTT
Tupaia_belangeri|17270              AGCACGTTTGCCGTCCTGGCTGTCAGTGAGCGGGCCGTGCGGGCCAAGCACATGCAGTTT
Dipodomys_ordii|4073                AGCACATTTTCTGTCCTAGCAGTCAGCGAGAGGGCCGTCCAGGCCAAGCATGTCCAGTTT
Spermophilus_tridecemlineatus|13217 AGCACCTTTTCCATCCTGGCAGTCAGTGAGAGGGCCGTCCAGGCCAAGCATGTCCAGTTT
Otolemur_garnettii|6861             AGCACATTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|6370             AGCACGTTCTCCATCCTGGCGGTCAGTGAGAGGACCGTGCAGGCCAAGCATGTGCAGTTT
Oryctolagus_cuniculus|25012         AGCACGTTCTCCATCCTGGCGGTCAGCGAGAGGGCCGTCCAGGCCAAGCACGTCCAGTTT
Ochotona_princeps|13529             AGCACATTCTCCATCCTGGCGGTCAGTGAGAGGGCTGTGCAGGCCAAGCACGTCCAGTTT
Mus_musculus|16778                  AGCACCTTTTCCATCCTGGCTGTCAGTGAGAGGGCCGTCCAGGCCAAGCACGTTCAGTTT
Rattus_norvegicus|5070              AGCACGTTTTCGATCCTGGCAGTCAGTGAGAGGGCCGTCCAAGCCAAGCACGTTCAGTTT
Cavia_porcellus|15563               AGCACATTCTCCATACTGGCAGTCAGCGAGAGGACTGTCCAGGCCAAGCATGTTCAGTTT
Callithrix_jacchus|20559            AGCACATTCTCCATCCTGGCGGTCAGTGAGAGGGCCGTGCAGGCCAAGCATGTGCAGTTT
Gorilla_gorilla|28689               AGCACGTTCTCCATCCTGGCGGTCAGCGAGAGGGCCGTGCAGGCCAAGCATGTGCAGTTT
Homo_sapiens|30539                  AGCACGTTCTCCATCCTGGCGGTCAGCGAGAGGGCCGTGCAGGCCAAGCATGTGCAGTTT
Pan_troglodytes|13792               AGCACGTTCTCCATCCTGGCAGTCAGCGAGAGGGCCGTGCAGGCCAAGCATGTGCAGTTT
                                    ***** **     .  . .  ..  . . . .    ..    .    .    .   ....

Tarsius_syrichta|13855              GTGAGCGGAGTCCGTGTGGCTACTTTCTGGCTCTCCGCCCTGCTGTGGGACCTCATCTCC
Tupaia_belangeri|17270              GTGAGCGGGGTGCACGCGGCCACATTCTGGCTGTCTGCCCTGCTGTGGGACCTCGCCTCC
Dipodomys_ordii|4073                GTGAGCGGCGCCCACGTGGCGACTTTCTGGCTCTCTGCTCTGCTGTGGGACCTCCTCTCC
Spermophilus_tridecemlineatus|13217 GTGAGCGGTGTCCATGTGGCTACTTTCTGGTTCTCTGCTCTGCTATGGGACCTCATCTCC
Otolemur_garnettii|6861             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|6370             GTGAGCGGAGTCCGCGTGGCTACTTTCTGGCTCTCCGCTCTGCTGTGGGACCTCGTCTCC
Oryctolagus_cuniculus|25012         GTGAGCGGAGTCCGCGTGGCCACTTACTGGCTCTCTGCTCTGCTGTGGGACCTCATCTCC
Ochotona_princeps|13529             GTGAGCGGAGTCCACGTGGCTACCTACTGGCTCTCGGCTCTGCTGTGGGACCTCATTTCC
Mus_musculus|16778                  GTGAGCGGTGTCCATGTGGCTACTTTCTGGTTCTCCGCTCTGTTGTGGGACCTCATCTCC
Rattus_norvegicus|5070              GTGAGCGGTGTCCATGTGGCTACTTTCTGGCTCTCTGCTCTGCTGTGGGACCTCATCTCT
Cavia_porcellus|15563               GTGAGTGGTATGCATGTGGCTACTTTTTGGCTCTCTGCTCTGCTGTGGGACCTCATCTCC
Callithrix_jacchus|20559            GTGAGCGGAGTCCACGTGGCCACTTTCTGGCTCTCCGCTCTGCTGTGGGACCTCATCTCC
Gorilla_gorilla|28689               GTGAGTGGAGTCCATGTGGCCAGTTTCTGGCTCTCTGCTCTGCTGTGGGACCTCATCTCC
Homo_sapiens|30539                  GTGAGTGGAGTCCACGTGGCCAGTTTCTGGCTCTCTGCTCTGCTGTGGGACCTCATCTCC
Pan_troglodytes|13792               GTGAGTGGAGTCCACGTGGCCAGTTTCTGGCTCTCTGCTCTGCTGTGGGACCTCATCTCC
                                    ... . ..       . ..     .  ... . .  .   .. . ....   .    .  

Tarsius_syrichta|13855              TTCCTTGTCCCCAGTCTGCTGCTGCTGGTGGTGTTCAAAGCCTTTGATGTGCACGCCTTC
Tupaia_belangeri|17270              TTCCTCGTCCCCAGCCTGCTGCTGCTGGCGGTGTTTGCCTACCACGAGGAGGAAGCTTTC
Dipodomys_ordii|4073                TTCCTCGTCCCCACCCTGCTACTGCTGGTGGTGTTTCGAGCTTTTGACGTGCGTGCCTTC
Spermophilus_tridecemlineatus|13217 TTCTTGGTCCCTGCTCTGCTGCTGTTGGTGGTGTTCAGAGCCTTCGATGTTCGCGCCTTC
Otolemur_garnettii|6861             NNNNNNNNNNNNNNNNNNNNNNNNNNNGCAGTATTCAAAGCCTTTGATGTGCACGCCTTC
Microcebus_murinus|6370             TTCCTCGTCCCCAGTCTGCTGCTGCTGGTGGTGTTCAAAGCCTTCGACGTGCGCGCCTTC
Oryctolagus_cuniculus|25012         TTCCTCGTCCCCAGCCTGCTGCTGCTCGCGGTGTTCCGGGCCTTTGACGTGCGCGCCTTC
Ochotona_princeps|13529             TTCCTGGTCCCTAGCCTGCTGCTGCTTGCGGTGTTCCGGGCCTTTGATGTGCGTGCCTTC
Mus_musculus|16778                  TTCCTCGTTCCCAGTCTACTACTTCTGGTGGTGTTCCAAGCCTTCAATGTGCACGCCTTC
Rattus_norvegicus|5070              TTCCTCGTTCCCAGTCTACTACTTCTGGTGGTGTTCCGAGCCTTCGATGTGCACGCCTTC
Cavia_porcellus|15563               TTCCTCATCCCCATTCTACTACTGCTGGTGGTATTCCGGGCCTTCGATGTACGTGCCTTC
Callithrix_jacchus|20559            TTCCTCATCCCCAGTCTGCTGCTGCTGGTGGTGTTCAAGGCCTTCGATGTGCGTGCCTTC
Gorilla_gorilla|28689               TTCCTTATCCCCAGTCTGCTGCTGCTGGTGGTGTTCAAGGCCTTCGACGTGCGTGCCTTC
Homo_sapiens|30539                  TTCCTCATCCCCAGTCTGCTGCTGCTGGTGGTGTTTAAGGCCTTCGACGTGCGTGCCTTC
Pan_troglodytes|13792               TTCCTCATCCCCAGTCTGCTGCTGCTGGTGGTGTTTAAGGCCTTCGACGTGCGTGCCTTC
                                    ..  .  .        .  .  .  . * .**.**     .  : .* *:  . ** ***

Tarsius_syrichta|13855              ACACGGGACGGCCATGTGGCCGATACCCTGCTGCTGCTGCTGCTCTATGGCTGGGCCATC
Tupaia_belangeri|17270              TCACAGCGCGAGAACGCCCTGGCCGTCACCCTGTTGCTCTCGCTCTACGGCTCCGCCATC
Dipodomys_ordii|4073                ACACGGGACGGCCACATGGCCGATCTCCTGCTGCTGCTGCTGCTGTATGGCTGGGCCATC
Spermophilus_tridecemlineatus|13217 ACACGGGATGGACACATGGCTGACGTGCTGCTGCTGCTTATGCTCTATGGCTGGGCCATC
Otolemur_garnettii|6861             ACAAGGGACAGCCACCCAGCCGATGTGCTGCTGCTGCTTCTGCTGTACGGCTGGGCTATC
Microcebus_murinus|6370             ACGAGGGACGGCCATGTGGCCGACACGCTGCTGCTGCTCCTACTGTACGGTTGGGCCATC
Oryctolagus_cuniculus|25012         ACGTGGGACGGCCACGCAGCCGGCACGCTGCTGCTGCTGCTGCTGTACGGCTGGGCCATC
Ochotona_princeps|13529             GCGTGGGACGGCCGGGCGGCTGACACGCTGCTGCTGCTGTTGCTGTACGGCTGGGCCATC
Mus_musculus|16778                  ACGAGGGATGGTCACATGGCTGACCTGCTGCTGCTGCTCATGCTCTACGGCTGGGCCATC
Rattus_norvegicus|5070              ACGAGGGATGGCCACATGGCTGACTTGCTGCTGCTGCTCATGCTCTATGGCTGGGCCATC
Cavia_porcellus|15563               ATACAGGATGGTCATGCAGCCGACATGCTGCTGCTGCTCATGCTATACGGCTGGGCCATT
Callithrix_jacchus|20559            ACGCGGGATGGCCACGTGGCCGACACCCTGCTGCTGCTCCTGCTTTATGGCTGGGCCATC
Gorilla_gorilla|28689               ACGCGGGACGGCCACGTGGCCGACACCCTGCTGCTGCTCCTGCTCTACGGCTGGGCCATC
Homo_sapiens|30539                  ACGCGGGACGGCCACATGGCTGACACCCTGCTGCTGCTCCTGCTCTACGGCTGGGCCATC
Pan_troglodytes|13792               ACACGGGACGGCCACATGGCCGACACCCTGCTGCTGCTCCTGCTCTACGGCTGGGCCATC
                                      . .* . .. ..       *     .  *** ****   .** ** ** *  ** ** 

Tarsius_syrichta|13855              ATCCCCCTCATGTACCTGATGAACTTCTTCTTCTCGGGGGCAGCTACTGCCTACACGAGG
Tupaia_belangeri|17270              GCGCCCTTCACCTACCTGGCCAGCTTCTTCTTCGACAGCGCGGGCAGCGCCTGCGTGAAG
Dipodomys_ordii|4073                ATCCCCTTCATGTACCTCATGAGTTTCTTCTTCTCGAGCGCATCCACAGCCTACACCAGG
Spermophilus_tridecemlineatus|13217 ATCCCCTTTATGTACCTCATGAGCTTCTTCTTCTCGGGCGCATCCACTGCCTACACCAGG
Otolemur_garnettii|6861             ATCCCTCTCATGTACCTGTCGACATTCTTCTTCTCGGGGGCAGCTACTGCCTACACAAGG
Microcebus_murinus|6370             ATCCCCCTCATGTACCTGATGAATTTCTTCTTCTCGGGGGCAGCCACCGCCTATGCGAGG
Oryctolagus_cuniculus|25012         ATCCCCCTCATGTACCTGATGAGCTTCTTGTTCTCGAGCGCGGCCACCGCCTACACCAGG
Ochotona_princeps|13529             ATTCCCCTCATGTATCTCCTGAGCTGCCTCTTCTCCAGCGCGGCCACCGCCTACACCCGC
Mus_musculus|16778                  ATCCCCCTCATGTACCTCATGAGCTTCTTCTTCTCGGCTGCGTCCACAGCTTATACCAGG
Rattus_norvegicus|5070              ATCCCCCTCATGTACCTCCTGAGCTTCTTCTTCTCAGCTGCGTCCACGGCTTACACCAGG
Cavia_porcellus|15563               GTCCCCCTCATGTATCTCCTAAGTTTCTTCTTCTCGGGCGCGTCCACTGCCTACACCAGA
Callithrix_jacchus|20559            ATCCCGCTCATGTACCTGATGAACTTCTTCTTCTCCGGGGCGGCCACCGCCTACACAAGG
Gorilla_gorilla|28689               ATCCCCCTCATGTACCTGATGAACTTCTTCTTCTTGGGGGCGGCCACCGCCTACACGAGG
Homo_sapiens|30539                  ATCCCCCTCATGTACCTGATGAACTTCTTCTTCTTGGGGGCGGCCACTGCCTACACGAGG
Pan_troglodytes|13792               ATCCCCCTCATGTACCTGATGAACTTCTTCTTCTTGGGGGCGGCCACCGCCTACACGAGG
                                    .  **  * *  ** **    *  * * * ***   .  **.   *  ** *. .  .. 

Tarsius_syrichta|13855              CTGACCATATTCAACATCCTGTCGGGCATTGCCACCTTCCTGATGGTCACCATCATGCGC
Tupaia_belangeri|17270              CTCGTCGTGCTGCTCACCTTCCTGAGCATCGGCCCCTTCATCCTCGTCTCGGTCACGAGC
Dipodomys_ordii|4073                CTGACCATATTCAACATCCTGTCGGGCATCGTCACCTTCATCATGGTCACTATCATGCGC
Spermophilus_tridecemlineatus|13217 CTGACCATCTTCAACATTCTGTCAGGCATCGCCACCTTCCTAGTGGTCACCATCATGCGC
Otolemur_garnettii|6861             CTGACCATATTCAACATCCTATCGGGCATCGCCACCTTCCTTGTGGTCACCATCATGCGC
Microcebus_murinus|6370             CTGACCATATTCAACATCCTGTCGGGCATTGCCACCTTCCTCATGGTCACCATCATGCGC
Oryctolagus_cuniculus|25012         CTGACCATATTCAACGTCCTGTCGGGCATCGCCACCTTCCTCATGGTCACCATCATGCGC
Ochotona_princeps|13529             TTGACCATCGTCAACATCCTGTCGGGCATCGCCACCTTCCTCATGGTTACCATCATGCGC
Mus_musculus|16778                  CTGACCATATTCAACATCCTGTCGGGCATCGCTACCTTCATCATGGTCACTATCATGCGT
Rattus_norvegicus|5070              CTGACCATATTCAACATCCTGTCGGGCATAGCCACCTTCATCGTGGTCACTATCATGAGG
Cavia_porcellus|15563               TTGACCATATTCAATATCCTGTCCGGCATTGCCACCTTCCTCATGGTCACTATCATGCGC
Callithrix_jacchus|20559            CTAACCATCTTCAACATCCTGTCGGGCATCGCCACCTTCCTGATGGTCACCATCATGCGC
Gorilla_gorilla|28689               CTGACCATCTTCAACATCCTGTCAGGCATCGCCACCTTCCTGATAGTCACCATCATGCGC
Homo_sapiens|30539                  CTGACCATCTTCAACATCCTGTCAGGCATCGCCACCTTCCTGATGGTCACCATCATGCGC
Pan_troglodytes|13792               CTGACCATCTTCAACATCCTGTCAGGCATCGCCACCTTCCTGATGGTCACCATCATGCGC
                                     * . *.*  * .: .   *    .**** *  .*****.*  * ** :* .*** *.* 

Tarsius_syrichta|13855              ATCCCAGCAGTAAAATTGGAAGAACTTTCCAGAACCCTGGATCATGTATTCCTGGTGCTG
Tupaia_belangeri|17270              GAGCAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|4073                ATCCCAGCGGTAAAGTTGGAAGAACTTTCCAGAACCCTGGATCATGTGTTCCTGGTGCTG
Spermophilus_tridecemlineatus|13217 ATCCCAGCAGTGAAGCTCGAAGAACTTTCCAGAACCCTGGATCACGTGTTCCTGGTGCTG
Otolemur_garnettii|6861             ATCCCAGCGGTAAAATTAGAAGAACTTTCCAGAACCCTGGACCATGTGTTCCTGGTGCTG
Microcebus_murinus|6370             ATCCCAGCAGTAAAATTAGAAGAACTTTCCAGAACTCTGGACCACGTGTTCCTGGTGCTG
Oryctolagus_cuniculus|25012         ATCCCAGCGGTAAAACTAGAAGAACTTGCCAGAACCCTGGACCGGGTGTTCCTGGTGCTG
Ochotona_princeps|13529             ATCCCAGCGGTAAAGCTAGAAGAACTTTCTAGAACACTGGATCATGTTTTCCTGGTGCTG
Mus_musculus|16778                  ATCCCAGCTGTGAAGTTAGAAGAACTTTCCAGAACCTTAGATCATGTGTTCTTGGTGCTG
Rattus_norvegicus|5070              ATCCCAGCTGTGAAGTTAGAAGAGCTTTCCAGAACCTTAGATCATGTGTTCTTGGTGCTG
Cavia_porcellus|15563               ATCCCAGCCTTGAAGTTGGAAGAACTTTCCAGAACCCTGGATCATGTGTTCCTGGTGCTG
Callithrix_jacchus|20559            ATCCCAGCTGTAAAACTGGAAGAACTTTCCAAAACCCTGGATCACGTGTTCCTGGTGCTG
Gorilla_gorilla|28689               ATCCCAGCTGTAAAACTGGAAGAACTTTCCAAAACCCTGGATCGCGTGTTCCTGGTGCTG
Homo_sapiens|30539                  ATCCCAGCTGTAAAACTGGAAGAACTTTCCAAAACCCTGGATCACGTGTTCCTGGTGCTG
Pan_troglodytes|13792               ATCCCAGCTGTAAAACTGGAAGAACTTTCCAAAACCCTGGATCGCGTGTTCCTGGTGCTG
                                    .: *..*   .     . .  .   ..          . .     .. ..  ..... ..

Tarsius_syrichta|13855              CCCAACCACTGTCTGGGGATGGCAGTCAGCAGCTTCTACGAGAACTACGAGACGCGGAGG
Tupaia_belangeri|17270              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|4073                CCCAACCACTGTTTGGGGATGGCAGTCAGCAGCTTCTATGAGAACTATGAAACCCGCCAG
Spermophilus_tridecemlineatus|13217 CCCAACCACTGTCTGGGGATGGCTGTCAGCAGTTTCTATGAGAACTATGAGACACAGCGG
Otolemur_garnettii|6861             CCCAACCATTGTCTGGGGATGGCGGTCAGCAGCTTCTACGAGAACTACGAGACACGGAGG
Microcebus_murinus|6370             CCCAACCACTGTCTGGGGATGGCGGTCAGCAGCTTCTACGAGAACTACGAGACACGGAGG
Oryctolagus_cuniculus|25012         CCCAACCACTGCCTGGGAATGGCGGTCAGCAGCTTCTACGAGAACTATGAGACCAAACAC
Ochotona_princeps|13529             CCCAACCACTGCCTGGGGATGGCGGTCAGCAACCTCTACGAGAACTACGAAACCCAGCGC
Mus_musculus|16778                  CCAAACCACTGCCTGGGGATGGCGGTCAGCAACTTCTATGAGAACTATGAGACTCGGCGA
Rattus_norvegicus|5070              CCAAACCACTGCCTGGGGATGGCGGTCAGCAACTTCTATGAGAACTATGAGACTCGGCGC
Cavia_porcellus|15563               CCCAACCATTGCCTAGGAATGGCAGTCAGCAGCTTCTATGAGAACTACGAGACACGGCGT
Callithrix_jacchus|20559            CCCAACCACTGTCTGGGGATGGCAGTCAGCAGCTTCTATGAGAACTACGAGACGCGGAGG
Gorilla_gorilla|28689               CCCAACCACTGTCTGGGGATGGCAGTCAGCAGTTTCTACGAGAACTACGAGACGCGGAGG
Homo_sapiens|30539                  CCCAACCACTGTCTGGGGATGGCAGTCAGCAGTTTCTACGAGAACTACGAGACGCGGAGG
Pan_troglodytes|13792               CCCAACCACTGTCTGGGGATGGCAGTCAGCAGTTTCTACGAGAACTACGAGACGCGGAGG
                                             ..  . ..  ...  ..  .     . .  . .   .  .           

Tarsius_syrichta|13855              TACTGTACCTCCTCTGAGGTCGCCGCACACTACTGCAAGAAGTACAACATCGAGTACCAA
Tupaia_belangeri|17270              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACATCAAGTACCAG
Dipodomys_ordii|4073                TACTGCACCTCCTCAGAAGTTGCCTCCCACTACTGCAAGAAGTACAACATCCAGTACCAG
Spermophilus_tridecemlineatus|13217 TACTGCACCTCCTCAGAGGTCGCCGCCCACTACTGCAAGAAATACAATATTAAGTACCAG
Otolemur_garnettii|6861             TACTGCACCTCCTCTGAGGTCGCTGCCCACTACTGCAAGAAGTACANNNNNNNNNNNNNN
Microcebus_murinus|6370             TACTGCACCTCCTCCGAGGTCGCTGCCCACTACTGCAAGAAGTACAACATCGAGTACCAG
Oryctolagus_cuniculus|25012         TACTGCACCTCCTCGGAGATTGCCGCTCACTACTGCAAGAAGTTCAACATCGTGTACCAG
Ochotona_princeps|13529             TACTGCACATCCTCAGAGATCGCTGCCCACTACTGCAAAAAGTACAACATTGTGTACCAG
Mus_musculus|16778                  TACTGCACTTCCTCAGAGCTTGCTGCCCACTACTGCAAGAAGTACAACATCCAGTACCAG
Rattus_norvegicus|5070              TACTGCACGTCCTCGGAGGTTGCTACCCACTACTGCAAGAAGTACAACATCCAATACCAG
Cavia_porcellus|15563               TACTGCACCTCTTCAGATGTTGCCACCCACTACTGCAAGAAGTACAACATTGAATACCAG
Callithrix_jacchus|20559            TACTGCACCTCTTCCGATGTTGCTGCCCACTACTGCAAGAAATACGACATCCAGTATCAG
Gorilla_gorilla|28689               TACTGCACCTCCTCCGAGGTCGCCGCCCACTACTGCAAGAAATACAACATCCAGTACCAG
Homo_sapiens|30539                  TACTGCACCTCCTCCGAGGTCGCCGCCCACTACTGCAAGAAATATAACATCCAGTACCAG
Pan_troglodytes|13792               TACTGCACCTCCTCCGAGGTCGCCACCCACTACTGCAAGAAATATAACATCCAGTACCAG
                                    .  ..    .  .  .   . .        .  ..       .      .    .     

Tarsius_syrichta|13855              GAGAACTTCTATGCCTGGAACACCCCAGGGGTTGGCAGGTTTGTGGTCTCCATGGCAACC
Tupaia_belangeri|17270              GAGAACTTCTACGCGTGGAATGCCCCAGGGGTGGGCAGGTTCGTGACCTCCATGGCTGCC
Dipodomys_ordii|4073                GAAAACTTCTACGCGTGGAACACGCCGGGGGTGGGCAGGTTTGTGACCTCCATGGCTGCC
Spermophilus_tridecemlineatus|13217 GAGAACTTCTTCGCCTGGAGCGCCCCAGGGGTTGGCAGGTTCATGACCTCTATGGCTGCC
Otolemur_garnettii|6861             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|6370             GAGAACTTCTACGCCTGGAGGGCCCCGGGCGTCGGCAGGTTCGTGGCCTCCATGGCTGCC
Oryctolagus_cuniculus|25012         GAGAACTTCTTCGCGTGGAGCGCGCCCGGGGTCGGCAGATTTGTGACCTCCATGGCCGCC
Ochotona_princeps|13529             GAGAACTTCTACGCGTGGAGTGCCCCGGGGGTCGGCAGGTTCGCGACCTCCATGGCCGCC
Mus_musculus|16778                  GAGAGCTTCTATGCCTGGAGCACCCCAGGCGTGGGCAAGTTTGTGACTTCCATGGCTGCC
Rattus_norvegicus|5070              GAGAACTTCTATGCCTGGAGCACCCCAGGCATTGGCAAGTTTGTGACTTCCATGGCTGCC
Cavia_porcellus|15563               GAGAACTTCTATGCCTGGAGCATGCCGGGGGTTGGCAGGTTTGTGACTTCCATGGCTACC
Callithrix_jacchus|20559            GAGAACTTCTATGCCTGGAGCGCTCCAGGGGTCGGCAGGTTCGTGGCCTCCATGGCCACC
Gorilla_gorilla|28689               GAGAACTTCTATGCTTGGAGCGCCCCGGGGGTCGGCCGGTTCGTGGCCTCCATGGCCGCC
Homo_sapiens|30539                  GAGAACTTCTATGCCTGGAGCGCCCCGGGGGTCGGCCGGTTTGTGGCCTCCATGGCCGCC
Pan_troglodytes|13792               GAGAACTTCTATGCCTGGAGCGCCCCGGGGGTCGGCCGGTTCGTGGCCTCCATGGCCGCC
                                    .     .. .  .  ...         ..  . ..    ..   .   .   ...     

Tarsius_syrichta|13855              TCTGGGTGCACCTACCTCATCCTGCTCTTCCTCATTGAGACCAACCTGCTGCGCAGACTG
Tupaia_belangeri|17270              TCAGGGTTCATCTACCTCGCCCTGCTCTTCCTCATCGAGACCAACCTGCTGTGGGGGCTG
Dipodomys_ordii|4073                TCGGGGTGTGCCTACCTCAGCCTGCTCTTCCTCATCGAGACCAACCTGCTGTGGAGACTG
Spermophilus_tridecemlineatus|13217 TCAGGGTGTGCCTACCTCACCCTGCTCTTCCTCATTGAGACCAACCTGCTGTGGAGACTG
Otolemur_garnettii|6861             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|6370             TCAGGGTGTGCATATCTCTCTCTGCTCTTCCTCATCGAGACCAACCTGCTGTGGAGACTT
Oryctolagus_cuniculus|25012         TCGGGGTGCGCCTACCTCACCCTGCTCTTCCTCATCGAGACCGACCTGCTGTGGAGACTG
Ochotona_princeps|13529             TCGGGGTGTTTCTACCTCAGCCTGCTCTTCCTCATCGAGACCAACCTACTGCAGAGGCTG
Mus_musculus|16778                  TCAGGGGGCATCTACCTCACCCTGCTGTTCCTCATTGAGACCAACCTGCTGTGGCGACTG
Rattus_norvegicus|5070              TCAGGGGGCATCTACCTCACCCTGCTCTTCCTCATTGAGACCAACCTGCTGTGGAGACTG
Cavia_porcellus|15563               TCAGGGTGTGTCTACCTCACCTTGCTCTTCCTCATTGAAACCAACCTGCTATGGAGACTG
Callithrix_jacchus|20559            TCAGGATGCGCCTACCTCATCCTGCTCTTCCTCATCGAGACCAACCTGCTGCAGAGACTC
Gorilla_gorilla|28689               TCAGGGTGCGCCTACCTCATCCTGCTCTTCCTCATCGAGACCAACCTGCTTCAGAGACTC
Homo_sapiens|30539                  TCAGGGTGCGCCTACCTCATCCTGCTCTTCCTCATCGAGACCAACCTGCTTCAGAGACTC
Pan_troglodytes|13792               TCAGGGTGCGCCTACCTCATCCTGCTCTTCCTCATCGAGACCAACCTGCTTCAGAGACTC
                                    .  ..       .   .     .. . ..  .  . .         .  .     .  . 

Tarsius_syrichta|13855              AAGTCCTTCTTCTGTGCCTTCTGGAGGAGGCAGACGTTGACAGAATTGTACACCCGGATG
Tupaia_belangeri|17270              CGGACCGCCGTCTGTGCCTTCTGGAGGCGGCGGATGCTGACAGAACTGTGCAGCCGCAGC
Dipodomys_ordii|4073                AGGACCTTTATCTGTGCCTTTCAGAGGAGGTGGACCCTGGCAGAATTGCATAGCCGGACT
Spermophilus_tridecemlineatus|13217 AGGACCTTTATCTGTGCCTTCCAGAAGAGGTGGACATTGGAAGAATTGCACAACCGGACA
Otolemur_garnettii|6861             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACAGAATTGTGCACCCGGACA
Microcebus_murinus|6370             AGGACCTTCCTCTGTGCCTTCCGGAGGAAGCAGACGCTGGCGGAACTGTGCACCCGGACG
Oryctolagus_cuniculus|25012         AGGAACTCCGTCTGTGCCTTCCGGAGGAGGTGGACGCTGGCAGAACTGTGCGCCCAGACA
Ochotona_princeps|13529             AGGAGCGCCGTGTGTGCCTTGCGGAGAAGGCGGACTCTGGCAGAGCTGTGCGCCCAGACC
Mus_musculus|16778                  AGAACCTTCATCTGTGCCTTCCGGAGGAGGTGGACTCTGGCAGAACTGCAGAACCGGACA
Rattus_norvegicus|5070              AGAACCTTTGTCTGCGCCTTCCGGAGGAGGTGGACTCTGGCAGAATTGCAGAACCGGACA
Cavia_porcellus|15563               AGGACCTTCGTCTGTGCCTTTTGGAGGAGGTGGATGCTGGCAGAATTGCACAGCCGAACA
Callithrix_jacchus|20559            AGGGGCATCCTCTGTGTCTTCTGGAGGAGGCGGACACTGGCAGAATTGTACACTCGGATG
Gorilla_gorilla|28689               AGGGGCATCCTCTGCGCCCTCCGGAGGAGGCGGACACTGACAGAATTACACACCCGGATG
Homo_sapiens|30539                  AGGGGCATCCTCTGCGCCCTCCGGAGGAGGCGGACACTGACAGAATTATACACCCGGATG
Pan_troglodytes|13792               AGGGGCATCCTCTGCGCCCTCCGGAGGAGGCGGACACTGACAGAATTATACACCCGGATG
                                              . .. .   .   .     .  .    .....**. *. . .  *. *  

Tarsius_syrichta|13855              TCCGTACTTCCTGAGGACCAAGATGTGGCAGATGAGAGGAGTCGCATCCTGGCCCCCAGC
Tupaia_belangeri|17270              GCAGTGCTGCCCGAGGACCAGGATGTGGCCGCCGAGAGGAGCCGGATCCTGGCCCCCAGC
Dipodomys_ordii|4073                TCAGTGCTTCCTGAGGACCAAGATGTAGCAGATGAGAGGAACCGAGTCCTGGCCCCCAGC
Spermophilus_tridecemlineatus|13217 TCAGTGCTTCCTGAGGACCAGGATGTGGCAGATGAGAGGAGCCGAGTCCTGGCCCCTGGC
Otolemur_garnettii|6861             TCGGTACTCCCAGAAGACCAAGATGTGGCAGATGAGAGGAGCCGAGTTCTGGCCCCCAGC
Microcebus_murinus|6370             TCGGTGCTTCCTGAGGACCAAGATGTGGCAGACGAGAGGAGCCGGGTCCTGGCCCCCAGC
Oryctolagus_cuniculus|25012         GCGCTGCTTCCTGAGGACCAGGATGTGGCTGAAGAGAGGAGCCGGGTCCTGGCCCCCAGC
Ochotona_princeps|13529             GCGCTGCTCCCTGAGGACCAAGACGTGGCTAATGAGAGGAACCGGGTCCTGGCCCCCAGC
Mus_musculus|16778                  TCAGTGCTGCCCGAGGACCAGGATGTAGCTGAGGAGAGGAGCCGAATCCTGGTCCCTAGC
Rattus_norvegicus|5070              TCAGTGCTTCCTGAGGACCAGGATGTAGCTGATGAGAGGAGCCGAGTCCTGGTCCCTAGC
Cavia_porcellus|15563               TCAGTGGTTCCTGAGGACCTCGATGTGGCACAAGAGAGGAACCGAGTCCTGACTCCTGGC
Callithrix_jacchus|20559            CCTGTGCTTCCTGAGGACCAAGATGTGGTGGATGAGAGGACCCGCATCCTGGCCCCCAGT
Gorilla_gorilla|28689               CCTGTGCTTCCTGAGGACCAAGATGTAGCGGACGAGAGGACCCGCATCCTGGCCCCCAGC
Homo_sapiens|30539                  CCTGTGCTTCCTGAGGACCAAGATGTAGCGGACGAGAGGACCCGCATCCTGGCCCCCAGT
Pan_troglodytes|13792               CCTGTGCTTCCTGAGGACCAAGACGTAGCGGACGAGAGGACCCGCATCCTGGCCCCCAGC
                                     *  *. * ** **.****: ** **.*   . *******  ** .* ***.  ** .* 

Tarsius_syrichta|13855              CTGGATTCCCTGCTTGACACCCCTCTGATTATCAAGGAGCTCTCCAAGGTGTATGAGCAG
Tupaia_belangeri|17270              CTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAGTATGAACAG
Dipodomys_ordii|4073                CTGGAATCC------CACACGCCCCTGATCATCAAGGAGATTTCTAAGGTATATGACCAG
Spermophilus_tridecemlineatus|13217 CTGGACATCCTGCTGCACACGCCTCTGACAATCAGGGAGCTCTCCAAGGTGTATGAGCAG
Otolemur_garnettii|6861             TTGGATGCCCTGCTCAACACACCTCTGGTTATCAAGGAGCTCTCGAAGGTGTACGAGCAG
Microcebus_murinus|6370             CTGGACTCCCTGCTTGACACGCCTCTGGTCATCAAGGAGCTCTCCAAGGTGTACGAGCAG
Oryctolagus_cuniculus|25012         CTGGGCCCCCTGCTCGACGCACCGCTGATCATCAAGGAGCTGTCCAAGGTGTATGAGCAG
Ochotona_princeps|13529             CCAGACCCCCTGCTGGACGCACCACTTGTCATCAAGGAGCTGTCCAAGGTGTATGACCAG
Mus_musculus|16778                  TTGGACTCCATGCTCGACACACCACTGATCATCAACGAGCTCTCCAAGGTGTATGACCAG
Rattus_norvegicus|5070              TTGGACTCCATGCTTGACACACCGCTGATCATCAATGAGCTCTCCAAGGTGTATGACCAG
Cavia_porcellus|15563               CTGGACTCTTTGCTGGACACACCTCTAATCATCAAGGAGCTTTCCAAGGTATATGAACAG
Callithrix_jacchus|20559            TCAGACTTCCTGCTCCACACACCTCTGATTATCAAGGAGCTCTCCAAGGTGTACGAGCAG
Gorilla_gorilla|28689               CCGGACTCCCTGCTCCACACACCTCTGATTATCAAGGAGCTCTCCAAGGTGTACGAGCAG
Homo_sapiens|30539                  CCGGACTCCCTGCTCCACACACCTCTGATTATCAAGGAGCTCTCCAAGGTGTACGAGCAG
Pan_troglodytes|13792               CCGGACTCCCTGCTCCACACACCTCTGATTATCAAGGAGCTCTCCAAGGTGTACGAGCAG
                                      ..                     .     .    . . . .    ..:.** ** ***

Tarsius_syrichta|13855              AGGATGCCCCTACTGGCGGTGGACAAGATCTCCCTCGCAGTCCAGAAGGGGGAGTGTTTC
Tupaia_belangeri|17270              CAGGCGCCCCTCCTAGCCGTGGACAGGCTCTACATCGCGGTCCAG---GGGGAGTGCTTT
Dipodomys_ordii|4073                CGGGCGCCGCTCCTCGCTGTGGACAGGATCTCCCTTGCCGTTCAGAAGGGGGAGTGCTTT
Spermophilus_tridecemlineatus|13217 CAGGTGCCCCTCCTGGCTGTGGACAGGATCTCCCTCACTGTCCAGAAAGGGGAGTGTTTT
Otolemur_garnettii|6861             CGGGTGCCCCTCCTCGCTGTGGACAAGGTCTCCCTCACAGTCCAGAAAGGGGAGTGCTTT
Microcebus_murinus|6370             CGGGTGCCCCTCCTGGCCGTGGACAAGGTCTCCCTCGCAGTCCAGAAAGGGGAGTGCTTT
Oryctolagus_cuniculus|25012         CGGACTCCCCTCCTCGCCGTGGACAAGATCTCCCTCGCCGTCCAGAGGGGGGAGTGCTTC
Ochotona_princeps|13529             CGGACGCTCCTTCTCGCCGTGGACAGGATCTCCCTTGCGGTCCAGAGGGGGGAGTGCTTT
Mus_musculus|16778                  CGAGCACCGCTCCTTGCCGTGGACAGGATCTCCCTTGCGGTCCAGAAAGGGGAGTGCTTC
Rattus_norvegicus|5070              CGTGCACCGCTCCTTGCCGTGGACAGGATCTCCCTTGCAGTCCAGAAAGGGGAGTGCTTT
Cavia_porcellus|15563               CAGACACCCCTCATTGCTGTAGACAGGATCTCTCTCGCAGTCCAGAAAGGAGAATGCTTT
Callithrix_jacchus|20559            CAGGTGCCCCTCCTGGCCGTGGACAGGATCTCCCTCGCGGTGCAGAAAGGGGAATGCTTC
Gorilla_gorilla|28689               CGGGTGCCCCTCCTGGCCGTGGACAGGATCTCCCTCGCGGTGCAGAAAGGGGAGTGCTTC
Homo_sapiens|30539                  CGGGTGCCCCTCCTGGCCGTGGACAGGCTCTCCCTCGCGGTGCAGAAAGGGGAGTGCTTC
Pan_troglodytes|13792               CGGGTGCCCCTCCTGGCTGTGGACAGGATCTCCCTCGCAGTGCAGAAAGGGGAGTGCTTC
                                    .. .  *  ** .* ** **.****.* ***. .* .* ** ***   **.**.** ** 

Tarsius_syrichta|13855              GGCCTGCTGGGCTTCAATGGGGCCGGGAAGACCACGACCTTCAAAATGCTGACTGGGGAG
Tupaia_belangeri|17270              GGC---CTGGGTTTCAATGGAGCCGGGAAAATCACGACATTCAAAATGCTGTCCGCAGAA
Dipodomys_ordii|4073                GGCCTTCTGGGTTTCAATGGAGCTGGGAAGACCACCACATTCAAAATGCTTACAGGGGAG
Spermophilus_tridecemlineatus|13217 GGCCTGCTGGGCTTCAACGGAGCCGGGAAAACCACGACATTCAAGATGTTGACTGGGGAG
Otolemur_garnettii|6861             GGTTTGCTGGGTTTCAATGGAGCTGGGAAAACCACGACTTTCAAAATGCTCACTGGCGAG
Microcebus_murinus|6370             GGCTTGCTGGGCTTCAACGGAGCTGGGAAAACCACGACTTTCAAAATGCTGACTGGGGAG
Oryctolagus_cuniculus|25012         GGCCTGCTTGGTTTCAACGGGGCCGGGAAAACCACCACGTTCAAGATGCTGACCGGGGAG
Ochotona_princeps|13529             GGCCTGCTTGGCTTCAATGGGGCTGGGAAAACCACCACGTTCAAGATGCTGACCGGGGAG
Mus_musculus|16778                  GGCCTGTTGGGTTTCAATGGAGCTGGAAAAACCACAACATTCAAAATGCTGACTGGGGAG
Rattus_norvegicus|5070              GGCCTGTTGGGTTTCAATGGAGCTGGAAAAACTACAACATTCAAAATGCTGACTGGGGAG
Cavia_porcellus|15563               GGTCTCCTGGGTTTCAATGGAGCCGGAAAGACCACAACATTCAAAATGCTGACTGGGGAG
Callithrix_jacchus|20559            GGCCTTCTGGGCTTCAACGGAGCTGGGAAGACCACGACTTTCAAAATGCTGACAGGAGAG
Gorilla_gorilla|28689               GGCCTGCTGGGCTTCAATGGAGCCGGGAAGACCACGACTTTCAAAATGCTGACCGGGGAG
Homo_sapiens|30539                  GGCCTGCTGGGCTTCAATGGAGCCGGGAAGACCACGACTTTCAAAATGCTGACCGGGGAG
Pan_troglodytes|13792               GGCCTGCTGGGCTTCAATGGAGCCGGGAAGACCACGACTTTCAAAATGCTGACCGGGGAG
                                    **     * ** ***** **.** **.**.*  ** ** *****.*** * :* *  **.

Tarsius_syrichta|13855              GAGAGCATCACTTCTGGGGACGCCTTTGTTGGGGGCCACAGCATCAGCTCTGACATCGGG
Tupaia_belangeri|17270              GAGGCCATCACTGCTGGGGATGCCTTCGTGGGGGGCCACAGCGTCAGTACTGATATCGGG
Dipodomys_ordii|4073                GAGACCATCACCTCAGGGGACGCCTTTGTTGGAGGCTACAGCATCAGCTCTGACATCCAG
Spermophilus_tridecemlineatus|13217 GAGCCCATCACCTCAGGGGATGCCTTCGTTGAGAGCTACAGCATCAGCTCTGACATTGGG
Otolemur_garnettii|6861             GACAGCATCACTTCTGGAGATGCCTTCATTGGGGGCCATAGCATCAGCTCTGACATTGGG
Microcebus_murinus|6370             GACAGCATCACTTCCGGGGATGCCTTTGTCGGGGGCCACAGCATCAGCTCTGACATCGGG
Oryctolagus_cuniculus|25012         GAATCCATCACTTCTGGGGACGCCTTCGTCGGGGGCCACAGCATCAGCTCCGACATCGGG
Ochotona_princeps|13529             GAGTCCATCACTGCTGGGGACGCCTTTGTCGGGGGTCACAGCATCCGCTCTGACATTGGG
Mus_musculus|16778                  GAGACCATCACCTCAGGGGATGCCTTTGTTGGTGGTTACAGCATCAGTTCTGACATCGGG
Rattus_norvegicus|5070              GAGACGATCACCTCGGGGGATGCCTTTGTTGGTGGTTACAGCATCAGTTCTGATATTGGG
Cavia_porcellus|15563               GAGACCATCACCTCAGGGGATGCCTTCGTTGGGGGCCACAGCATCAGCTCTGACATTGGA
Callithrix_jacchus|20559            GAGAGCCTCACTTCTGGGGACGCCTTTGTCGGTGGTCACAGCATCAGCTCTGATGTTGGG
Gorilla_gorilla|28689               GAGAGCCTCACTTCTGGGGATGCCTTTGTCGGGGGTCACAGAATCAGCTCTGATGTCGGA
Homo_sapiens|30539                  GAGAGCCTCACTTCTGGGGATGCCTTTGTCGGGGGTCACAGAATCAGCTCTGATGTCGGA
Pan_troglodytes|13792               GAGAGCCTCACTTCTGGGGATGCCTTTGTCGGGGGTCACAGAATCAGCTCTGATGTCGGA
                                    **    .****  * **.** ***** .* *. .*  * **..**.* :* ** .*  ..

Tarsius_syrichta|13855              AAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17270              AAG---------------------------------------------------------
Dipodomys_ordii|4073                CAGGTGCGGCAGCGGATGGGCTACTGCCCCCAGTTTGATGCCCTGCTGGACCACATGACC
Spermophilus_tridecemlineatus|13217 AAGGTGCGGCAGCGGATGGGCTACTGTCCCCAGTTTGATGCCCTGTTGGATCACATGACG
Otolemur_garnettii|6861             AAGGTACGGCAACGCATCGGCTACTGCCCGCAGTTTGACGCCCTGCTGGACCACATGACT
Microcebus_murinus|6370             AAGGTGCGGCAGTGCATTGGCCACTGCCCGCAGTTCGACGCCCTGCTGGACCACATGACA
Oryctolagus_cuniculus|25012         AAGGTGCGGCAGCGGATTGGCTACTGCCCCCAGTTTGATGCCCTGCTGGACCACATGACC
Ochotona_princeps|13529             AAGGTGCGGCAACGGATTGGCTACTGCCCCCAGTTTGATGCCCTGCTAGACCACATGACC
Mus_musculus|16778                  AAGGTGCGGCAGCGGATGGGCTACTGCCCCCAGTTTGATGCACTGCTTGATCACATGACT
Rattus_norvegicus|5070              AAGGTACGGCAGCGGATGGGCTACTGCCCCCAGTTTGATGCACTGCTTGATCACATGACT
Cavia_porcellus|15563               AAGGTACGGCAGAGGATGGGCTACTGCCCACAGTTTGATGCCCTCCTGGACCACATGACT
Callithrix_jacchus|20559            AAGGTGCGGCAGCGGATCGGCTACTGCCCCCAGTTTGATGCCTTGCTGGACCACATGACT
Gorilla_gorilla|28689               AAGGTACGGCAGTGGATCGGCTACTGCCCGCAGTTTGATGCCTTGCTGGACCACATGACA
Homo_sapiens|30539                  AAGGTGCGGCAGCGGATCGGCTACTGCCCGCAGTTTGATGCCTTGCTGGACCACATGACA
Pan_troglodytes|13792               AAGGTGCGGCAGCGGATCGGCTACTGCCCGCAGTTTGATGCCTTGCTGGACCACATGACA
                                    .**                                                         

Tarsius_syrichta|13855              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17270              ------------------------------------------------------------
Dipodomys_ordii|4073                GGCCGGGAGATGCTGGTCATGTATGCCCGGCTCCGGGGCATTCCTGAGCGCCTCATCGGC
Spermophilus_tridecemlineatus|13217 GGCCGGGAGATGCTGGTCATGTATGCTCGGCTCCGAGGCATCCCTGAGCACCTCATTGAC
Otolemur_garnettii|6861             GGCCGTGAGATGCTGGTCATGTATGCCCGACTCCGGGGCATCCCTGAGTGCCACATTGGG
Microcebus_murinus|6370             GGCCGCGAGATGCTGGTCATGTACGCCCGGCTCCGGGGCATCCCTGAGCGCCACATCGGG
Oryctolagus_cuniculus|25012         GGCCGGGAGATGCTGGTCATGTACGCCCGGCTCCGCGGCATCCCCGAGCGCCACATCGGG
Ochotona_princeps|13529             GGCCGGGAGATGCTGGTCATGTATGCTCGGCTCCGCGGCATCCCTGAGCGCCATATCGGG
Mus_musculus|16778                  GGCAGGGAGATGCTGGTTATGTATGCACGGCTCCGAGGCATCCCAGAGCGGCTCATCAAT
Rattus_norvegicus|5070              GGCAGGGAAATGCTGGTCATGTATGCACGGCTCCGAGGCATCCCAGAGCGTCTCATCGAT
Cavia_porcellus|15563               GGCCGGGAAATGTTGGTCATGTATGCACGTCTGCGGGGTATCCCCGAACGCCTCATTGGT
Callithrix_jacchus|20559            GGCCGGGAGATGCTGGTCATGTACGCTCGGCTCCGAGGCATCCCTGAGCGCCACATCGGG
Gorilla_gorilla|28689               GGCCGGGAGATGCTGGTCATGTACGCTCGGCTCCGGGGCATCCCTGAGCGCCACATCGGG
Homo_sapiens|30539                  GGCCGGGAGATGCTGGTCATGTACGCTCGGCTCCGGGGCATCCCTGAGCGCCACATCGGG
Pan_troglodytes|13792               GGCCGGGAGATGCTGGTCATGTACGCTCGGCTCCGGGGCATCCCTGAGCGCCACATCGGG
                                                                                                

Tarsius_syrichta|13855              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17270              ------------------------------------------------------------
Dipodomys_ordii|4073                CCCTGTGTGGAGAACACACTGCGGGGCTTGCTCCTGGAGCCACACGCTAACAAACTGGTC
Spermophilus_tridecemlineatus|13217 CCCTGCGTGGAGAACACACTGCGAGGC---CTGCTGGAGCCACATGCCAATAAGCTGGTC
Otolemur_garnettii|6861             GCCTGTGTGGAAAACACCCTTCGGGGCCTATTGCTGGAGCCACACGCCAATAAGCTGGTT
Microcebus_murinus|6370             GCCTGTGTGGAGAACACTCTCCGGGGCCTGCTCCTGGAGCCACACGCCAACAAGCTGGTC
Oryctolagus_cuniculus|25012         GCCTGTGTGGAGAACACGCTGCGGGGCCTGCTCCTGGAGCCGCACGCCAACAAGCTGGTC
Ochotona_princeps|13529             ACCTGTGTGGAAAACACGCTGCGGGGCCTGCTTCTGGAGCCACATGCTGACAAGCTGGTC
Mus_musculus|16778                  GCCTGTGTGGAGAATACTCTGCGGGGTCTGCTGCTGGAACCGCACGCCAACAAACTAGTC
Rattus_norvegicus|5070              GCCTGTGTGGAGAACACTCTGCGGGGTCTGCTCCTGGAGCCACATGCCAATAAACTGGTC
Cavia_porcellus|15563               GCTTGTGTAGAGAACACACTGCGGGGCCTGCTCCTGGAGCCACATGCCAACAAGCTGGTC
Callithrix_jacchus|20559            GCCTGCGTGGAGAACACTCTGCGGGGCCTGCTGCTGGAGCCACACGCCAACAAACTGGTC
Gorilla_gorilla|28689               GCCTGCGTGGAGAACACTCTGCGGGGCCTGCTGCTGGAGCCACATGCCAACAAGCTGGTC
Homo_sapiens|30539                  GCCTGCGTGGAGAACACTCTGCGGGGCCTGCTGCTGGAGCCACATGCCAACAAGCTGGTC
Pan_troglodytes|13792               GCCTGCGTGGAGAACACTCTGCGGGGCCTGCTGCTGGAGCCGCATGCCAACAAGCTGGTC
                                                                                                

Tarsius_syrichta|13855              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17270              ------------------------------------------------------------
Dipodomys_ordii|4073                AGGACATACAGCGGCGGCAACAAGCGAAAGCTGAGCACAGGCATCGCCCTCATTGGAGAG
Spermophilus_tridecemlineatus|13217 AGG---TACAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|6861             AAAACATACAGTGGTGGTAACAAGAGGAAGCTGAGCACTGGCAATGCCATAATTGGAGAG
Microcebus_murinus|6370             AGGACTTACAGTGGTGGAAACAAGCGGAAGCTGAGCACCGGCATCGCCCTGATAGGAGAG
Oryctolagus_cuniculus|25012         AGGACGTACAGCGGAGGCAACAAGCGCAAGCTGAGCACGGGCATCGCCCTCCTCGGAGAG
Ochotona_princeps|13529             AGGACGTACAGCGGGGGGAACAAGCGCAAACTGAGCACAGGCATTGCCCTCATCGGAGAG
Mus_musculus|16778                  AAGACTTACAGTGGTGGTAACAAACGCAAGCTAAGCACTGGCATTGCCCTCATTGGAGAG
Rattus_norvegicus|5070              AAGACTTACAGTGGTGGTAACAAGCGCAAGTTAAGCACTGGCATCGCCCTCATTGGAGAG
Cavia_porcellus|15563               AGATCATACAGTGGTGGTAACAAGCGCAAGCTGAGCACTGGCATTGCCCTCATTGGTGAG
Callithrix_jacchus|20559            AGGACGTACAGCGGTGGTAACAAGCGGAAGCTGAGCACTGGCATCGCCCTGATTGGAGAG
Gorilla_gorilla|28689               AGGACGTACAGTGGTGGTAACAAGCGGAAGCTGAGCACCGGCATCGCCCTGATCGGAGAG
Homo_sapiens|30539                  AGGACGTACAGTGGTGGTAACAAGCGGAAGCTGAGCACCGGCATCGCCCTGATCGGAGAG
Pan_troglodytes|13792               AGGACGTACAGTGGTGGTAACAAGCGGAAGCTGAGCACCGGCATCGCCCTGATCGGAGAG
                                                                                                

Tarsius_syrichta|13855              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17270              ------------------------------------------------------------
Dipodomys_ordii|4073                CCTGCAGTCATCTTCCTGGACGAGCCGTCCACTGGCATGGACCCCGTGGCCAGACGCCTG
Spermophilus_tridecemlineatus|13217 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|6861             CCTGCAGTCATCTTACTGGATGAGCCATCCTCTGATATAAAAACTGAGTCCCACAGTCTA
Microcebus_murinus|6370             CCCGCGGTCATCTTCCTGGATGAGCCGTCCACCGGCATGGACCCCGTGGCCCGGCGCCTG
Oryctolagus_cuniculus|25012         CCTGCGGTCATCTTCCTGGACGAGCCGTCCACGGGCATGGACCCCGTGGCCCGGCGCCTG
Ochotona_princeps|13529             CCCGCCGTCATCTTCCTGGACGAGCCGTCCACTGGCATGGACCCCGTGGCCCGGCGCCTG
Mus_musculus|16778                  CCTGCAGTCATCTTCCTGGATGAGCCATCGACCGGCATGGACCCAGTGGCCCGGCGTCTA
Rattus_norvegicus|5070              CCTGCAGTCATCTTCCTGGATGAGCCATCTACTGGCATGGACCCCGTGGCCCGGCGCCTA
Cavia_porcellus|15563               CCTGCAGTCATCTTCCTGGACGAGCCATCCACTGGCATGGACCCTGTTGCCCGACGCCTG
Callithrix_jacchus|20559            CCTGCCGTCATCTTCCTGGACGAGCCATCCACTGGCATGGACCCTGTGGCCCGGCGCCTG
Gorilla_gorilla|28689               CCTGCTGTCATCTTCCTGGATGAGCCGTCCACTGGCATGGACCCCGTGGCCCGGCGCCTG
Homo_sapiens|30539                  CCTGCTGTCATCTTCCTGGACGAGCCGTCCACTGGCATGGACCCCGTGGCCCGGCGCCTG
Pan_troglodytes|13792               CCTGCTGTCATCTTCCTGGACGAGCCGTCCACTGGCATGGACCCCGTGGCCCGGCGCCTG
                                                                                                

Tarsius_syrichta|13855              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17270              ------------------------------------------------------------
Dipodomys_ordii|4073                CTGTGGGACACAGTGGCCCGGGCCCGGGAGTCTGGCAAGGCCATCGTCATCACCTCCCAC
Spermophilus_tridecemlineatus|13217 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|6861             TGCAGGGAGACTGAGGCTCGTTATCTTCAGACTGGAATTTCAATCGTCATCACCTCATAT
Microcebus_murinus|6370             CTCTGGGACACAGTGGCCCGGGCCCGGGAGTCTGGCAAGGCCATCGTCATCACCTCCCAC
Oryctolagus_cuniculus|25012         CTCTGGGACACCGTGGCCCGGGCCCGCGAGTCTGGCAAGGCCGTCGTCATCACCTCCCAC
Ochotona_princeps|13529             CTCTGGGACACCGTGGCCCGCGCCCGCGAGTCCGGCAAGGCCGTCATCATCACCTCCCAC
Mus_musculus|16778                  CTCTGGGATACTGTAGCCCGGGCCCGAGAGTCTGGCAAAGCCATTGTCATCACCTCCCAC
Rattus_norvegicus|5070              CTCTGGGACACTGTAGCCCGGGCCCGAGAGTCTGGCAAAGCCATTGTCATCACCTCCCAC
Cavia_porcellus|15563               CTTTGGGACACTGTGGCCCGGGCCCGAGAGTCTGGCAAGGCCATTGTCATAACCTCCCAC
Callithrix_jacchus|20559            CTCTGGAATGCCGTGGCACGAGCCCGCGAGTCCGGCAAGACCATCGTCATCACCTCCCAC
Gorilla_gorilla|28689               CTTTGGGACACCGTGGCACGAGCCCGAGAGTCTGGAAAGGCCATTGTCATCACCTCCCAC
Homo_sapiens|30539                  CTTTGGGACACCGTGGCACGAGCCCGAGAGTCTGGCAAGGCCATCATCATCACCTCCCAC
Pan_troglodytes|13792               CTTTGGGACACCGTGGCACGAGCCCGAGAGTCTGGCAAGGCCATCGTCATCACCTCCCAC
                                                                                                

Tarsius_syrichta|13855              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17270              ------------------------------------------------------------
Dipodomys_ordii|4073                AGCATGGAGGAGTGCGAGGCGCTGTGTACCCGGCTGGCCATCATGGTGCAGGGCCAGTTC
Spermophilus_tridecemlineatus|13217 NNCATGGAAGAGTGTGAGGCCTTGTGCACCCGGCTGGCCATTGTGGTGCAGGGTCAGTTC
Otolemur_garnettii|6861             ATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|6370             AGCATGGAGGAGTGCGAAGCCTTGTGCACCCGGCTGGCCATCATGGTGCAGGGCCAGTTC
Oryctolagus_cuniculus|25012         AGCATGGAGGAGTGCGAGGCCCTGTGCACCCGGCTGGCCATCATGGTGCAGGGTCAGTTC
Ochotona_princeps|13529             AGCATGGAGGAGTGTGAGGCCTTGTGCACCCGGCTGGCCATCATGGTGCAGGGTCAGTTC
Mus_musculus|16778                  AGTATGGAGGAGTGTGAAGCCTTATGTACCAGGCTGGCCATCATGGTACAGGGCCAGTTC
Rattus_norvegicus|5070              AGTATGGAGGAGTGTGAAGCCTTATGTACCCGGCTGGCCATCATGGTACAGGGCCAGTTC
Cavia_porcellus|15563               AGCATGGAGGAATGTGAGGCCTTGTGCACCCGGCTGGCCATCATGGTACAGGGTCAGTTC
Callithrix_jacchus|20559            GGCATGGAGGAGTGTGAGGCCCTGTGCACCCGGCTGGTCATCATGGTGCAGGGGCAGTTC
Gorilla_gorilla|28689               AGCATGGAGGAATGTGAGGCCCTGTGCACCCGGCTGGCCATCATGGTGCAGGGGCAGTTC
Homo_sapiens|30539                  AGCATGGAGGAGTGTGAGGCCCTGTGCACCCGGCTGGCCATCATGGTGCAGGGGCAGTTC
Pan_troglodytes|13792               AGCATGGAGGAGTGTGAGGCCCTGTGCACCCGGCTGGCCATCATGGTGCAGGGGCAGTTC
                                                                                                

Tarsius_syrichta|13855              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17270              ------------------------------------------------------------
Dipodomys_ordii|4073                AAGTGTCTGGGCAGCCCGCAGCACCTCAAGAGCAAGTTTGGCAGCGGCTACTCCCTGCAG
Spermophilus_tridecemlineatus|13217 AAGTGCCTGGGAAGCCCACAGCACCTCAAGAGCAAGTTTGGCAGCGGCTACTCCCTGCGG
Otolemur_garnettii|6861             NNNNNNNNNNNCAGCCCCCAGCACCTCAAGAGCAAGTTCGGCAGTGGCTACTCCCTGCGG
Microcebus_murinus|6370             AAGTGCCTGGGCAGCCCCCAGCACCTCAAGAGCAAGTTCGGCAGTGGCTACTCCCTGCGG
Oryctolagus_cuniculus|25012         AAGTGCCTGGGCAGCCCGCAGCACCTCAAGAGCAAGTTCGGCAGCGGCTACTCCCTGCAG
Ochotona_princeps|13529             AAGTGCCTGGGCAGCCCGCAGCACCTCAAGAGCAAGTTTGGCAGCGGCTACTCCCTGCAG
Mus_musculus|16778                  AAGTGCCTGGGCAGCCCACAGCACCTCAAGAGCAAGTTTGGCAGCGGCTACTCCCTGCAG
Rattus_norvegicus|5070              AAGTGCCTGGGCAGCCCACAGCACCTCAAGAGCAAGTTTGGCAGCGGCTACTCCCTGCAG
Cavia_porcellus|15563               AAGTGCCTGGGCAGCCCTCAGCACCTCAAGAGCAAGTTTGGCAGTGGCTACTCCCTGCAG
Callithrix_jacchus|20559            AAGTGCCTGGGCAGCCCCCAGCACCTCAAAAGCAAGTTTGGCAGCAGCTACTCCCTGAGA
Gorilla_gorilla|28689               AAGTGCCTGGGCAGCCCCCAGCACCTCAAGAGCAAGTTCGGCAGCGGCTACTCCCTGCGG
Homo_sapiens|30539                  AAGTGCCTGGGCAGCCCCCAGCACCTCAAGAGCAAGTTCGGCAGCGGCTACTCCCTGCGG
Pan_troglodytes|13792               AAGTGCCTGGGCAGCCCCCAGCACCTCAAGAGCAAGTTCGGCAGCGGCTACTCCCTGCGG
                                                                                                

Tarsius_syrichta|13855              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17270              ------------------------------------------------------------
Dipodomys_ordii|4073                GCCAAGGTCCACAGCGAAGGGCAGCAGGAGGCTCTGGAGGAGTTCAAGGCGTTCGTGGAC
Spermophilus_tridecemlineatus|13217 GCCAAAGTCCGAAGTGAAGGGCAGCAGGAGGCACTGGAGGAGTTCAAGGCATTTGTGGAC
Otolemur_garnettii|6861             GCCAAGGTCCGGAATGAAGGGCAGCAGGAGGCACTGGAGGAGTTCAAGGCTTTCGTTGAC
Microcebus_murinus|6370             GCCAAGGTGCGGAGTGAAGGGCAGCAGGAGGCGCTGCAGGAGTTCAAGGCGTTCGTGGAC
Oryctolagus_cuniculus|25012         GCCAAGGTCCGGAGCAGAGGGCAGCAGGAGGCGCTGCGGGATTTCAAGGCCTTTGTGGAC
Ochotona_princeps|13529             GCCAAGGTCCGCAGCAAGGGGCAGCAGGAGGCGCTGGAGGCGTTCAAGGCGTTTGTGGAG
Mus_musculus|16778                  GCCAAGGTCCGGAGCGAGGGGAAGCAAGACGCGCTAGAGGAGTTCAAGGCCTTTGTGGAC
Rattus_norvegicus|5070              GCCAAGGTCCGGAGTGAGGGGAAGCAAGAAGTACTAGAGGAGTTCAAGGCATTTGTGGAC
Cavia_porcellus|15563               GCCAAGGTCCAGAGTGAAGGGCAGCAGGAAGCACTGAAGAAATTCAAGGCATTTGTGGAC
Callithrix_jacchus|20559            GCCAAGGTCCGGAGTGAAGGGCAGCAGGAGGCGCTGGAGGAATTCAAGGCCTTCGTGGAC
Gorilla_gorilla|28689               GCCAAGGTGCAGGGTGAAGGGCAACAGGAGGCGCTGGAGGAGTTCAAGGCCTTCGTGGAC
Homo_sapiens|30539                  GCCAAGGTGCAGAGTGAAGGGCAACAGGAGGCGCTGGAGGAGTTCAAGGCCTTCGTGGAC
Pan_troglodytes|13792               GCCAAGGTGCAGAGTGAAGGGCAACAGGAGGCGCTGGAGGAGTTCAAGGCCTTCGTGGAC
                                                                                                

Tarsius_syrichta|13855              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17270              ------------------------------------------------------------
Dipodomys_ordii|4073                CTGACCTTCCCAGGCAGCGTCCTGGAAGATGAGCACCAGGGTATGGTTCATTACCACCTA
Spermophilus_tridecemlineatus|13217 CTGACCTTCCCAGGTTTTGTCCTAGAAGATGAGCACCAAGGCATGGTCCACTATCACCTG
Otolemur_garnettii|6861             CTGACCTTCCCAGGTGTTGTCCTGGAAGATGAACACCAAGGGATGGTCCATTACCATCTG
Microcebus_murinus|6370             CTGACCTTCTCAGGTGTTGTACTGGAGGATGAGCACCAAGGCATGGTCCATTACCACCTG
Oryctolagus_cuniculus|25012         CTGACCTTCCCAGGCAGCGTCCTGGAAGATGAGCACCAGGGGATGGTCCACTACCACCTG
Ochotona_princeps|13529             CTGACCTTCCCAGGTAGCATCCTGGAGGACGAGCACCAGGGGATGGTCCATTACCACCTG
Mus_musculus|16778                  CTGACCTTCCCAGGCAGCATCCTAGAAGATGAGCACCAAGACATGGTCCATTATCATCTG
Rattus_norvegicus|5070              CTGACCTTCCCAGGCAGCGTCCTAGAAGATGAGCACCAAGACATGGTCCACTACCATCTG
Cavia_porcellus|15563               CTGACCTTCCCAGGCAGCGTCCTAGAAGATGAACACCAAGGCATGGTCCACTATCACCTG
Callithrix_jacchus|20559            CTGACCTTTCCAGGCAGCGTCCTAGAAGATGAGCACCAAGGCATGGTCCACTACCACCTG
Gorilla_gorilla|28689               CTGACCTTTCCAGGCAACGTCCTGGAAGATGAGCACCAAGGCATGGTCCATTACCACCTG
Homo_sapiens|30539                  CTGACCTTTCCAGGCAGCGTCCTGGAAGATGAGCACCAAGGCATGGTCCATTACCACCTG
Pan_troglodytes|13792               CTGACCTTTCCAGGCAGCGTCCTGGAAGATGAGCACCAAGGCATGGTCCATTACCACCTG
                                                                                                

Tarsius_syrichta|13855              NNNNNNNNNNNNNNCAGCTGG---AAGGCCTTCAGTATTCTGGAGAGAGCCAAGGAGAAG
Tupaia_belangeri|17270              ------------------------------------------------------------
Dipodomys_ordii|4073                CCCGGCCAAGACCTCAGCTGGGCAAAGGTTTTTGGTATCCTGGAGAAAGCCAAGGAAAAG
Spermophilus_tridecemlineatus|13217 CCTGGTGGCAACCTCAGCTGGGCCAAGGTTTTTGGTATCCTGGAGAAAGCCAAGGAGAAG
Otolemur_garnettii|6861             CCTGGCTATGACCTCAGCTGGGCAAAGGTGTTTGGCATTCTGGAGAAAGCCAAGGAAAAG
Microcebus_murinus|6370             CCAGGCCGTGACCTCAGCTGGGCAAAGGTGTTTGGCATTCTGGAGAAGGCCAAGGAGAAG
Oryctolagus_cuniculus|25012         CCCGGCCACGACCTCAGCTGGGCGAAGGTGTTTGGTACCCTGGAGAAGGCCAAGGAGAAG
Ochotona_princeps|13529             CCCAGCCATGGCCTCGGCTGGGCGAAGGTTTTTGGCATCCTGGAGAAAGCCAAGGAGAAG
Mus_musculus|16778                  CCTGGCTGTGACCTCAGCTGGGCCAAGGTATTTGGTATCCTGGAGAAAGCCAAGGAGAAG
Rattus_norvegicus|5070              CCTGGCTGTGACCTCAGCTGGGCCAAGGTATTTGGTATCCTGGAGAAGGCCAAGGAGAAG
Cavia_porcellus|15563               CCTGGCCACAACTTGAGCTGGGCAAAGGTTTTTGGTATCCTGGAGAAAGCCAAGGAGAAG
Callithrix_jacchus|20559            CCAGGCCAGAACCTCAGCTGGGCGAAGGTTTTTGGTATTCTGGAGAAAGCCAAGGAAAAA
Gorilla_gorilla|28689               CCGGGCCGTGACCTCAGCTGGGCGAAGGTTTTCGGTATTCTGGAGAAAGCCAAGGAAAAG
Homo_sapiens|30539                  CCGGGCCGTGACCTCAGCTGGGCGAAGGTTTTCGGTATTCTGGAGAAAGCCAAGGAAAAG
Pan_troglodytes|13792               CCGGGCCGTGACCTCAGCTGGGCGAAGGTTTTCGGTATTCTGGAGAAAGCCAAGGAAAAG
                                                                                                

Tarsius_syrichta|13855              TTCAGCGTGGATGACTACTCCGTGAGCCAGATCTCGCTGGAGCAGGTCTTCCTGGGTTTT
Tupaia_belangeri|17270              ------------------------------------------------------------
Dipodomys_ordii|4073                TACGGAGTGGATGACTACTCAGTAAGCCAGATCTCTCTGGAGCAGGTCTTCCTGAGCTTT
Spermophilus_tridecemlineatus|13217 TATGGAGTGGATGACTACTCAGTGAGCCAGATCTCACTGGAGCAAGTCTTTCTGAGCTTT
Otolemur_garnettii|6861             TACGGGGTGGACGACTACTCTGTGAGCCAGATCTCGCTGGAGCAGGTCTTCCTGGGCTTC
Microcebus_murinus|6370             TACGGAGTGGACGACTACTCCGTGAGCCAGATCTCGCTGGAGCAGGTCTTCCTGAGCTTC
Oryctolagus_cuniculus|25012         TACGGAGTGGACGACTACTCGGTGAGCCAGATCTCGCTGGAGCAGGTCTTCCTAAGCTTC
Ochotona_princeps|13529             TACGGCGTGGACGACTATTCTGTGAGCCAGATCTCATTGGAGCAGGTCTTCCTGAGCTTT
Mus_musculus|16778                  TATGGAGTGGATGATTACTCTGTGAGCCAGATCTCCCTGGAGCAGGTCTTTCTGAGCTTT
Rattus_norvegicus|5070              TATGGAGTGGACGATTACTCTGTGAGTCAGATCTCGCTGGAGCAGGTCTTTCTGAGCTTT
Cavia_porcellus|15563               TATGGAGTGGATGACTACTCAGTGAGCCAGATCTCACTGGAACAAGTCTTCCTGAGCTTC
Callithrix_jacchus|20559            TACAGCGTGGATGACTACTCCGTGAGCCAGATCTCGCTGGAGCAAGTCTTCCTGAGCTTC
Gorilla_gorilla|28689               TACGGCGTGGACGACTACTCCGTGAGCCAGATCTCGCTGGAACAGGTCTTCCTGAGCTTC
Homo_sapiens|30539                  TACGGCGTGGACGACTACTCCGTGAGCCAGATCTCGCTGGAACAGGTCTTCCTGAGCTTC
Pan_troglodytes|13792               TACGGCGTGGACGACTACTCCGTGAGCCAGATCTCGCTGGAACAGGTCTTCCTGAGCTTC
                                                                                                

Tarsius_syrichta|13855              GCCCACCTGCAGCCGCCCACCGTGGATGAGGGGCGATGA
Tupaia_belangeri|17270              ---------------------------------------
Dipodomys_ordii|4073                GCCCACCTGCAGCCCCCAACCGTGGAGGAGGGGCGATGA
Spermophilus_tridecemlineatus|13217 GCCCACCTACAACCCCCCACTGCAGAGGAGGGACGATGA
Otolemur_garnettii|6861             GCCCATCTGCAGCCACCCACTGTGGAAGAGGGCCAGTAA
Microcebus_murinus|6370             GCCCACCTGCAGCCACTCGCCGCAGAGGACAGCCGATGA
Oryctolagus_cuniculus|25012         GCCCACCTGCAGCCACCCACCTCGGAGGAGGGGCGA---
Ochotona_princeps|13529             GCACACCTGCAGCCACCCACCTCCGAGGAGGGACGATGA
Mus_musculus|16778                  GCCCACCTACAACCCCCCACCACTGAGGATGGCCGGTGA
Rattus_norvegicus|5070              GCCCACCTGCAGCCCCCCACCACTGAGGATGGACGATGA
Cavia_porcellus|15563               GCCCACCTGCAGCCCCCTACTGCAGAGGAAGGGCGATAA
Callithrix_jacchus|20559            GCCCACCTGCAGCCGTCTGCCACGGAGGAGGGGCGATGA
Gorilla_gorilla|28689               GCGCACCTGCAACCGCCCACCGCAGAGGAGGGGCGATGA
Homo_sapiens|30539                  GCCCACCTGCAGCCGCCCACCGCAGAGGAGGGGCGATGA
Pan_troglodytes|13792               GCCCACCTGCAGCCGCCCACCGCAGAGGAGGGGCGATGA
                                                                           

multiple sequence alignment in CLUSTALW format


Tarsius_syrichta|12704              APPTPLPSLPLQRAATSIPLGLCALGTQSTFPLFPWCHKIYLY-----VRTPLTELVPSW
Tupaia_belangeri|14995              ASRPSPSPPGEAASA----TALHALRCPKAAPLFPECCGVYLN----SVRPPASAVLAAL
Dipodomys_ordii|3782                TGTPPAPSLHLAPPG----LGFWNSPVSSSLGLFL--------------PTSPTVLAPTG
Spermophilus_tridecemlineatus|11837 TAPPPPPPAGSAHLN----ALSFRKEVLTGCHAYLGV----------RPPTSPTVLGVPG
Otolemur_garnettii|5913             APPPPLASLPFFVAT----FTHLSSHTLSLQCTFLLCPYHRVYLGYSPPNSLAGQDNPPS
Microcebus_murinus|5408             AAPAPSPSLPLQRAA----VSTQPSPALSLQSKFLLRPACR------GPPTSPAALGVPG
Oryctolagus_cuniculus|20249         ---------------------------------------------------LAAGRRPLL
Ochotona_princeps|11798             --------------------------------------------------------LPAP
Mus_musculus|22691                  ------------------------------------------------------------
Rattus_norvegicus|13279             ------------------------------------------------------------
Cavia_porcellus|12221               ------------------------------------------------------------
Callithrix_jacchus|12957            ------------------------------------------------------------
Gorilla_gorilla|22264               ------------------------------------------------------------
Homo_sapiens|73227                  ------------------------------------------------------------
Pan_troglodytes|3469                ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|12704              EKMAVFRQLVLLLWKNYTLQKRKVLVTVLELFLPLLFSGILIWLRLKIQSENVPNATIYP
Tupaia_belangeri|14995              VKMAVPRQLLLLLWKNYTLQKRKVLVTALELFLPLLFSGILIWLRLKIQSENVPNATVYP
Dipodomys_ordii|3782                GRMSVLRQLALLLWKNYTLKKRKVLVTILELLLPLLFSGILIWLRLKIQSENVPNATVYP
Spermophilus_tridecemlineatus|11837 ERMAVLQQLALLLWKNYTLQKRKVLVTVLELFLPLLFSGILIWLRLKIQSENVPNATVYP
Otolemur_garnettii|5913             EKMAVLRHLALLLWKNYTLKKRKVLVTVLELFLPLLFSGILIWLRLKIQSENVPNATIYP
Microcebus_murinus|5408             EKMAVLRQLALLLWKNYTLQKRKVLVTVLELFLPLLFSGILIWLRLKIQSENVPNATIYP
Oryctolagus_cuniculus|20249         AKMAVLRQLALLLWKNYTLQKRKVLVTALELFLPLLFSGILIWLRLKIQSENVPNATVYP
Ochotona_princeps|11798             EKMAALRQLALLLWKNYTLQKRKVLVTALELLLPLLFSGILIWLRLKIQSENVPNATVYP
Mus_musculus|22691                  --MAVLRQLTLLLWKNYTLKKRKVLVTVLELFLPLLFSGILIWLRLKIQSENVPNATVYP
Rattus_norvegicus|13279             --MVVLRQLRLLLWKNYTLKKRKVLVTVLELFLPLLFSGILIWLRLKIQSENVPNATVYP
Cavia_porcellus|12221               --MAVLRQLVLLLWKNYTLQKRKVLVTVLELLLPLLFSGILIWLRLTIQSENVPNATVYP
Callithrix_jacchus|12957            --MAVLRQLALLLWKNYTLQKRKVVVTVLELFLPLLFSGILIWLRLKIQSENVPNATIYP
Gorilla_gorilla|22264               --MAVLRQLALLLWKNYTLQKRKVLVTVLELFLPLLFSGILIWLRLKIQSENVPNATIYP
Homo_sapiens|73227                  --MAVLRQLALLLWKNYTLQKRKVLVTVLELFLPLLFSGILIWLRLKIQSENVPNATIYP
Pan_troglodytes|3469                --MAVLRQLALLLWKNYTLQKRKVLVTVLELFLPLLFSGILIWLRLKIQSENVPNATIYP
                                      * . ::* *********:****:** ***:**************.**********:**

Tarsius_syrichta|12704              DQSIQELPLFFTFPPPGDTWELAYIPSHSDAAKTVTETVRRALVINMRVRGFPSEKDFED
Tupaia_belangeri|14995              GQSIQVLPLFFTIPPPGDAWELAYIPSHSEAARTVTEAARKALVINMRVRGFPSEKDFED
Dipodomys_ordii|3782                SQSIQQLPFFFTLAPSVGTWELAYVPSHSEAARTVTETVKRALQVNIRXXXXXXXXXXXX
Spermophilus_tridecemlineatus|11837 GQSIQELPLFFTFPPPGDTWELAYIPSHSEAAKTITETVRKSLVINMRVRGFPSEKDFED
Otolemur_garnettii|5913             GQSIQELPLFFTFPPPGDSWELAFIPSHSDAAKTITETVRRELVINMRVRGFPSEKDFED
Microcebus_murinus|5408             GQSIQELPLFFTFPPPGGTWELAFVPSHSDTARAITQTVRRELVINMRVRGFPSEKDFED
Oryctolagus_cuniculus|20249         GQSIQELPLFFNFPPPGDAWELAYIPSHSDAARAITEWARRALVVNMKVRGFPSEKHFED
Ochotona_princeps|11798             EQSIQELPLFFTFPPPGGTWELAYVPSHSDAARTITESARRALLINMRVRGFPSDKHFED
Mus_musculus|22691                  DQSIQELPLFFSFPPPGGTWELAYVPSHSDAARTITETVKREFMIKMRVHGFSSEKDFED
Rattus_norvegicus|13279             DQHIQELPLFFSFPPPGGSWELAYVPSHSDAARTITEAVRREFMIKMRVHGFSSEKDFED
Cavia_porcellus|12221               GQSIQELPLFFSFPPLGGTWELAYVPSHSAAAKTITESVRRALVINMRVHGFPTEKDFED
Callithrix_jacchus|12957            GQSIQELPLFFTFPPPGDTWELAYIPSHSDAAKTVTETVRRALGINMRVRGFPAEKAFED
Gorilla_gorilla|22264               GQSIQELPLFFTFPPPGDTWELAYIPSHSDAAKTVTETVRRALVINMRVRGFPSEKDFED
Homo_sapiens|73227                  GQSIQELPLFFTFPPPGDTWELAYIPSHSDAAKTVTETVRRALVINMRVRGFPSEKDFED
Pan_troglodytes|3469                GQSIQELPLFFTFPPPGDTWELAYIPSHSDAAKTVTETVRRALVINMRVRGFPSEKDFED
                                     * ** **:**.:.*  .:****::**** :*:::*: .:: : ::::            

Tarsius_syrichta|12704              YIRYDNHSSNVLAAVVFEHTFNHSKEPLPLAVKYHLRFSYTRRNYMWTQTGSLLLKETEG
Tupaia_belangeri|14995              HVRYDNHSANVLAAVVFQHTFNHSKDPLPLAVKYHLRFSCTRRNYMWTQAGSVFLKEAEG
Dipodomys_ordii|3782                XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKYH-RFSCARRNYIWTQTGNFF-KETDG
Spermophilus_tridecemlineatus|11837 YVRYDNHSSNVLAAVVFQLASNHSKEPLPLAVKYHLRFSYTRRNYMWTQTGNFFLKKTEG
Otolemur_garnettii|5913             YIRYDNHSSNVLAAVVFEHTFNHSKDTLPLAVKYHLRFSYTRRNYMWTQTGSFFLKETEG
Microcebus_murinus|5408             YIRYDNHSTNVLAAVVFEHTFNHSKDPLPLAVKYHLRFSYTRRNYMWTQTGSFFLKETEG
Oryctolagus_cuniculus|20249         YIRYDNRSSNVLAALVFENEFSHSTDPLPLAVKYHLRFSYTRRNYMWTQSGTFLLRDTEG
Ochotona_princeps|11798             YIRYDNRSSNVLAAVVFEHEFSHSTDPLPLAVKYHLRFSYTRRNYIWTQSGSFLLKETEG
Mus_musculus|22691                  YIRYDNHSSSVLAAVVFEHSFNHSQDPLPLAVKYHLRFSYTRRNYMWTQTGNIFLKETEG
Rattus_norvegicus|13279             YVRYDNHSSNVLAAVVFEHTFNHSKDPLPLAVRYHLRFSYTRRNYMWTQTGNLFLKETEG
Cavia_porcellus|12221               YIRYDNHSSNVLAAVVFENASNHSKEPLPLTVKYHLRFSHTRRNYMWTQTGNFFLKETEG
Callithrix_jacchus|12957            YIRYDNRSSSVLAAVVFEHPFNHSKEPLPLAVKYHLRFSYTRRNYLWTQTGSFFLKETDD
Gorilla_gorilla|22264               YIRYDNRSSSVLAAVVFEHPFNHSKEPLPLAVKYHLRFSYTRRNYMWTQTGSFFLKETEG
Homo_sapiens|73227                  YIRYDNCSSSVLAAVVFEHPFNHSKEPLPLAVKYHLRFSYTRRNYMWTQTGSFFLKETEG
Pan_troglodytes|3469                YIRYDNRSSSVLAAVVFEHPFNHSKEPLPLAVKYHLRFSYTRRNYMWTQTDSFFLKETEG
                                                                   *:** *** :****:***:...: :.::.

Tarsius_syrichta|12704              WHTTSLFPLFPNP---GPREPTSPDGGEPGYIKEGFLTVQHSLDKAIMVYHNGRAIERIF
Tupaia_belangeri|14995              WYTTSLFPLFPNP---GPREPTSPDGGEPGYIREGFLAVQHAVDRAIMHYHANTSAHQLF
Dipodomys_ordii|3782                WHTNSLFPLFPNP---GPREPTSPDGGEPGYIREGFLVVQHAVDKAIMHYHANASTQQLF
Spermophilus_tridecemlineatus|11837 WHTTSLFPLFPNP---GPREPAFPDGGEPGYIREGFLAVQHAVDKAIMYYHANASAHQLF
Otolemur_garnettii|5913             WHTTSLFPLFPNP---GPREPTSPDGGEPGYIREGFLAVQHAVDRAIMQYHAEAATHQLF
Microcebus_murinus|5408             WHTTSLFPLFPNP---GPREPTSADGGEPGYIREGFLAVQHAVDRAIMQYHADAATRQLF
Oryctolagus_cuniculus|20249         WHTNSLFPLFPNP---GPREPASPDGGEPGYVREGFLAVQHAVDRAIMHYHANASAQQLL
Ochotona_princeps|11798             WHTTSLFPLFPNP---GPREPSSPDGGEPGYIREGFLAVQHAVDRAIMQYHANASAHQLF
Mus_musculus|22691                  WHTTSLFPLFPSP---GPREPSSPDGGEPGYIREGFLAMQHAVDKAIMRYHANTSAQQLF
Rattus_norvegicus|13279             WHTASLFPLFPSP---GPREPSSPDGGEPGYIREGFLAVQHAVDKAIMHYHANASAHQLF
Cavia_porcellus|12221               WHTTSLFPLFPSP---GPREPASPDGGEPGYIHEGFLAVQHAVDRAIMQYHANTSAHQLF
Callithrix_jacchus|12957            WHTTSLF-LFPKPRTNSSRWPGRPLLPHTGYIREGFLAVQHAVDRAIMQYHADAATHQLF
Gorilla_gorilla|22264               WHTTSLFPLFPNP---GPREPTSPDGGEPGYIREGFLAVQHAVDRAIMEYHADATTRQLF
Homo_sapiens|73227                  WHTTSLFPLFPNP---GPREPTSPDGGEPGYIREGFLAVQHAVDRAIMEYHADAATRQLF
Pan_troglodytes|3469                WHTTSLFPLFPNP---GPREPTSPDGGEPGYIREGFLAVQHAVDRAIMEYHADAATRQLF
                                    *:* *** ***.*   ..* *  .   ..**::****.:**::*:*** **   : .:::

Tarsius_syrichta|12704              DNVTILVKRFPYL-LIIDSFVGIFGFLLLTLLFIFFQ-NSLSLIQTIATEKEKKLKXXXX
Tupaia_belangeri|14995              QKLTVMAKRFPYPPFISDPFLIAIQYQLPLLLTLSFTYTSLAIIRAVVQEKERKLKXXXX
Dipodomys_ordii|3782                QKLTVKAKRFPFPPYISDPFLIAIQYQLPLLLMLSFTYTSLTIIRSVVQEKERKLKEYMH
Spermophilus_tridecemlineatus|11837 QKLTVVAKRFPFPPFISDPFLVAIQYQLPLLLMLSFTYTSLSIIRAVVQEKERRLKEYMR
Otolemur_garnettii|5913             QKLTVMAKRFPYPPFISDPFLVAIQYQLPLLLMLSFTYSSLTITRAIVQEKERKLKEYMR
Microcebus_murinus|5408             QNLTVIAKRFPYPPFISDPFLAAIQYQLPLLLMLSFTYASLTITRAVVQEKERKLKEYMR
Oryctolagus_cuniculus|20249         QQLTVTVKRFPYPPFISDPFLVAIQYQLPLLLLLSFTYASLTIIRAVVQEKERKLKEYMR
Ochotona_princeps|11798             QKLTVVVKRFPYPPFIQDPFLVAIQYQLPLLLMLSFTYASLTIVRALVQEKQHKLKEYMR
Mus_musculus|22691                  QKLMVITKRFPFPPYISDPFLIAIQYQLPLLLMLSFTYTSLTIIRAVVQEKEKKLKEYMR
Rattus_norvegicus|13279             QKLTVITKRFPFPPYISDPFLIAIQYQLPLLLMLSFTYTSLTIIRAVVQEKEKKLKEYMR
Cavia_porcellus|12221               QKLTVTAKRFPFPPFISDPFLVAIQYQLPLLLMLSFTYTSLTIIRAVVQEKERKLKEYMR
Callithrix_jacchus|12957            QRLTVAIKRFPYPPFIADPFLVAIQYQLPLLLLLSFTYTTLTIARAVVQEKERRLKEYMR
Gorilla_gorilla|22264               QRLTVTIKRFPYPPFIADPFLVAIQYQLPLLLLLSFTYTALTIARAVVQEKERRLKEYMR
Homo_sapiens|73227                  QRLTVTIKRFPYPPFIADPFLVAIQYQLPLLLLLSFTYTALTIARAVVQEKERRLKEYMR
Pan_troglodytes|3469                QRLTVTIKRFPYPPFIADPFLVAIQYQLPLLLLLSFTYTALTIARAVVQEKERRLKEYMR
                                    :.: :  ****:   * *.*:  : : *  ** : *   :*:: :::. **:::**    

Tarsius_syrichta|12704              XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tupaia_belangeri|14995              XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Dipodomys_ordii|3782                MMGLSSWLHWTAWFLMFFFFLLIAVSFMTFLLCIKVKKDIAVLSSSDPSLVLVFLLCFAI
Spermophilus_tridecemlineatus|11837 MXXXXSWLHWSA------LMLLLIVVSMTLLFCVKVKKDVAVLSSSDPSLVLAFLLCFAI
Otolemur_garnettii|5913             MMGLSNWLHWSAWFLLFFLFLLITVSFMTLLFCIKVKKDVAVLSHSEPSLVLAFLVCFAI
Microcebus_murinus|5408             MMGLSNWLHWSAWFLLFFLFLLVAVSLMTLLLCIKVKKDVAVLAHSEPSLVLAFLVCFAV
Oryctolagus_cuniculus|20249         MLGLDSWVHWNAWFLMFFLVLLVVVSFMTLLFCVKVKTGVAVLTNSDPSLVLAFLLCFAT
Ochotona_princeps|11798             MLGLDSWLHWSAWFLVFFLVLLVVVSLMTLLFCIRVKKGVAVLTSSDPSLVLAFLLCFAI
Mus_musculus|22691                  MMGLNSWLHWSAWFLMFFLFFLIVVSFMTLLFCVKVKKDIAVLSNSDPSLVLAFLLCFAI
Rattus_norvegicus|13279             MMGLSSWLHWSAWFLMFLLFSLIVVSFMTLLFCVKVREEEGAESSTTPELRASXLLCFAI
Cavia_porcellus|12221               MMGLSSWLHWSAWFLMFFLFLLIAVSFMTLLFCVKVKKDVAVLSRSDPSLVLVFLLCFAI
Callithrix_jacchus|12957            MMGLSSWLHWSAWFLVFFLFLLIASSFMTLLFCVKVKPDAAVLSRSNPSLVLAFLLCFAV
Gorilla_gorilla|22264               MMGLSSWLHWSAWFLLFFLFLLIAASFMTLLFCVKVKPDVAVLSRSDPSLVLAFLLCFAI
Homo_sapiens|73227                  MMGLSSWLHWSAWFLLFFLFLLIAASFMTLLFCVKVKPNVAVLSRSDPSLVLAFLLCFAI
Pan_troglodytes|3469                MMGLSSWLHWSAWFLLFFLFLLIAASFMTLLFCVKVKPNVAVLSRSDPSLVLAFLLCFAI
                                                                                                

Tarsius_syrichta|12704              XXXXXXXXXXXXXX----------------------------------------------
Tupaia_belangeri|14995              X-----------------------------------------------------------
Dipodomys_ordii|3782                SSISFSFMVSTFFN----------------------------------------------
Spermophilus_tridecemlineatus|11837 SSISFSFMVSTFFS----------------------------------------------
Otolemur_garnettii|5913             SSISFSFMVSTFFN----------------------------------------------
Microcebus_murinus|5408             ASISFSFMVSTFFS----------------------------------------------
Oryctolagus_cuniculus|20249         SSISFSFMVSTFFS----------------------------------------------
Ochotona_princeps|11798             SSICFSFMVSTFFS----------------------------------------------
Mus_musculus|22691                  SSISFSFMVSTFFSKANIAAAVGGFLYFFTYTPYFFVAPRYNWMTLSQKLLSCLLSNVAM
Rattus_norvegicus|13279             SSISFSFMVSTFFSKANMAATVGGFLYFFTYTPYFFVAPRYNWMTLSQKLLSCLLSNVAM
Cavia_porcellus|12221               SSISFSFMVSTFFSKANMAAAVGGFLYFFTYIPYFFVAPHYNWMTLSQKLLSCLLSNVAM
Callithrix_jacchus|12957            STISFSFMVSTFFSKANMAAAFGGFLYFFTYIPYFFVAPRYNWMTLSQKLCSCLLSNVAM
Gorilla_gorilla|22264               STISFSFMVSTFFSKANMAAAFGGFLYFFTYIPYFFVAPRYNWMTLSQKLCSCLLSNVAM
Homo_sapiens|73227                  STISFSFMVSTFFSKANMAAAFGGFLYFFTYIPYFFVAPRYNWMTLSQKLCSCLLSNVAM
Pan_troglodytes|3469                STISFSFMVSTFFSKANMAAAFGGFLYFFTYIPYFFVAPRYNWMTLSQKLCSCLLSNVAM
                                                                                                

Tarsius_syrichta|12704              ------------XXTGIQWRDLLSPVNVDDDFCFGQVLGMLLLDSVLYGLVTWYVEAVFP
Tupaia_belangeri|14995              ------------XXXXXXXXXXXXXXSVGGEFNFTQVLLMLLPDSLLYCLLT-YVESVLP
Dipodomys_ordii|3782                ------------KXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Spermophilus_tridecemlineatus|11837 ------------KXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Otolemur_garnettii|5913             ------------KGTGIQWQDLLSPVSVDDDFCFGHVLGMLLLDSVLYGLATWYVEAVFP
Microcebus_murinus|5408             ------------KGTGIQWRDLLSPVSVDDDFCFGQVLGMLLLDSVLYGMAAWYVEAVFP
Oryctolagus_cuniculus|20249         ------------KGTGIQWRDLLSPVSVDDDFCFGHVLGLLLLDSVLYGLVTWYVEAVFP
Ochotona_princeps|11798             ------------KGTGIQWRDLLSPVSVDDDFCFGQVLGMLLLDSVLYGLVTWYVEAVFP
Mus_musculus|22691                  AMGAQLIGKFEAKGTGIQWRDLLNPVNVDDNFCFGQVLGMLLLDSALYGLVTWYVEAVFP
Rattus_norvegicus|13279             AMGAQLIGKFEAKGTGIQWCDLLNPVNVDDDFCFGQVLGMLLLDSVLYGLVTWYVEAVFP
Cavia_porcellus|12221               AMGAQLIGKFEAKGTGIQWQNLLSPVNVDDDFCFGQVLGMLLLDSVLYGLVTWYMEAVFP
Callithrix_jacchus|12957            AMGAQLIGKFEAKGVGIQWQDLLSPVNVDDDFCFGQVLGMLLLDSVLYGLVAWYVEAVFP
Gorilla_gorilla|22264               AMGAQLIGKFEAKASFLRHSKLLHQLGFED-FSSTTALAMQFLAAACKGLGLWKEISVFP
Homo_sapiens|73227                  AMGAQLIGKFEAKGMGIQWRDLLSPVNVDDDFCFGQVLGMLLLDSVLYGLVTWYMEAVFP
Pan_troglodytes|3469                AMGAQLIGKFEAKGMGIQWRDLLSPVNVDDDFCFGQVLGMLLLDSVLYGLVTWYMEAVFP
                                                                                                

Tarsius_syrichta|12704              GQFGVPQPWYFF-VMRSYWFGES---SEKKTEKNQSYETFQSKYFEAEPTDLIAGIQINH
Tupaia_belangeri|14995              GKYGTPKPWYFF-LLPSYWRGSPRTALGKEDDDSDPEKVLRTEFFEAEPEDLVAGIKIKH
Dipodomys_ordii|3782                XXXXXXXXXXXX-XXPSYWCGSPRTVVGKEEEDSDPEKALRTEYFEAEPEDLVAGLKIKH
Spermophilus_tridecemlineatus|11837 XXXXXPQPWYFF-LMPSYWCGNPRTVVGKEEEDSDPEKALRTEYFEAEPEDLVAGIKIKH
Otolemur_garnettii|5913             GQFGVPQPWYFF-VMPSYWCGNPRTVIGKEEEDSDPEKVLGTEYFEAEPEDLVAGIKIKH
Microcebus_murinus|5408             GQFGVPQPWYFC-VLPSYWFGTPRTVVGKKEEDNDPEKALRTEYFEAEPEDLVAGIKIKH
Oryctolagus_cuniculus|20249         GQFGVPQPWYFF-IMPSYWCGSPRTALGKE-EDADPEKALPTEHCEAEPEALVAGIKIKH
Ochotona_princeps|11798             GQFGMPQPWYFF-IMPSYWCASPRTATGKE-EDADPEKGIPTEHCEAEPEALLPGIKIKH
Mus_musculus|22691                  GQFGVPQPWHFF-LMPSYWCGNPRTVVGKEEEGSDPEKALRNEYFEAEPEDLVAGIKIKH
Rattus_norvegicus|13279             GQFGVPQPWYFF-LMPSYWCGNPRTVVGKEEEGGDPEKAFRTEYFEAEPEDLAAGIKIKH
Cavia_porcellus|12221               GQFGVPQPWYFF-LLPSYWCGNPRMVVRKEEEDSDPEKAFRSEYFEAEPEDLVAGIKIKH
Callithrix_jacchus|12957            GQFGVPQPWYFF-IMPSYWCGKPRTVTGKEDEDSDPEKALRTEYFEAEPEDLVAGIKIKH
Gorilla_gorilla|22264               CLLGIGVPQVFIKCPPSYWCGKPRAVAGKEEEDSDPEKALRNEYFEAEPEDLVAGIKIKH
Homo_sapiens|73227                  GQFGVPQPWYFF-IMPSYWCGKPRAVAGKEEEDSDPEKALRNEYFEAEPEDLVAGIKIKH
Pan_troglodytes|3469                GQFGVPQPWYFF-IMPSYWCGKPRAVAGKEEEDSDPEKALRNEYFEAEPEDLVAGIKIKH
                                                    *** . .     *: :  :. : : .:. ****  * .*::*:*

Tarsius_syrichta|12704              LCKVFHRGKTKHIAVKGLT-VNIYRGQITVLLGHNGTGKTATCFMLTGLYTATSGNAYIN
Tupaia_belangeri|14995              LSKVFRVGGEDKAAVRDLN-LNLYEGQITVLLGHNGAGKTTTLSMLTGLFPPTSGRAYIS
Dipodomys_ordii|3782                LSKVFRVGNKDKAVVRDLN-LNLYEGQITVLLGHNGAGKTTTLSVLTGLYPPTSGRVYIS
Spermophilus_tridecemlineatus|11837 LSKVFQVGNKDKTAVRDLERVNLYEGQITVXXXXXXXXXXXXXXXXXXLYPSTSGEAYVY
Otolemur_garnettii|5913             LSKVFRVGNKDKAAVKDLN-LNLYEGQITVLLGHNGAGKTTTLSMLTGLFPPTSGQAYIS
Microcebus_murinus|5408             LSKVFRVGNKEQAAVWDLN-LNLYEGQITVLLGHNGAGKTTTLSMLTGLFPPTSGQAYIS
Oryctolagus_cuniculus|20249         LSKVFRVGNKDRAAVRDLN-LNLYEGQVTVLLGHNGAGKTTTLSMLTGLFPPTSGQAYIS
Ochotona_princeps|11798             LSKVFQVGHKDRAAVRDLS-LNLYEGQITVLLGHNGAGKTTTLSMLTGLFPPTSGQAYIR
Mus_musculus|22691                  LSKVFQVGNKDKMGIRDLT-LNLYEGQITVLLGHNGAGKTTTMSLLTGLFPPTSGHAYIH
Rattus_norvegicus|13279             LSKVFQVGNKDKMGIRDLT-LNLYEGQITVLLGHNGAGKTTTMSMLTGLFPPTSGHAYIR
Cavia_porcellus|12221               LSKVFQVGNKEKAAVRDLS-LNLYEGQITVLLGHNGAGKTTTLSMLTGLFPPTSGRAYIS
Callithrix_jacchus|12957            LSKVFRVGNKDRAAVRDLN-LNLYEGQITVLLGHNGAGKTTTLSMLTGLFPPTSGRAYIS
Gorilla_gorilla|22264               LSKVFRVGNKDRAAVRDLN-LNLYEGQITVLLGHNGAGKTTTLSMLTGLFPPTSGRAYIS
Homo_sapiens|73227                  LSKVFRVGNKDRAAVRDLN-LNLYEGQITVLLGHNGAGKTTTLSMLTGLFPPTSGRAYIS
Pan_troglodytes|3469                LSKVFRVGNKDRAAVRDLN-LNLYEGQITVLLGHNGAGKTTTLSMLTGLFPPTSGRAYIS
                                    *.***: *  .:  : .*  :*:*.**:**                  *:..***..*: 

Tarsius_syrichta|12704              GYDISKQMVQIRKSLGLCPQHDLLFNHLTVSEHLYFY--IKGIPLKMQPVEIDHMLSAFN
Tupaia_belangeri|14995              GYEISRDMVQIRKNLGLCPQHDVLFDNLTVTEHLYFYAQLKGLSRQKCPEEVKQMLHTLG
Dipodomys_ordii|3782                GYEISQDMALIRKSLGLCPQHDVLFDNLTVAEHLYFYAQLKGLSPQKCPEEVKHMLYALN
Spermophilus_tridecemlineatus|11837 GYEISQHMTEIRKFLGLCPQQNLLYNYLTVSEHLYL---LKGLSQQKCPEEVEQMLHILN
Otolemur_garnettii|5913             GYEISQDMVQIRKSLGLCPQHDILFDNLTVVEHLYFYAQLKGLSRQKCPEEVKKMLHILG
Microcebus_murinus|5408             GYEISQDMVQIRKSLGLCPQHDILFDNLTVAEHLYFYAQLKGLSRQKCPEEVKQMLHILS
Oryctolagus_cuniculus|20249         GYEISQDMPQIRKSLGLCPQHDVLFDNLTVEEHLSFYAQLKGLSPHKCPEEVKQMLHVLS
Ochotona_princeps|11798             GYEISQDMACIRKSLGLCPQHDILFDNLTVAEHLSFYAQLKGLSRHKCPEEVKQMLHALG
Mus_musculus|22691                  GYEISQDMAQIRKSLGLCPQHDVLFDNLTVAEHLYFYAQLKGLSLQKCPEEVKQMLHILS
Rattus_norvegicus|13279             GYEISQDMVQIRKSLGLCPQHDVLFDNLTVAEHLYFYAQLKGLSVQKCPEEVKQMLHTLG
Cavia_porcellus|12221               GYEISQDMVQIRKSLGLCPQHDVLFDNLTVAEHLCFYAQLKGLSRQKCPEEVKQMLHILS
Callithrix_jacchus|12957            GYEISQDMVQIRKSLGLCPQHDILFDGLTVEEHLYFYAQLKGLSRQKCPEEVKEMLHTLG
Gorilla_gorilla|22264               GYEISQDMVQIRKSLGLCPQHDILFDNLTVAEHLYFYAQLKGLSRQKCPEEVKQMLHIIG
Homo_sapiens|73227                  GYEISQDMVQIRKSLGLCPQHDILFDNLTVAEHLYFYAQLKGLSRQKCPEEVKQMLHIIG
Pan_troglodytes|3469                GYEISQDMVQIRKSLGLCPQHDILFDNLTVAEHLYFYAQLKGLSRQKCPEEVKQMLHIIG
                                    **:**:.*  *** ******:::*:: *** *** :   :**:. :  * *:..**  :.

Tarsius_syrichta|12704              LLEKRNAFSQTLSGGMKRKLSIIIALIGGSKVVILDEPTSGMDPASRRVTWDLLQHYKQN
Tupaia_belangeri|14995              LEDTRDSRSRFLSGGMRRRLSIGIALIAGSKVLLLDEPTAGMDAISRRAIWDLLQQQKSD
Dipodomys_ordii|3782                MEDKRNSPCKYLSGGMKRKLSIGIALIAGSKLLILDEPTSGMDAISRRAIWDLLQQQKSD
Spermophilus_tridecemlineatus|11837 LEDKRNSQSKFLSGGMKRKLSIGIALIAGSKVLMLDEPTSGMDAISRRAIWDLLQQQKSD
Otolemur_garnettii|5913             LEDKWASRSRFLSGGMKRKLSIGIALIAGSKVLILDEPTSGMDAISRRAIWDLLQQQKSD
Microcebus_murinus|5408             LEDKWDSRSRYLSGGMKRKLSIGIALIAGSKVLMLDEPTSGMDAISRRAIWDLLQQQKSD
Oryctolagus_cuniculus|20249         LEDKRDSRCRFLSGGMKRKLSVGIALIAGSKVLMLDEPTSGMDAISRRAVWDLLQQQKSD
Ochotona_princeps|11798             LEDKRHTRCKLLSGGMKRKLSIGIALIAGSKVLMLDEPTSGMDAISRRAVWDLLQQQKTD
Mus_musculus|22691                  LEDKRDLRSKFLSGGMKRKLSIGIALIAGSKVLMLDEPTSGMDAVSRRAIWDLLQQQKSD
Rattus_norvegicus|13279             LEDKRDSRSKFLSGGMKRKLAIGIALIAGSKVLMLDEPTSGMDAVSRRAIWDLLQQQKSD
Cavia_porcellus|12221               LEDKRNSLCRFLSGGMKRKLSIGIALIAGSKVLMLDEPTSGMDAISRRAIWDLLQQQKND
Callithrix_jacchus|12957            LDDKRDSPSRFLSGGTRRKLSIGIALIAGSKVLMLDEPTSGMDAISRRAIWDLLQQQKRD
Gorilla_gorilla|22264               LEDKWNSRSRFLSGGMRRKLSIGIALIAGSKVLILDEPTSGMDAISRRAIWDLLQRQKSD
Homo_sapiens|73227                  LEDKWNSRSRFLSGGMRRKLSIGIALIAGSKVLILDEPTSGMDAISRRAIWDLLQRQKSD
Pan_troglodytes|3469                LEDKWNSRSRFLSGGMRRKLSIGIALIAGSKVLILDEPTSGMDAISRRAIWDLLQRQKSD
                                    : :.    .: **** :*:*:: ****.***:::*****:***. ***. *****: * :

Tarsius_syrichta|12704              RTILLTTHYMDEADILGDRIAIMVEGSLRCCGSSIFLKKTYGAGYHMTLVKEPHCNPESI
Tupaia_belangeri|14995              HTILLTTHFMDEADLLGDRIAIMAKGELQCCGSSLFLKQKYGAGYHMTLVKEPHCNLEGV
Dipodomys_ordii|3782                RTILLTTHFMDEADLLGDRIAIMADGELQCCGSSLFLKQKYGAGYHMTLVKEPHCNPEAI
Spermophilus_tridecemlineatus|11837 RTILLTTHFMDEADLLGDRIAIMAKGELQCCGSSLFLKQKYGAGYHMTLVKEPHCNPEGI
Otolemur_garnettii|5913             RTILLTTHFMEEADLLGDRIAIMAKGELQCCGSSLFLKQKYGAGYHMTLVKEPHCNPEGI
Microcebus_murinus|5408             RTILLTTHFMDEADLLGDRIAIMAKGELQCCGSSLFLKQKYGAGYHMTLVKEPHCNPEGV
Oryctolagus_cuniculus|20249         RTILLTTHFMDEADLLGDRIAIMAKGELQCCGSPLFLKQKYGAGYHMTLVKEPHCNPAGV
Ochotona_princeps|11798             RTILLTTHFMDEADLLGDRIAIMAKGELQCCGSPLFLKQKYGAGYHMTLVKEPHCNPASV
Mus_musculus|22691                  RTVLLTTHFMDEADLLGDRIAILAKGELQCCGSSLFLKQKYGAGYHMTLVKEPHCNPEGI
Rattus_norvegicus|13279             RTVLLTTHFMDEADLLGDRIAILAKGELQCCGSSLFLKQKYGAGYHMTLVKEPHCNPEGI
Cavia_porcellus|12221               RTILLTTHFMDEADLLGDRIAIMAKGELQCCGSSLFLKQKYGAGYHMTLVKEPHCNPKAI
Callithrix_jacchus|12957            RTIVLTTHFMDEADLLGDRIAIMAKGELQCCGSPLFLKQKYGAGYHMTLVKEPHCNPEGI
Gorilla_gorilla|22264               RTIVLTTHFMDEADLLGDRIAIMAKGELQCCGSSLFLKQKYGAGYHMTLVKEPHCNPEDI
Homo_sapiens|73227                  RTIVLTTHFMDEADLLGDRIAIMAKGELQCCGSSLFLKQKYGAGYHMTLVKEPHCNPEDI
Pan_troglodytes|3469                RTIVLTTHFMDEADLLGDRIAIMAKGELQCCGSSLFLKQKYGAGYHMTLVKEPHCNPEDI
                                    :*::****:*:***:*******:..*.*:****.:***:.****************   :

Tarsius_syrichta|12704              SQLVRHHVPNATLESNAGAELSFILPKESTHXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tupaia_belangeri|14995              SQLVPHHVPNATLQSSAGAELSFVLPKESTHXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Dipodomys_ordii|3782                SQLVHRHVPNATLESHAGAELSFILPKESTHRFEGLFAKLEKKQKELGIASFGASVTTME
Spermophilus_tridecemlineatus|11837 SQLVHHHVPNATLESSVGAELSFILPKESTHRFESLFTKLENKQKELGIASFGASVTTME
Otolemur_garnettii|5913             SQLVYHHVPNATLESNAGAELSFILPKESTHRFESFVP--GKKQKEPGLA-FGASGTTME
Microcebus_murinus|5408             SQLVYHHVPNATLESSAGAELSFILPKESTHRFESLFTKLEKKQKELGIASFGASVTTME
Oryctolagus_cuniculus|20249         SQLVRHHVPNATLESSAGAELSFILPKESTHRFESLFAKLEKRQKELGIASFGASVTTME
Ochotona_princeps|11798             MQLVYQHIPNATLQSNAGAELSFVLPKESTHRFESLFGKLEKRQKELGIASFGASVTTME
Mus_musculus|22691                  SQLVHHHVPNAMLESHAGAELSFILPKESTHRFESLFAKLEKKQKELGIASFGASVTTME
Rattus_norvegicus|13279             SQLVHHHVPNAMLESHAGAELSFILPKESTHRFESLFAKLEKKQKELGIASFGASVTTME
Cavia_porcellus|12221               SQLVYHHIPNATLESSAGAELSFILPKESTHRFESLFAKLEKKQKELGIASFGASVTTME
Callithrix_jacchus|12957            SQLVHHHVPNATLESSAGAELSFILPRESTHRFEGLFAKLEKKQKELGIASFGASVTTME
Gorilla_gorilla|22264               SQLVHHHVPNATLESSAGAELSFILPRESTHRYASQGGHAQRDSNHMNLTRPGSWVLTGP
Homo_sapiens|73227                  SQLVHHHVPNATLESSAGAELSFILPRESTHRFEGLFAKLEKKQKELGIASFGASITTME
Pan_troglodytes|3469                SQLVHHHVPNATLESSAGAELSFILPRESTHRFEGLFAKLEKKQKELGIASFGASITTME
                                     *** :*:*** *:* .******:**:****                             

Tarsius_syrichta|12704              XXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tupaia_belangeri|14995              XXX-XXVGKLVDSSMDIQAVQLPALQYQHERRASDWXXXXXXXXXXXXXXXXXXXXXXXX
Dipodomys_ordii|3782                EVF-LRVGKLVDTSMDIQAIQLPALQYQHERRASDWAVDSNLCGVMDPTDGIGGLMEEDH
Spermophilus_tridecemlineatus|11837 EVF-LRVGKLVDTSMDIQAIQLPALQYQHERRASDWAVDSNLCGVMDPTDGIGTLIEEEH
Otolemur_garnettii|5913             -VF-FWVGKLVDTSMDMQAIQLPPLQYQHERRASDWAVDSNLCGAMDPTDGIGALIEEQC
Microcebus_murinus|5408             EVF-LRVGKLVDTSMDMQAIQLPALQYQHERRASDWAVDSNLCGAMDPTDGIGALIEEER
Oryctolagus_cuniculus|20249         EVF-LRVGKLVDTSMDIQAVQLPALQYQHERRASDWAVDSSLCGALDPTDGIGALIEEEP
Ochotona_princeps|11798             EVF-LRVGKLVDSSMDIQAVQLPALQYQHERRASDWALDSNLCGLLDPTDGVGTLIEEEP
Mus_musculus|22691                  EVF-LRVGKLVDTSMDIQAIQLPALQYQHERRASDWALDSNLCGVMDPTNGIGALIEEEE
Rattus_norvegicus|13279             EVF-LRVGKLVDTSMDIQAIQLPALQYQHERRASDWALDSNLCGVMDPTNGIGALIEEEE
Cavia_porcellus|12221               EVF-LRVGKLVDTSMDIQAIQLPALQYQHERRASDWAVDSNLCGVMDPTDGIGTLIEEEH
Callithrix_jacchus|12957            EVF-LRVGKLVDSSMDIQAIQLPALQYQHERRASDWAVDSNLCGAMDPTDGIGALIEEEH
Gorilla_gorilla|22264               CVYRHRVGKLVDSSMDIQAIQLPALQYQHERRASDWAVDSNLCGAMDPSDGIGALIEEER
Homo_sapiens|73227                  EVF-LRVGKLVDSSMDIQAIQLPALQYQHERRASDWAVDSNLCGAMDPSDGIGALIEEER
Pan_troglodytes|3469                EVF-LRVGKLVDSSMDIQAIQLPALQYQHERRASDWAVDSNLCGAMDPSDGIGALIEEER
                                                                                                

Tarsius_syrichta|12704              XXXXXXXXLALHCQQFWAMFLKKAAYSWREWKMVVAQVLVPLTCITLALLAINYSSEIFD
Tupaia_belangeri|14995              XXXXXXXXLALHCQQFWAMLLKKASYSWREWKMVAAQVLVPLTCVTLALLAINYSSEILD
Dipodomys_ordii|3782                TMVKLNTGLSLHCQQLWAMFLKKAAYSWREWKMLAAQVVVPLTCITLALLAISYSTELFD
Spermophilus_tridecemlineatus|11837 TVVKLNTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Otolemur_garnettii|5913             ATVKLNTGLALHCQQFWAMFLKKATYSWREWKMVAAQVLVPLTCVTLGLLAVNYSSEIFD
Microcebus_murinus|5408             AAVKLNTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Oryctolagus_cuniculus|20249         SMVKLNTGLALHWQQFWAMFLKKATYSWREWKMLAAQILVPLTCVTLALLAINYSSEILD
Ochotona_princeps|11798             AMVKLNSGLALHWQQFWAMFLKKATYSWREWKMLAAQVLVPLTVVTLALLAINYSSEILD
Mus_musculus|22691                  VLVKLNTGLALHCQQFWAMFLKKAAYSWREWKMVAAQVLVPLTCLTLALLAIHYTSEIFD
Rattus_norvegicus|13279             VLVKLNTGLALHCQQFWAMFLKKAAYSWREWRMVAAQILVPVTCLTLALLAINYTSEIFD
Cavia_porcellus|12221               AVVQLNTGLALHCQQFWAMFLKKATYSWREWKMVAAQILVPLTCVTLALLAINYSSEVFD
Callithrix_jacchus|12957            TAVTLNTGLTLHCQQFWAMFLKKAAYSWREWKMVAAQVLVPVTCVTLALLAINYSSELFD
Gorilla_gorilla|22264               TAVKLNTGLALHCQQFWAMFLKKAAYSWREWKMVAAQVLVPLTCVTLALLAINYSSELFD
Homo_sapiens|73227                  TAVKLNTGLALHCQQFWAMFLKKAAYSWREWKMVAAQVLVPLTCVTLALLAINYSSELFD
Pan_troglodytes|3469                TAVKLNTGLALHCQQFWAMFLKKAAYSWREWKMVAAQVLVPLTCVTLALLAINYSSELFD
                                                                                                

Tarsius_syrichta|12704              DPPLKLTLGEYGRTVVPFSVPGTSRLDQQLSEHLKDMLQAEGQEPREVLGDLEEFLIFRA
Tupaia_belangeri|14995              DPVLKLTLGEYGRTVVPFSAPETSRRGRQLSELLKDMLQAEGQEPREVLGDLEEFLIFRA
Dipodomys_ordii|3782                DPLLRLSLGEYGRTVVPFSVSSTSRLDQQLSELLRDMLQAEGQEPREVLXXXXXXXXXXX
Spermophilus_tridecemlineatus|11837 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLEEFLVFRA
Otolemur_garnettii|5913             DPILKLILGAYGRTVVPFSVPGTSRLGQQLSEHLKDMLQAEGQEPREVLGDLEEFLIFRA
Microcebus_murinus|5408             XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLEEFLIFRA
Oryctolagus_cuniculus|20249         DPLLRLTLGEYGRTVVPFSVPGTSRLDQQLSERLKDMLQAQGQEPREVLGDLEEFLIFRA
Ochotona_princeps|11798             DPLLQLTLSEYGRTAVPFSAPGASRLGQQLSEHLKDMLQAEGQEPREVLGDLEEFLIFRA
Mus_musculus|22691                  DPLLKLSLNEYGRTVVPFSVPGTSRLAQQLSENLRDMLQAERQEPREVLGDLEEFLVFRA
Rattus_norvegicus|13279             DPPLKLSLNEYGTTVVPFSVPGTSRLGQQLSEHLRDMLQAERQEPREVLGDLEEFLVFRA
Cavia_porcellus|12221               DPILKLSLSEYGRTIVPFSVPGTSQLDQQLSEHLRDMLQAAGQEPREVLGDLEEFLVFRA
Callithrix_jacchus|12957            DPMLRLTLGEYGRTVVPFSIPGTSRLGQQLSEHLKDSLQAEEQEPREVLGDLEEFLIFRA
Gorilla_gorilla|22264               DPMLRLTLGEYGRTVVPFSVPGTSQLGQQLSEHLKDALQAEGQEPREVLGDLEEFLIFRA
Homo_sapiens|73227                  DPMLRLTLGEYGRTVVPFSVPGTSQLGQQLSEHLKDALQAEGQEPREVLGDLEEFLIFRA
Pan_troglodytes|3469                DPMLRLTLGEYGRTVVPFSVPGTSQLGQQLSEHLKDALQAEGQEPREVLGDLEEFLIFRA
                                                                                                

Tarsius_syrichta|12704              SVEGGGFSDRCLIKSSFQNEEKQNSITTLVKNK--HSKA---------------------
Tupaia_belangeri|14995              SVEGGGFNERCLVAASFRDVGERTVVTALFNNQAYHSPATALAVVDNLLFRLLCGPRASI
Dipodomys_ordii|3782                XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Spermophilus_tridecemlineatus|11837 SVEGGGFNERCLVATSFRDVGERTVVTALFNNQAYHSPATALAIVDNLLFKLLCGPRASI
Otolemur_garnettii|5913             SVEGGGFNERCLVAVSFRDVGEQMVVTALFNNQAYHSPATALAIVDNLLFKLLCGPLASI
Microcebus_murinus|5408             SVEGGGFNERCLVAVSFRDVGERTVVTALFNNQAYHSPATALAVVDNLLFKLLCSPQASI
Oryctolagus_cuniculus|20249         SVEGGGFNERCLVAMSFGDAGEHTVVTALFNNQAYHSPATALAVVDNLLFQLLCGPRASI
Ochotona_princeps|11798             SVEGGGFNERCLVATSFRDVGERMVVTALFNNQAYHSPATALTVADNLLFRLLCGPRASI
Mus_musculus|22691                  SVEGGGFNERCLVATSFKDRGELTVVTALFNNQAYHSPATALAIVDNLLFKLLCGPQASI
Rattus_norvegicus|13279             SVEGGGFNERCLVATSFKDSGERTVVTALFNNQAYHSPATALAIVDNLLFKLLCGPRASI
Cavia_porcellus|12221               SVEGGGFNERCLVAVSFRDEVERTVVTALFNNQAYHSPATALAIVDNLLFKLLCGPQASI
Callithrix_jacchus|12957            SVEGGGFNERCLVAVSFRDVGERT-VTALFNNQAYHSPATALAVVDNLLFKLLCGPHASI
Gorilla_gorilla|22264               SVEGGGFNERCLVAASFRDVGERTVVTALFNNQAYHSPATALAVVDNLLFKLLCGPHASI
Homo_sapiens|73227                  SVEGGGFNERCLVAASFRDVGERTVVNALFNNQAYHSPATALAVVDNLLFKLLCGPHASI
Pan_troglodytes|3469                SVEGGGFNERCLVAASFRDVGERTVVTALFNNQAYHSPATALAVVDNLLFKLLCGPHASI
                                                                                                

Tarsius_syrichta|12704              ------------------FAMGRKGFDIALNLLFAMAFLASTFSILAVSERAVQAKHVQF
Tupaia_belangeri|14995              VVSNHPQPRSALQAAKDQFNEGREGFDITLNLLFAMAFLASTFAVLAVSERAVRAKHMQF
Dipodomys_ordii|3782                XXXXXXXXXXXXXXXXXXXXXGRKGFDIALNLLFAMAFLASTFSVLAVSERAVQAKHVQF
Spermophilus_tridecemlineatus|11837 VVSNYPQPRSALQAAKDQFNEGRKGFDIALNLLFAMAFLASTFSILAVSERAVQAKHVQF
Otolemur_garnettii|5913             MVSNYPQPRSALQAAKDQFNEGRKGFDIALNLL-AMAFLASTFXXXXXXXXXXXXXXXXX
Microcebus_murinus|5408             VVSNYPQPRSALQAAKDQFSEGRKGFDIALNLLFAMAFLASTFSILAVSERTVQAKHVQF
Oryctolagus_cuniculus|20249         EVSNYPQPRSALQAAKDQFSEGRKGFDIALNLLFAMAFLTSTFSILAVSERAVQAKHVQF
Ochotona_princeps|11798             VVSNYPQPRSALQAAKDQFSEGRKGFDIALNLLFAMAFLASTFSILAVSERAVQAKHVQF
Mus_musculus|22691                  EISNYPQPRNTLQVAKDHFNEGRKGFDIALNLLIAMAFLASTFSILAVSERAVQAKHVQF
Rattus_norvegicus|13279             EISNYPQPRSTLQVAKDQFNEGRKGFDIALNLLIAMAFLASTFSILAVSERAVQAKHVQF
Cavia_porcellus|12221               EVSNYPQPRSALQAAKDQFSEGRKGFDIALNLLFAMAFLASTFSILAVSERTVQAKHVQF
Callithrix_jacchus|12957            VVSNFPQPRSALQAAKDQFNEGRKGFDIALNLLFAMAFLASTFSILAVSERAVQAKHVQF
Gorilla_gorilla|22264               VVSNFPQPRSALQAAKDQFNEGRKGFDIALNLLFAMAFLASTFSILAVSERAVQAKHVQF
Homo_sapiens|73227                  VVSNFPQPRSALQAAKDQFNEGRKGFDIALNLLFAMAFLASTFSILAVSERAVQAKHVQF
Pan_troglodytes|3469                VVSNFPQPRSALQAAKDQFNEGRKGFDIALNLLFAMAFLASTFSILAVSERAVQAKHVQF
                                                         **:****:**** *****:***                 

Tarsius_syrichta|12704              VSGVRVATFWLSALLWDLISFLVPSLLLLVVFKAFDVHAFTRDGHVADTLLLLLLYGWAI
Tupaia_belangeri|14995              VSGVHAATFWLSALLWDLASFLVPSLLLLAVFAYHEEEAFSQRENALAVTLLLSLYGSAI
Dipodomys_ordii|3782                VSGAHVATFWLSALLWDLLSFLVPTLLLLVVFRAFDVRAFTRDGHMADLLLLLLLYGWAI
Spermophilus_tridecemlineatus|11837 VSGVHVATFWFSALLWDLISFLVPALLLLVVFRAFDVRAFTRDGHMADVLLLLMLYGWAI
Otolemur_garnettii|5913             XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVFKAFDVHAFTRDSHPADVLLLLLLYGWAI
Microcebus_murinus|5408             VSGVRVATFWLSALLWDLVSFLVPSLLLLVVFKAFDVRAFTRDGHVADTLLLLLLYGWAI
Oryctolagus_cuniculus|20249         VSGVRVATYWLSALLWDLISFLVPSLLLLAVFRAFDVRAFTWDGHAAGTLLLLLLYGWAI
Ochotona_princeps|11798             VSGVHVATYWLSALLWDLISFLVPSLLLLAVFRAFDVRAFAWDGRAADTLLLLLLYGWAI
Mus_musculus|22691                  VSGVHVATFWFSALLWDLISFLVPSLLLLVVFQAFNVHAFTRDGHMADLLLLLMLYGWAI
Rattus_norvegicus|13279             VSGVHVATFWLSALLWDLISFLVPSLLLLVVFRAFDVHAFTRDGHMADLLLLLMLYGWAI
Cavia_porcellus|12221               VSGMHVATFWLSALLWDLISFLIPILLLLVVFRAFDVRAFIQDGHAADMLLLLMLYGWAI
Callithrix_jacchus|12957            VSGVHVATFWLSALLWDLISFLIPSLLLLVVFKAFDVRAFTRDGHVADTLLLLLLYGWAI
Gorilla_gorilla|22264               VSGVHVASFWLSALLWDLISFLIPSLLLLVVFKAFDVRAFTRDGHVADTLLLLLLYGWAI
Homo_sapiens|73227                  VSGVHVASFWLSALLWDLISFLIPSLLLLVVFKAFDVRAFTRDGHMADTLLLLLLYGWAI
Pan_troglodytes|3469                VSGVHVASFWLSALLWDLISFLIPSLLLLVVFKAFDVRAFTRDGHMADTLLLLLLYGWAI
                                                                 .**  .: .**    .     *** *** **

Tarsius_syrichta|12704              IPLMYLMNFFFSGAATAYTRLTIFNILSGIATFLMVTIMRIPAVKLEELSRTLDHVFLVL
Tupaia_belangeri|14995              APFTYLASFFFDSAGSACVKLVVLLTFLSIGPFILVSVTSEQXXXXXXXXXXXXXXXXXX
Dipodomys_ordii|3782                IPFMYLMSFFFSSASTAYTRLTIFNILSGIVTFIMVTIMRIPAVKLEELSRTLDHVFLVL
Spermophilus_tridecemlineatus|11837 IPFMYLMSFFFSGASTAYTRLTIFNILSGIATFLVVTIMRIPAVKLEELSRTLDHVFLVL
Otolemur_garnettii|5913             IPLMYLSTFFFSGAATAYTRLTIFNILSGIATFLVVTIMRIPAVKLEELSRTLDHVFLVL
Microcebus_murinus|5408             IPLMYLMNFFFSGAATAYARLTIFNILSGIATFLMVTIMRIPAVKLEELSRTLDHVFLVL
Oryctolagus_cuniculus|20249         IPLMYLMSFLFSSAATAYTRLTIFNVLSGIATFLMVTIMRIPAVKLEELARTLDRVFLVL
Ochotona_princeps|11798             IPLMYLLSCLFSSAATAYTRLTIVNILSGIATFLMVTIMRIPAVKLEELSRTLDHVFLVL
Mus_musculus|22691                  IPLMYLMSFFFSAASTAYTRLTIFNILSGIATFIMVTIMRIPAVKLEELSRTLDHVFLVL
Rattus_norvegicus|13279             IPLMYLLSFFFSAASTAYTRLTIFNILSGIATFIVVTIMRIPAVKLEELSRTLDHVFLVL
Cavia_porcellus|12221               VPLMYLLSFFFSGASTAYTRLTIFNILSGIATFLMVTIMRIPALKLEELSRTLDHVFLVL
Callithrix_jacchus|12957            IPLMYLMNFFFSGAATAYTRLTIFNILSGIATFLMVTIMRIPAVKLEELSKTLDHVFLVL
Gorilla_gorilla|22264               IPLMYLMNFFFLGAATAYTRLTIFNILSGIATFLIVTIMRIPAVKLEELSKTLDRVFLVL
Homo_sapiens|73227                  IPLMYLMNFFFLGAATAYTRLTIFNILSGIATFLMVTIMRIPAVKLEELSKTLDHVFLVL
Pan_troglodytes|3469                IPLMYLMNFFFLGAATAYTRLTIFNILSGIATFLMVTIMRIPAVKLEELSKTLDRVFLVL
                                     *: ** . :* .*.:* .:*.:.  : .* .*::*::                      

Tarsius_syrichta|12704              PNHCLGMAVSSFYENYETRRYCTSSEVAAHYCKKYNIEYQENFYAWNTPGVGRFVVSMAT
Tupaia_belangeri|14995              XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKYQENFYAWNAPGVGRFVTSMAA
Dipodomys_ordii|3782                PNHCLGMAVSSFYENYETRQYCTSSEVASHYCKKYNIQYQENFYAWNTPGVGRFVTSMAA
Spermophilus_tridecemlineatus|11837 PNHCLGMAVSSFYENYETQRYCTSSEVAAHYCKKYNIKYQENFFAWSAPGVGRFMTSMAA
Otolemur_garnettii|5913             PNHCLGMAVSSFYENYETRRYCTSSEVAAHYCKKYXXXXXXXXXXXXXXXXXXXXXXXXX
Microcebus_murinus|5408             PNHCLGMAVSSFYENYETRRYCTSSEVAAHYCKKYNIEYQENFYAWRAPGVGRFVASMAA
Oryctolagus_cuniculus|20249         PNHCLGMAVSSFYENYETKHYCTSSEIAAHYCKKFNIVYQENFFAWSAPGVGRFVTSMAA
Ochotona_princeps|11798             PNHCLGMAVSNLYENYETQRYCTSSEIAAHYCKKYNIVYQENFYAWSAPGVGRFATSMAA
Mus_musculus|22691                  PNHCLGMAVSNFYENYETRRYCTSSELAAHYCKKYNIQYQESFYAWSTPGVGKFVTSMAA
Rattus_norvegicus|13279             PNHCLGMAVSNFYENYETRRYCTSSEVATHYCKKYNIQYQENFYAWSTPGIGKFVTSMAA
Cavia_porcellus|12221               PNHCLGMAVSSFYENYETRRYCTSSDVATHYCKKYNIEYQENFYAWSMPGVGRFVTSMAT
Callithrix_jacchus|12957            PNHCLGMAVSSFYENYETRRYCTSSDVAAHYCKKYDIQYQENFYAWSAPGVGRFVASMAT
Gorilla_gorilla|22264               PNHCLGMAVSSFYENYETRRYCTSSEVAAHYCKKYNIQYQENFYAWSAPGVGRFVASMAA
Homo_sapiens|73227                  PNHCLGMAVSSFYENYETRRYCTSSEVAAHYCKKYNIQYQENFYAWSAPGVGRFVASMAA
Pan_troglodytes|3469                PNHCLGMAVSSFYENYETRRYCTSSEVATHYCKKYNIQYQENFYAWSAPGVGRFVASMAA
                                                                                                

Tarsius_syrichta|12704              SGCTYLILLFLIETNLLRRLKSFFCAFWRRQTLTELYTRMSVLPEDQDVADERSRILAPS
Tupaia_belangeri|14995              SGFIYLALLFLIETNLLWGLRTAVCAFWRRRMLTELCSRSAVLPEDQDVAAERSRILAPS
Dipodomys_ordii|3782                SGCAYLSLLFLIETNLLWRLRTFICAFQRRWTLAELHSRTSVLPEDQDVADERNRVLAPS
Spermophilus_tridecemlineatus|11837 SGCAYLTLLFLIETNLLWRLRTFICAFQKRWTLEELHNRTSVLPEDQDVADERSRVLAPG
Otolemur_garnettii|5913             XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTELCTRTSVLPEDQDVADERSRVLAPS
Microcebus_murinus|5408             SGCAYLSLLFLIETNLLWRLRTFLCAFRRKQTLAELCTRTSVLPEDQDVADERSRVLAPS
Oryctolagus_cuniculus|20249         SGCAYLTLLFLIETDLLWRLRNSVCAFRRRWTLAELCAQTALLPEDQDVAEERSRVLAPS
Ochotona_princeps|11798             SGCFYLSLLFLIETNLLQRLRSAVCALRRRRTLAELCAQTALLPEDQDVANERNRVLAPS
Mus_musculus|22691                  SGGIYLTLLFLIETNLLWRLRTFICAFRRRWTLAELQNRTSVLPEDQDVAEERSRILVPS
Rattus_norvegicus|13279             SGGIYLTLLFLIETNLLWRLRTFVCAFRRRWTLAELQNRTSVLPEDQDVADERSRVLVPS
Cavia_porcellus|12221               SGCVYLTLLFLIETNLLWRLRTFVCAFWRRWMLAELHSRTSVVPEDLDVAQERNRVLTPG
Callithrix_jacchus|12957            SGCAYLILLFLIETNLLQRLRGILCVFWRRRTLAELYTRMPVLPEDQDVVDERTRILAPS
Gorilla_gorilla|22264               SGCAYLILLFLIETNLLQRLRGILCALRRRRTLTELHTRMPVLPEDQDVADERTRILAPS
Homo_sapiens|73227                  SGCAYLILLFLIETNLLQRLRGILCALRRRRTLTELYTRMPVLPEDQDVADERTRILAPS
Pan_troglodytes|3469                SGCAYLILLFLIETNLLQRLRGILCALRRRRTLTELYTRMPVLPEDQDVADERTRILAPS
                                                                      **  : .::*** **. **.*:*.*.

Tarsius_syrichta|12704              LDSLLDTPLIIKELSKVYEQRMPLLAVDKISLAVQKGECFGLLGFNGAGKTTTFKMLTGE
Tupaia_belangeri|14995              LXXXXXXXXXXXXXXXKYEQQAPLLAVDRLYIAVQ-GECFG-LGFNGAGKITTFKMLSAE
Dipodomys_ordii|3782                LES--HTPLIIKEISKVYDQRAPLLAVDRISLAVQKGECFGLLGFNGAGKTTTFKMLTGE
Spermophilus_tridecemlineatus|11837 LDILLHTPLTIRELSKVYEQQVPLLAVDRISLTVQKGECFGLLGFNGAGKTTTFKMLTGE
Otolemur_garnettii|5913             LDALLNTPLVIKELSKVYEQRVPLLAVDKVSLTVQKGECFGLLGFNGAGKTTTFKMLTGE
Microcebus_murinus|5408             LDSLLDTPLVIKELSKVYEQRVPLLAVDKVSLAVQKGECFGLLGFNGAGKTTTFKMLTGE
Oryctolagus_cuniculus|20249         LGPLLDAPLIIKELSKVYEQRTPLLAVDKISLAVQRGECFGLLGFNGAGKTTTFKMLTGE
Ochotona_princeps|11798             PDPLLDAPLVIKELSKVYDQRTLLLAVDRISLAVQRGECFGLLGFNGAGKTTTFKMLTGE
Mus_musculus|22691                  LDSMLDTPLIINELSKVYDQRAPLLAVDRISLAVQKGECFGLLGFNGAGKTTTFKMLTGE
Rattus_norvegicus|13279             LDSMLDTPLIINELSKVYDQRAPLLAVDRISLAVQKGECFGLLGFNGAGKTTTFKMLTGE
Cavia_porcellus|12221               LDSLLDTPLIIKELSKVYEQQTPLIAVDRISLAVQKGECFGLLGFNGAGKTTTFKMLTGE
Callithrix_jacchus|12957            SDFLLHTPLIIKELSKVYEQQVPLLAVDRISLAVQKGECFGLLGFNGAGKTTTFKMLTGE
Gorilla_gorilla|22264               PDSLLHTPLIIKELSKVYEQRVPLLAVDRISLAVQKGECFGLLGFNGAGKTTTFKMLTGE
Homo_sapiens|73227                  PDSLLHTPLIIKELSKVYEQRVPLLAVDRLSLAVQKGECFGLLGFNGAGKTTTFKMLTGE
Pan_troglodytes|3469                PDSLLHTPLIIKELSKVYEQRVPLLAVDRISLAVQKGECFGLLGFNGAGKTTTFKMLTGE
                                                     *:*:  *:***:: ::** ***** ******** ******:.*

Tarsius_syrichta|12704              ESITSGDAFVGGHSISSDIGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tupaia_belangeri|14995              EAITAGDAFVGGHSVSTDIGK---------------------------------------
Dipodomys_ordii|3782                ETITSGDAFVGGYSISSDIQQVRQRMGYCPQFDALLDHMTGREMLVMYARLRGIPERLIG
Spermophilus_tridecemlineatus|11837 EPITSGDAFVESYSISSDIGKVRQRMGYCPQFDALLDHMTGREMLVMYARLRGIPEHLID
Otolemur_garnettii|5913             DSITSGDAFIGGHSISSDIGKVRQRIGYCPQFDALLDHMTGREMLVMYARLRGIPECHIG
Microcebus_murinus|5408             DSITSGDAFVGGHSISSDIGKVRQCIGHCPQFDALLDHMTGREMLVMYARLRGIPERHIG
Oryctolagus_cuniculus|20249         ESITSGDAFVGGHSISSDIGKVRQRIGYCPQFDALLDHMTGREMLVMYARLRGIPERHIG
Ochotona_princeps|11798             ESITAGDAFVGGHSIRSDIGKVRQRIGYCPQFDALLDHMTGREMLVMYARLRGIPERHIG
Mus_musculus|22691                  ETITSGDAFVGGYSISSDIGKVRQRMGYCPQFDALLDHMTGREMLVMYARLRGIPERLIN
Rattus_norvegicus|13279             ETITSGDAFVGGYSISSDIGKVRQRMGYCPQFDALLDHMTGREMLVMYARLRGIPERLID
Cavia_porcellus|12221               ETITSGDAFVGGHSISSDIGKVRQRMGYCPQFDALLDHMTGREMLVMYARLRGIPERLIG
Callithrix_jacchus|12957            ESLTSGDAFVGGHSISSDVGKVRQRIGYCPQFDALLDHMTGREMLVMYARLRGIPERHIG
Gorilla_gorilla|22264               ESLTSGDAFVGGHRISSDVGKVRQWIGYCPQFDALLDHMTGREMLVMYARLRGIPERHIG
Homo_sapiens|73227                  ESLTSGDAFVGGHRISSDVGKVRQRIGYCPQFDALLDHMTGREMLVMYARLRGIPERHIG
Pan_troglodytes|3469                ESLTSGDAFVGGHRISSDVGKVRQRIGYCPQFDALLDHMTGREMLVMYARLRGIPERHIG
                                    :.:*:****: .: : :*: :                                       

Tarsius_syrichta|12704              XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tupaia_belangeri|14995              ------------------------------------------------------------
Dipodomys_ordii|3782                PCVENTLRGLLLEPHANKLVRTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRL
Spermophilus_tridecemlineatus|11837 PCVENTLRG-LLEPHANKLVR-YXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Otolemur_garnettii|5913             ACVENTLRGLLLEPHANKLVKTYSGGNKRKLSTGNAIIGEPAVILLDEPSSDIKTESHSL
Microcebus_murinus|5408             ACVENTLRGLLLEPHANKLVRTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRL
Oryctolagus_cuniculus|20249         ACVENTLRGLLLEPHANKLVRTYSGGNKRKLSTGIALLGEPAVIFLDEPSTGMDPVARRL
Ochotona_princeps|11798             TCVENTLRGLLLEPHADKLVRTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRL
Mus_musculus|22691                  ACVENTLRGLLLEPHANKLVKTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRL
Rattus_norvegicus|13279             ACVENTLRGLLLEPHANKLVKTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRL
Cavia_porcellus|12221               ACVENTLRGLLLEPHANKLVRSYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRL
Callithrix_jacchus|12957            ACVENTLRGLLLEPHANKLVRTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRL
Gorilla_gorilla|22264               ACVENTLRGLLLEPHANKLVRTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRL
Homo_sapiens|73227                  ACVENTLRGLLLEPHANKLVRTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRL
Pan_troglodytes|3469                ACVENTLRGLLLEPHANKLVRTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRL
                                                                                                

Tarsius_syrichta|12704              XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tupaia_belangeri|14995              ------------------------------------------------------------
Dipodomys_ordii|3782                LWDTVARARESGKAIVITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLQ
Spermophilus_tridecemlineatus|11837 XXXXXXXXXXXXXXXXXXXXXMEECEALCTRLAIVVQGQFKCLGSPQHLKSKFGSGYSLR
Otolemur_garnettii|5913             CRETEARYLQTGISIVITSYXXXXXXXXXXXXXXXXXXXXXXXXSPQHLKSKFGSGYSLR
Microcebus_murinus|5408             LWDTVARARESGKAIVITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLR
Oryctolagus_cuniculus|20249         LWDTVARARESGKAVVITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLQ
Ochotona_princeps|11798             LWDTVARARESGKAVIITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLQ
Mus_musculus|22691                  LWDTVARARESGKAIVITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLQ
Rattus_norvegicus|13279             LWDTVARARESGKAIVITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLQ
Cavia_porcellus|12221               LWDTVARARESGKAIVITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLQ
Callithrix_jacchus|12957            LWNAVARARESGKTIVITSHGMEECEALCTRLVIMVQGQFKCLGSPQHLKSKFGSSYSLR
Gorilla_gorilla|22264               LWDTVARARESGKAIVITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLR
Homo_sapiens|73227                  LWDTVARARESGKAIIITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLR
Pan_troglodytes|3469                LWDTVARARESGKAIVITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLR
                                                                                                

Tarsius_syrichta|12704              XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSW-KAFSILERAKEK
Tupaia_belangeri|14995              ------------------------------------------------------------
Dipodomys_ordii|3782                AKVHSEGQQEALEEFKAFVDLTFPGSVLEDEHQGMVHYHLPGQDLSWAKVFGILEKAKEK
Spermophilus_tridecemlineatus|11837 AKVRSEGQQEALEEFKAFVDLTFPGFVLEDEHQGMVHYHLPGGNLSWAKVFGILEKAKEK
Otolemur_garnettii|5913             AKVRNEGQQEALEEFKAFVDLTFPGVVLEDEHQGMVHYHLPGYDLSWAKVFGILEKAKEK
Microcebus_murinus|5408             AKVRSEGQQEALQEFKAFVDLTFSGVVLEDEHQGMVHYHLPGRDLSWAKVFGILEKAKEK
Oryctolagus_cuniculus|20249         AKVRSRGQQEALRDFKAFVDLTFPGSVLEDEHQGMVHYHLPGHDLSWAKVFGTLEKAKEK
Ochotona_princeps|11798             AKVRSKGQQEALEAFKAFVELTFPGSILEDEHQGMVHYHLPSHGLGWAKVFGILEKAKEK
Mus_musculus|22691                  AKVRSEGKQDALEEFKAFVDLTFPGSILEDEHQDMVHYHLPGCDLSWAKVFGILEKAKEK
Rattus_norvegicus|13279             AKVRSEGKQEVLEEFKAFVDLTFPGSVLEDEHQDMVHYHLPGCDLSWAKVFGILEKAKEK
Cavia_porcellus|12221               AKVQSEGQQEALKKFKAFVDLTFPGSVLEDEHQGMVHYHLPGHNLSWAKVFGILEKAKEK
Callithrix_jacchus|12957            AKVRSEGQQEALEEFKAFVDLTFPGSVLEDEHQGMVHYHLPGQNLSWAKVFGILEKAKEK
Gorilla_gorilla|22264               AKVQGEGQQEALEEFKAFVDLTFPGNVLEDEHQGMVHYHLPGRDLSWAKVFGILEKAKEK
Homo_sapiens|73227                  AKVQSEGQQEALEEFKAFVDLTFPGSVLEDEHQGMVHYHLPGRDLSWAKVFGILEKAKEK
Pan_troglodytes|3469                AKVQSEGQQEALEEFKAFVDLTFPGSVLEDEHQGMVHYHLPGRDLSWAKVFGILEKAKEK
                                                                                                

Tarsius_syrichta|12704              FSVDDYSVSQISLEQVFLGFAHLQPPTVDEGR
Tupaia_belangeri|14995              --------------------------------
Dipodomys_ordii|3782                YGVDDYSVSQISLEQVFLSFAHLQPPTVEEGR
Spermophilus_tridecemlineatus|11837 YGVDDYSVSQISLEQVFLSFAHLQPPTAEEGR
Otolemur_garnettii|5913             YGVDDYSVSQISLEQVFLGFAHLQPPTVEEGQ
Microcebus_murinus|5408             YGVDDYSVSQISLEQVFLSFAHLQPLAAEDSR
Oryctolagus_cuniculus|20249         YGVDDYSVSQISLEQVFLSFAHLQPPTSEEGR
Ochotona_princeps|11798             YGVDDYSVSQISLEQVFLSFAHLQPPTSEEGR
Mus_musculus|22691                  YGVDDYSVSQISLEQVFLSFAHLQPPTTEDGR
Rattus_norvegicus|13279             YGVDDYSVSQISLEQVFLSFAHLQPPTTEDGR
Cavia_porcellus|12221               YGVDDYSVSQISLEQVFLSFAHLQPPTAEEGR
Callithrix_jacchus|12957            YSVDDYSVSQISLEQVFLSFAHLQPSATEEGR
Gorilla_gorilla|22264               YGVDDYSVSQISLEQVFLSFAHLQPPTAEEGR
Homo_sapiens|73227                  YGVDDYSVSQISLEQVFLSFAHLQPPTAEEGR
Pan_troglodytes|3469                YGVDDYSVSQISLEQVFLSFAHLQPPTAEEGR