Orthologs Set ID: EOG4003GC


Orthology Database
OrthoDB4
Gene Symbol(s)
COBLL1

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 24298 67, 153, 347, 549, 778, 876, 1113, 1270, 1351, 1506, 1715, 1816, 3606, 3786
Cavia porcellus 12650 347, 549, 778, 876, 1113, 1270, 1351, 1480, 1715, 1816, 3606, 3786
Dipodomys ordii 434 347, 549, 778, 876, 1113, 1270, 1351, 1480, 1715, 1816, 1902, 1929, 1995, 2004, 2046, 2956, 2961, 3100, 3606, 3786
Gorilla gorilla 17687 67, 158, 347, 549, 778, 876, 1113, 1270, 1351, 1480, 1715, 1816, 3606, 3786
Homo sapiens 47954 158, 347, 549, 778, 876, 1113, 1270, 1480, 1715, 1813, 3606, 3786
Microcebus murinus 1583 549, 778, 876, 1113, 1270, 1351, 1480, 1715, 1816, 1830, 3606, 3786
Mus musculus 22105 158, 347, 549, 778, 876, 1113, 1276, 1351, 1480, 1715, 1813, 3606, 3786
Ochotona princeps 11485 9, 41, 54, 155, 158, 347, 549, 778, 876, 1113, 1270, 1351, 1480, 1715, 1816, 2904, 2938, 3459, 3468, 3487, 3531, 3606, 3786
Otolemur garnettii 3416 347, 549, 778, 876, 1113, 1270, 1351, 1480, 1677, 1816, 2054, 2214, 2660, 2667, 3606, 3786
Pan troglodytes 24569 67, 158, 347, 549, 778, 876, 1113, 1270, 1351, 1480, 1715, 1816, 3606, 3786
Rattus norvegicus 21893 347, 549, 778, 876, 1113, 1276, 1351, 1360, 1480, 1715, 1813, 3222, 3606, 3786
Spermophilus tridecemlineatus 3286 137, 144, 158, 347, 549, 778, 876, 1113, 1270, 1351, 1480, 1715, 1816, 3606, 3786
Tarsius syrichta 8004 267, 347, 348, 489, 528, 549, 778, 876, 1113, 1270, 1351, 1480, 1694, 1819, 1827, 3606, 3786
Tupaia belangeri 12172 153, 347, 549, 778, 876, 1113, 1270, 1351, 1486, 1721, 1816, 3606, 3786

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 24298 ENSCJAT00000056470 100397637 ENSCJAG00000006065 COBLL1 calJac3
Cavia porcellus 12650 ENSCPOT00000011925 100718068 ENSCPOG00000011810 COBLL1 cavPor3
Dipodomys ordii 434 ENSDORT00000008623 ENSDORG00000008623 Cobll1 dipOrd1
Gorilla gorilla 17687 ENSGGOT00000009151 101145383 ENSGGOG00000009104 COBLL1 gorGor3
Homo sapiens 47954 ENST00000375458 22837 ENSG00000082438 COBLL1 hg19,GRCh37
Microcebus murinus 1583 ENSMICT00000001481 ENSMICG00000001479 COBLL1 micMur1
Mus musculus 22105 ENSMUST00000112431 319876 ENSMUSG00000034903 mm9
Ochotona princeps 11485 ENSOPRT00000012462 ENSOPRG00000012455 COBLL1 OchPri2.0
Otolemur garnettii 3416 ENSOGAT00000003306 ENSOGAG00000003301 COBLL1 otoGar1
Pan troglodytes 24569 ENSPTRT00000062243 459696 ENSPTRG00000012588 COBLL1 panTro2
Rattus norvegicus 21893 ENSRNOT00000001606 ENSRNOG00000027016 F1M124_RAT rn4
Spermophilus tridecemlineatus 3286 ENSSTOT00000003286 101975633 ENSSTOG00000003276 Cobll1 speTri1
Tarsius syrichta 8004 ENSTSYT00000004566 ENSTSYG00000004565 COBLL1 tarSyr1
Tupaia belangeri 12172 ENSTBET00000012173 ENSTBEG00000012167 COBLL1 tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 16511 ENSCJAP00000045437 100397637 ENSCJAG00000006065 COBLL1 calJac3
Cavia porcellus 9905 ENSCPOP00000010623 100718068 ENSCPOG00000011810 COBLL1 cavPor3
Dipodomys ordii 406 ENSDORP00000008094 ENSDORG00000008623 Cobll1 dipOrd1
Gorilla gorilla 14125 ENSGGOP00000008905 101145383 ENSGGOG00000009104 COBLL1 gorGor3
Homo sapiens 389 ENSP00000364607 22837 ENSG00000082438 COBLL1 hg19,GRCh37
Microcebus murinus 1349 ENSMICP00000001351 ENSMICG00000001479 COBLL1 micMur1
Mus musculus 2394 ENSMUSP00000108050 319876 ENSMUSG00000034903 mm9
Ochotona princeps 10018 ENSOPRP00000011377 ENSOPRG00000012455 COBLL1 OchPri2.0
Otolemur garnettii 2945 ENSOGAP00000002948 ENSOGAG00000003301 COBLL1 otoGar1
Pan troglodytes 8774 ENSPTRP00000054798 459696 ENSPTRG00000012588 COBLL1 panTro2
Rattus norvegicus 11886 ENSRNOP00000001606 ENSRNOG00000027016 F1M124_RAT rn4
Spermophilus tridecemlineatus 2930 ENSSTOP00000002937 101975633 ENSSTOG00000003276 Cobll1 speTri1
Tarsius syrichta 7329 ENSTSYP00000004188 ENSTSYG00000004565 COBLL1 tarSyr1
Tupaia belangeri 10540 ENSTBEP00000010541 ENSTBEG00000012167 COBLL1 tupBel1

multiple sequence alignment in CLUSTALW format


Spermophilus_tridecemlineatus|3286 ------------------------------------------------------------
Otolemur_garnettii|3416            ------------------------------------------------------------
Ochotona_princeps|11485            CGCCCAACCTCGTTTCCGGCCCTGGAAGGCCAGGCGGCCCGCCCTGACCTCCCGTTTCCT
Tupaia_belangeri|12172             ------------------------------------------------------------
Mus_musculus|22105                 ------------------------------------------------------------
Rattus_norvegicus|21893            ------------------------------------------------------------
Dipodomys_ordii|434                ------------------------------------------------------------
Cavia_porcellus|12650              ------------------------------------------------------------
Microcebus_murinus|1583            ------------------------------------------------------------
Tarsius_syrichta|8004              ------------------------------------------------------------
Callithrix_jacchus|24298           ---------AACCGTGCGGCAGAGGCGGCGGCGAGCTCCCGGACTCCCGGCAGGGAAATG
Homo_sapiens|47954                 ------------------------------------------------------------
Gorilla_gorilla|17687              ---ATGTGCGGCCGTGCTGCAGAGGCGGCGGCGAGCTCCCGGACTCCGGGCAGGGAAATG
Pan_troglodytes|24569              ---ATGTGCGGCCGTGCTGCAGAGGCGGCGGCGAGCTCCCGGACTCCGGGCAGGGAAATG
                                                                                               

Spermophilus_tridecemlineatus|3286 ---------------------------------------------------------ATG
Otolemur_garnettii|3416            ------------------------------------------------------------
Ochotona_princeps|11485            ACCCCAGCAGTGACGCGCCGCTTCCGAGCTGGAGCCCGCGCAGAGCCGCGCAGGGCGATG
Tupaia_belangeri|12172             ---------------------------------------------------------ATG
Mus_musculus|22105                 ---------------------ATGGACCGCAGCGTCCCGGATCCCCTACCCCGCAGCGCG
Rattus_norvegicus|21893            ------------------------------------------------------------
Dipodomys_ordii|434                ------------------------------------------------------------
Cavia_porcellus|12650              ------------------------------------------------------------
Microcebus_murinus|1583            ------------------------------------------------------------
Tarsius_syrichta|8004              ------------------------------------------------------------
Callithrix_jacchus|24298           GGGCAGGCAGTGACGCGCCGTCTCGGAGCTGGAGCCCGCGCAACGCCCCGCAGGGCTATG
Homo_sapiens|47954                 ---------------------------------------------------------ATG
Gorilla_gorilla|17687              GGGCAGGCAGTGACGCGCCGCCTGGGAGCTGGAGCCCGCGCAGCGCCCCGCAGGGCGATG
Pan_troglodytes|24569              GGGCAGGCAGTGACGCGCCGCCTGGGAGCTGGAGCCCGCGCAGCGCCCCGCAGGGCGATG
                                                                                               

Spermophilus_tridecemlineatus|3286 GACAGCCAACCCCCGTGCCCGCGGGCCGCCCCCGCTGGNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|3416            ---------------------------------------AGAAAGCCGAAAGCCAAGGCA
Ochotona_princeps|11485            GACGGCCGAGCCTCCAGCGCGCACGACGCCCGGGCAGGGAGGAAACCAAAAGCAAAGGCA
Tupaia_belangeri|12172             GACTGCCGAACCCCGAGCGTGCAGGACGCCCCG------AGAAAACCAAAAGGCAAGGCA
Mus_musculus|22105                 CCCCGCACCCCCGCCATGCAGCCCGCGGGCTCCGCAGGCAGGAAAACAAAAGGGAAGGCG
Rattus_norvegicus|21893            ---------------------------------------AGGAAAACAAAAGCGAAGGCA
Dipodomys_ordii|434                ---------------------------------------AGAAAACCAAAAGCCAGGGCA
Cavia_porcellus|12650              ------------------------------------AGGAGAAAAACAAAAGCCAAGGCA
Microcebus_murinus|1583            ------------------------------------------------------------
Tarsius_syrichta|8004              ---------------------------------------AGAAAGCCAAAAGCCAAGGCG
Callithrix_jacchus|24298           GACGGCCGAACCCCGCACTCGCAGGACGCCCAGTTTAGGAGAAAACCAAAAGCCAAGGCA
Homo_sapiens|47954                 GACGGCCGAACCCCGCGCCCGCAGGACGCCCCAGCCAGGAGAAAACCAAAAGCCAAGGCA
Gorilla_gorilla|17687              GACGGCCGAACCCCGCGCCCGCAGGACGCCCCAGCCAGGAGAAAACCAAAAGCCAAGGCA
Pan_troglodytes|24569              GACGGCCGAACCCCGCGCCCGCAGGACGTCCCAGCCGGGAGAAAACCAAAAGCCAAGGCA
                                                                                               

Spermophilus_tridecemlineatus|3286 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|3416            CCCCTTCCTCCAGCTGAGACCAAACACGTTGATGTCTCTTCAGTTTCTAATTCTGAAGAA
Ochotona_princeps|11485            CCACTCCCACCAACTGACACTAAGAATGTTGACGTCTCTTCAACTGAGGATTCTGTAGAG
Tupaia_belangeri|12172             CCGCTTCCTCCAGCCGAGACCAAAAGTGTTGATGTCTCTGCAGTTGATGAGTCTGTAGAA
Mus_musculus|22105                 CCTCTTCCTCCGGCCGAGACGAAGGGCACTGATGTCTCTTCTGCTGAAGACCCTGTAGAA
Rattus_norvegicus|21893            CCTCTCCCCCCTGCTGAGATGAAGGGCATGGATGTCTCTTCGGCTGAGGATCCTGTAGAA
Dipodomys_ordii|434                CCGCTTCCTCCTTGTGAGACCAAATGTGTTGACGTCTCTTCAGCTGATGGATCTGCAAAG
Cavia_porcellus|12650              CCACTTCCTCCAGCTGAGACAAAATATGTGGACGCCTCTTCATTTGATGATTCTGTAGAA
Microcebus_murinus|1583            ------------------------------------------------------------
Tarsius_syrichta|8004              CCACTTCCTCCAGCTGAGATCAAATACGCTGATTTCGCTTCAGTTCCTGATTCTGTAGAA
Callithrix_jacchus|24298           CCCCTTCCTCCAGCTGAGACCAAATACGTTGATGTCTCTTCAGCTGCTGATTCTGTAGAA
Homo_sapiens|47954                 CCACTTCCTCCAGCTGAGACCAAATATACTGATGTCTCTTCAGCTGCTGATTCTGTAGAA
Gorilla_gorilla|17687              CCACTTCCTCCAGCTGAGACCAAATACACTGATGTCTCTTCAGCTGCTGATTCTGTAGAA
Pan_troglodytes|24569              CCACTTCCTCCAGCTGAGACCAAATACACTGATGTCTCTTCAGCTGCTGATTCTGTAGAA
                                                                                               

Spermophilus_tridecemlineatus|3286 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|3416            TCCGCTGCTTTCAACATGGAACAGAAAGAAAACACAATAGATAAAGACATTGAACTCTCA
Ochotona_princeps|11485            TCGGCTTCTTTCATCATGGAACAGAAAGAAAACATGATAGACCGAGACATTGAACTCTCA
Tupaia_belangeri|12172             TCCACTCCTTTCAGCATGGAACAGAAAGAAAACATGATAGAGAGAGACATTGAGCTCTCG
Mus_musculus|22105                 TCTACTGCTGTCGTCACAGAGCAACAAGACAATATGATAGATAAAGATATTGAGCTCTCA
Rattus_norvegicus|21893            TCTATTCCTGTCTCCACAGAGCAACATGACAATATGATAGATAAAGACATCGAACTCTCG
Dipodomys_ordii|434                CCCACC---------ATGGAACAGAAGGAAAACAGGACTGATAAAGACATTGAACTCTCC
Cavia_porcellus|12650              TCTGCTGCTTTCATTATGGAACAGAAAGAAAACATAATAGATAAAGACATTGACCTTACA
Microcebus_murinus|1583            ------------------------------------------------------------
Tarsius_syrichta|8004              TCCACTGCTTTCAGCATGGAACAAAAA---AACATGATAGACCGAGACATTGAATTCTCG
Callithrix_jacchus|24298           TCCACCACTTTCATCATGGAACAGAAGGAAAACATGATAGATAAAGACATTGAACTCTCA
Homo_sapiens|47954                 TCCACTGCTTTCATCATGGAACAGAAAGAAAACATGATAGATAAAGACGTTGAACTCTCA
Gorilla_gorilla|17687              TCCACTGCTTTCATCATGGAACAGAAAGAAAACATGATAGATAAAGACGTTGAACTCTCA
Pan_troglodytes|24569              TCCACTGCTTTCATCATGGAACAGAAAGAAAACATGATAGATAAAGACGTTGAACTCTCA
                                                                                               

Spermophilus_tridecemlineatus|3286 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|3416            GTGGTTCTCCCTGGGGATGTTATCAAATCTACTACTGTTCCTGGCAGCAAACCTATGATG
Ochotona_princeps|11485            GTGGTTCTTCCTGGGGATATCATCAAATCTACTACTGTTCATGGCAGTAAGCCTATGATG
Tupaia_belangeri|12172             GTGGTTCTACCTGGGGATGTTATCAAATCCACTACTGTTCATGGCAGTAAACCTATGATG
Mus_musculus|22105                 GTGGTCCTGCCGGGAGATATCCTCAAGTCTACTACTGTTCATGGCAGTAAGCCAATGATG
Rattus_norvegicus|21893            GTGGTCCTGCCTGGAGATGTTCTCAAATCTACTACAGTTCATGGCAGTAAGCCCATGATG
Dipodomys_ordii|434                GTGGTTCTGCCTGGGGATATTATCAAATCGACTACAGTCCACGGAAGNNNNNNNNNNNNN
Cavia_porcellus|12650              GTGGTTTTACCTGGGGATATCATCAAATCTACTACTGTTCATGGCAGTAAGCCTATGATG
Microcebus_murinus|1583            ------------------------------------------------------------
Tarsius_syrichta|8004              GTGGTTTTACCTGGAGATGTTATCAAATCTACTACTGTTCATGGCAGT---CCTATGATG
Callithrix_jacchus|24298           GTGGTTCTACCTGGGGATATTATCAAATCTACTACTGTTCATGGCAGTAAACCTATGATG
Homo_sapiens|47954                 GTGGTCCTACCTGGGGATATTATCAAATCTACTACTGTTCATGGCAGTAAACCTATGATG
Gorilla_gorilla|17687              GTGGTCCTACCTGGGGATATTATCAAATCTACTACTGTTCATGGCAGTAAACCTATGATG
Pan_troglodytes|24569              GTGGTCCTACCTGGGGATATTATCAAATCTACTACTGTTCATGGCAGTAAACCTATGATG
                                                                                               

Spermophilus_tridecemlineatus|3286 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|3416            GACTTGTTGATATTCCTCTGTGCACAGTATCACTTGAATCCATCAAGTTACACAATTGAT
Ochotona_princeps|11485            GACTTGTTGATATTCCTCTGTGCACAGTATCACTTAAATCCATCAAGTTACACAATTGAT
Tupaia_belangeri|12172             GACTTGTTGATATTCCTCTGTGCACAGTATCATTTAAATCCATCAAGTTACACAATTGAT
Mus_musculus|22105                 GACTTGCTCGTGTTCCTCTGTGCTCAGTATCACTTAAATCCGTCAAGTCACACAATTGAT
Rattus_norvegicus|21893            GACTTGCTGGTGTTCCTCTGTGCACAGTATCACTTAAACCCATCAAGTCACACAATCAAC
Dipodomys_ordii|434                NNNNNNNNNNNNNNNNNNNNTGCACAGTATCACTTAAATCCTTCCAGCTACACAATCGAT
Cavia_porcellus|12650              GACTTGCTGATATTCCTGTGTGCACAGTATCACTTAAATCCATCAAGCTACACAATTGAT
Microcebus_murinus|1583            ---------------------------TATCACTTAAATCCATCAAGTTACACAATTGAT
Tarsius_syrichta|8004              GACTTGTTGATATTCCTCTGTGCACAGTATCACTTGAATCCATCAAGTTACACAATTGAT
Callithrix_jacchus|24298           GACTTGTTGATATTCCTTTGTGCGCAGTATCACTTAAATCCATCAAGTTACACAATTGAT
Homo_sapiens|47954                 GACTTGTTGATATTCCTTTGTGCACAGTATCACTTAAATCCATCAAGTTACACAATCGAT
Gorilla_gorilla|17687              GACTTGTTGATATTCCTTTGTGCACAGTATCACTTAAATCCATCAAGTTACACAATCGAT
Pan_troglodytes|24569              GACTTGTTGATATTCCTTTGTGCACAGTATCACTTAAATCCATCAAGTTACACAATCGAT
                                                              . .   ..       .   .        .    

Spermophilus_tridecemlineatus|3286 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|3416            CTGCTGTCAGCTGAAAAGAACCACATTAAGTTTAAGCCAAACACACCAATAGGAATGTTG
Ochotona_princeps|11485            CTGCTCTCAGCTGAAAAGAATCCCATTAAATTTAAGCCAAACACACCAATAGGAATGTTG
Tupaia_belangeri|12172             CTACTGTCAGCTGAAAAGAACCATGTCAAATTTAAGCCAAACACACCAATAGGAATGTTG
Mus_musculus|22105                 TTGCTCTCTGCTGAAGAGAACCTTATCAAATTTAAGCCAAACACACCAATAGGAATGCTG
Rattus_norvegicus|21893            TTGCTGTCTGCTGAAGAGAATCTCATCAAATTTAAGCCAAACACACCAATAGGAATGCTG
Dipodomys_ordii|434                CTGCTGTCGGCTGACCAGAATCACATTAAATTTAAGCCAAACACACCAATAGGAATATTG
Cavia_porcellus|12650              CTGCTGTCAGCTGAGAAGAATAACATTAAATTTAAGCCAAATACACCTATAGGAATGTTG
Microcebus_murinus|1583            CTGCTGTCAGCCGAAAAGAACCACATTAAATTTAAGCCAAATACACCAATAGGAATGTTG
Tarsius_syrichta|8004              CTGCTATCCGCTGAAAAGAGACACATTAAATTTAAGCCAAATACACCAATAGGAATGTTG
Callithrix_jacchus|24298           CTGTTGTCAGCTGAACAGAATCACATTAAATTTAAGCCAAACACACCAATAGGAATGTTG
Homo_sapiens|47954                 CTGTTGTCAGCTGAACAGAACCACATTAAATTTAAGCCAAACACACCAATAGGAATGTTG
Gorilla_gorilla|17687              CTGTTGTCAGCTGAACAGAACCACATTAAATTTAAGCCAAACACACCAATAGGAATGTTG
Pan_troglodytes|24569              CTGTTGTCAGCTGAACAGAACCACATTAAATTTAAGCCAAACACACCAATAGGAATGTTG
                                    .  . .  .  .    .       .    ...  .             . ..  .  ..

Spermophilus_tridecemlineatus|3286 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|3416            GAGGTAGAGAAGGTAATTTTAAAGCCAAAATTGTTGGATAAGAAAAAACCGACACCTATA
Ochotona_princeps|11485            GAGGCAGAAAAGGTGGTTTTAAAGCCAAAAGTTTTGGATAGGAAGAAACCTACACCTATA
Tupaia_belangeri|12172             GAGGTAGAGAAGGTCATTTTAAAGCCAAAAAATGTGGATAAGAAAAAACCTACACCAATA
Mus_musculus|22105                 GATGTAGAGAAGGTAATTTTAAAGCCAAAATCTCTGGATAAGAAAAAGCCTACACCTATA
Rattus_norvegicus|21893            GAGGTAGAAAAGGTCATTTTAAAGCCGAAATCTCTGGATAAGAAAAAACCTACACCTATA
Dipodomys_ordii|434                GAAGTAGAGAAGGTCATTTTAAAGCCAAAAAATTTGGATAAGAAGAAGCCCACACCTCTA
Cavia_porcellus|12650              GATGTAGAGAAAGTGATTTTAAAGCCAAAAAATTTGGATAAGAAAAAACCTACACCTATA
Microcebus_murinus|1583            GAGGTAGAAAAGGTGATTTTAAAGCCAAAAATTTTGGATAAGAAAAAACCTACACCTATA
Tarsius_syrichta|8004              GAGGTAGAGAAGGTAATTTTAAAACCAAAAATATTGGATAAGAAAAAACCCACACCAATA
Callithrix_jacchus|24298           GAAGTAGAGAAGGTAATTTTAAAGCCAAAAATGTTGGATAAGAGAAAACCTACACCTATA
Homo_sapiens|47954                 GAGGTAGAGAAGGTAATTTTAAAGCCAAAAATGTTGGATAAGAAAAAACCTACACCTATA
Gorilla_gorilla|17687              GAGGTAGAGAAGGTAATTTTAAAGCCAAAAATGTTGGATAAGAAAAAACCTACACCTATA
Pan_troglodytes|24569              GAGGTAGAGAAGGTAATTTTAAAGCCGAAAATGTTGGATAAGAAAAAACCTACACCTATA
                                   .  .  .     ..  ....              ... .  .                . 

Spermophilus_tridecemlineatus|3286 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|3416            ATACCAGAGAAAACTGTGAGGGTAGTGATCAATTTTAAGAAAACCCAGAAGACTATAGTG
Ochotona_princeps|11485            ATACCAGAGAAAACTGTGAGAGTAGTCATCAATTTTAAAAAATCCCAGAAGGCAATAGTG
Tupaia_belangeri|12172             ATACCAGAGAAAACTGTCAGAGTAGTAATCAATTTTAAGAAAACACAGAAGGCCATAGTG
Mus_musculus|22105                 ATCCCAGAGAAAACTGTGAGAGTAGTGATCAACTTTAAGAAAACACAGAAGACCATAGTG
Rattus_norvegicus|21893            ATCCCAGAGAAAACTGTGAGAGTAGTGATCAATTTTAAGAAGACACAGAAGACCATAGTG
Dipodomys_ordii|434                ATACCAGAGAAAACTGTGAGGGTAGTGATCAACTTTAAGAAAACACAGAAGACCATAGTG
Cavia_porcellus|12650              ATACCAGAGAAAACTGTGAGAGTAGTGATCAATTTTAAGAAAACACAAAAGGCCATAGTG
Microcebus_murinus|1583            ATACCAGAGAAAACTGTGAGAGTAGTGATCAATTTTAAGAAAACACAGAAGACCATAGTG
Tarsius_syrichta|8004              ATACCAGAGAAAACTGTGAGAGTAGTGATCAATTTTAAGAAAACACAGAAGACCATAGTA
Callithrix_jacchus|24298           ATACCGGAGAAAACTGTAAGAGTAGTGGTTAATTTTAAGAAAACACAGAAGACCATAGTG
Homo_sapiens|47954                 ATACCAGAGAAAACTGTGAGAGTAGTGATTAATTTTAAGAAAACACAGAAGACCATAGTG
Gorilla_gorilla|17687              ATACCAGAGAAAACTGTGAGAGTAGTGATTAATTTTAAGAAAACACAGAAGACCATAGTG
Pan_troglodytes|24569              ATACCAGAGAAAACTGTGAGAGTAGTGATTAATTTTAAGAAAACACAGAAGACCATAGTG
                                    .    . .     ...  . .. ..  .    ...              .    . .. 

Spermophilus_tridecemlineatus|3286 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|3416            AGAGTTAGCCCCCACGCCTCACTTCAAGAACTTGTTCCTACCATATGTAGCAAATGTGAG
Ochotona_princeps|11485            AGAGTGAATCCGCATGCGTCACTTCAGGAACTCACCCCTATCATATGTAGCAAATGTGAC
Tupaia_belangeri|12172             AGAGTCAGTCCACACGCATCACTTCAAGAACTTGCCCCTATTATATGCAGCAAATGTGAG
Mus_musculus|22105                 AGAGTTAGTCCCCACGCACCCCTTCAAGATCTTGCTCCCATCATATGCAGTAAATGTGAG
Rattus_norvegicus|21893            AGAGTTAGTCCCCACTCACCGCTTCAAGACCTTGCTCCCATTATATGCAGTAAATGTGAG
Dipodomys_ordii|434                AGAGTTGGCCCCCACACACCACTTCAAGAACTTCTTCCTATCATATGTGACAAATGTGAG
Cavia_porcellus|12650              AGAGTCAGTCCACATGCATCGCTTCAAGAACTTGTTCCTACGATATGTAGCAAGTGTGAG
Microcebus_murinus|1583            AGAGTTAGTCCACATGCATCACTTGAAGAACTTATTCCTATTATATGTAGCAAATGTGAG
Tarsius_syrichta|8004              AGAGTTAGCCCACATGCATCACTTCAAGAACTTGCTCCTATTATCTGTAGCAAGTGTGAG
Callithrix_jacchus|24298           AGAGTGAGTCCACATGCATCACTTCAAGAGCTTGCCCCTATTATATGTAGCAAATGTGAA
Homo_sapiens|47954                 AGAGTGAGTCCACATGCATCGCTTCAAGAGCTTGCCCCTATTATATGTAGCAAATGTGAG
Gorilla_gorilla|17687              AGAGTGAGTCCACATGCATCGCTTCAAGAGCTTGCCCCTATTATATGTAGCAAATGTGAG
Pan_troglodytes|24569              AGAGTGAGTCCACATGCATCGCTTCAAGAGCTTGCCCCTATTATATGTAGCAAATGTGAG
                                    . ..                 ..   .   .           . ..       ....  

Spermophilus_tridecemlineatus|3286 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|3416            TTTGATCCATTTCATACATTGTTATTAAAGGATTATCAATCTCAGGAGCCCCTGGATTTG
Ochotona_princeps|11485            TTTGATCCATCACACACACTGTTGCTCAAAGATTATCAGTCTCAGGAGCCTCTCGACTTA
Tupaia_belangeri|12172             TTTGATCCGTTACATACACTGTTGTTGAAAGATTATCAATCTCAGGAGCCCCTCGACTTG
Mus_musculus|22105                 TTTGATCCGTTGCATACCGTGCTGTTGAAGGATTACCAGGCTCAGGAGCCCCTCGACTTG
Rattus_norvegicus|21893            TTTGATCCATTGCATACAGTGTTGTTGAAGGATTACCAGGCTCAGGAGCCCCTCGACCTC
Dipodomys_ordii|434                TTTGATCCATTGCATACTCTGTTGTTGAAAGATCATCAATCTCAGGAGCCCCTCGACCTG
Cavia_porcellus|12650              TTTGACCCGTCTCACACCTTGTTGCTGAAAGATTATCAATCTCAGGAACCATTGGATTTG
Microcebus_murinus|1583            TTTGATCCATTACATACACTGTTGTTAAAAGAGTATCAATCTCAGGAGCCTCTGGACTTG
Tarsius_syrichta|8004              TTTGATCCATTACATACACTGTTGCTGAAAGATTACCAATCTCAGGAGCCCCTCGACCTG
Callithrix_jacchus|24298           TTTGATCCATTGCATACTCTATTGTTGAAAGATTATCAATCACAGGAGCCCCTCGACATG
Homo_sapiens|47954                 TTTGATCCGTTGCATACACTATTGTTGAAAGATTATCAATCGCAGGAGCCTCTTGACTTG
Gorilla_gorilla|17687              TTTGATCCGTTGCATACACTATTGTTGAAAGATTATCAATCGCAGGAGCCTCTCGACTTG
Pan_troglodytes|24569              TTTGATCCGTTGCATACACTATTGTTGAAAGATTATCAAACGCAGGAGCCTCTCGACTTG
                                   ....     .         .  .  .    .             ..      . .   . 

Spermophilus_tridecemlineatus|3286 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|3416            ACAAAATCTCTTAATGACCTGGGACTAAGAGAATTATATGCCATGGATGTCAGCAGAGNN
Ochotona_princeps|11485            ACAAAATCTCTTAATGACCTGGGACTAAGAGAATTATATGCCATGGACATCAGCAGAGAG
Tupaia_belangeri|12172             ACAAAATCTCTGAATGACCTGGGACTCAGAGAGTTATATGCCATGGATGCCAATAGAGAA
Mus_musculus|22105                 ACAAAATCTCTTAATGACTTGGGACTAAGAGAGTTATATGCCATGGATATCAGCAGAGAG
Rattus_norvegicus|21893            ACAAAGTCTCTTAATGACCTGGGACTAAGAGAGTTATATGCCATGGATATCAGCAGAGAG
Dipodomys_ordii|434                ACAAAATCTCTTAATGACCTGGGACTCAGAGAATTATATGCCATGGATGTCAGCAGAGAG
Cavia_porcellus|12650              ACGAAGTCTCTTAATGACCTGGGACTGAGAGAATTATATGCCATGGATGTCAGTGGAGAG
Microcebus_murinus|1583            ACAAAATCTCTTAATGACCTGGGATTAAGAGAATTATATGCCATGGATGTCAGCAGAGAG
Tarsius_syrichta|8004              ACAAAATCTCTTAATGACCTGGGACTAAGAGAATTATATGCCATGGATGTCAACAGAGAG
Callithrix_jacchus|24298           ACAAAATCTCTTGATGACCTAGGACTAAGAGAATTATATGCAATGGATGTCAACAGAGAG
Homo_sapiens|47954                 ACAAAATCTCTTAATGACCTGGGACTAAGAGAATTATATGCGATGGATGTCAACAGAGAG
Gorilla_gorilla|17687              ACAAAATCTCTTAATGACCTGGGACTAAGAGAATTATATGCGATGGATGTCAACAGAGAG
Pan_troglodytes|24569              ACAAAATCTCTTAATGACCTGGGACTAAGAGAATTATATGCGATGGATGTCAACAGAGAG
                                         . . .   ..   . ..  .  . .  .. . ..   ...         . .  

Spermophilus_tridecemlineatus|3286 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|3416            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|11485            TCCTGCCAAATACCGCAAAACCTGGACTTCATGAAGGAGAAGGAAAATAAGGGGTTTTTC
Tupaia_belangeri|12172             TCCTGCCAAATATCACAAAACCTAGACATTATGAAGGAGAAAGAAAATAAAGGCTTCTTA
Mus_musculus|22105                 TCCTGCCAAATATCACACAACCCGGACATTGTGAAGGAGAAAGAAAACAAAGGGATTTTC
Rattus_norvegicus|21893            TCCTGCCAAATATCACATAACCCGGACATTGTGAAGGAGAAAGAAAACAAAGGGATTTTC
Dipodomys_ordii|434                TCCTGTCAAATACCGCAAAGCTTAGACATCATGAAGGAAAAAGAAAACAAAGGGTTTTTC
Cavia_porcellus|12650              TCTTCTCAAGTATCACCAAACCTAGATATCATGAAGGAGAAAGAAAGTAAGGGGTTTTTC
Microcebus_murinus|1583            TCCTGCCAAATATCTCCAAACCTAGACATTATGAAGGAGAAAGAAAATAAAGGGTTTTTC
Tarsius_syrichta|8004              TCCTGCCAAATATCACCAAACCTAGACATTATGAAGGAGAAAGAAAATAAAGGGTTTTTC
Callithrix_jacchus|24298           TCCTGCCCAATATCACAAAACCTAGACATTATGAAGGAAAAAGAAAATAAAGGGTTTTTC
Homo_sapiens|47954                 TCCTGCCAAATATCACAAAACCTAGATATTATGAAGGAGAAAGAAAATAAAGGGTTTTTC
Gorilla_gorilla|17687              TCCTGCCAAATATCACAAAACCTAGATATTATGAAGGAGAAAGAAAATAAAGGGTTTTTC
Pan_troglodytes|24569              TCCTGCCAAATATCACAAAACCTAGATATTATGAAGGAGAAAGAAAATAAAGGGTTTTTC
                                   .  .      .             .   .  ..  ..     .        ..  . .. 

Spermophilus_tridecemlineatus|3286 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACTGCAAGTGCTCCTGCAACCCCT
Otolemur_garnettii|3416            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|11485            AGTTTTTTCCAACGCAGTAAGAAGAAACGAGAGCAAACTGCAAGTGCCCCGGCCACCCCT
Tupaia_belangeri|12172             AGCTTTTTTCAACGCAGTAAGAAGAAGCGGGACCAAACTGCAAGTGCACCTGCCACTCCA
Mus_musculus|22105                 AGTTTTTTCCAACGCAGCAAGAAAAAGCGAGAGCAAACTGCCAGTGCTCCTGCGACCCCA
Rattus_norvegicus|21893            AGCTTTTTCCAACGCAGTAAGAAAAAGCGAGAGCAAACTGCCAGCGCTCCTGCGACCCCA
Dipodomys_ordii|434                AGCTTTTTTCAGCGCAGTAAGAAAAAGAGGGAACAAACTGCCAGTGCTCCGGCCACACCA
Cavia_porcellus|12650              AGCTTTTTTCAACGCAGTAAGAAAAAGCGGGAGCAAACTGCGAGTGCTCCTGCAACTCCT
Microcebus_murinus|1583            AGCTTTTTTCAACGCAGTAAGAAAAGGCGAGAGCAAACTGCAAGTGCCCCTGCAACCCCT
Tarsius_syrichta|8004              AGTTTTTTTCAACGCAGTAAGAAAAAGCGGGACCAAACTGCAAGTGCCCCTGCAACCCCT
Callithrix_jacchus|24298           AGTTTTTTTCAACGCAGTAAGAAAAAGCGGGACCAAACTGCAAGTGCACCTGCAACCCCT
Homo_sapiens|47954                 AGTTTTTTTCAACGCAGTAAGAAAAAGCGAGACCAAACTGCAAGTGCCCCTGCAACCCCT
Gorilla_gorilla|17687              AGTTTTTTTCAACGCAGTAAGAAAAAGCGGGACCAAACTGCAAGTGCCCCTGCAACCCCT
Pan_troglodytes|24569              AGTTTTTTTCAACGCAGTAAGAAAAAGCGAGACCAAACTGCAAGTGCCCCTGCAACCCCT
                                    . .....     .  .   .       . .       ..   . .     .        

Spermophilus_tridecemlineatus|3286 CTAATAAATAAGCACCACCCAACTTTTTTGAGGTCCAATGCTATTTCCAAACCACATGTT
Otolemur_garnettii|3416            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|11485            CTGATAAATAAACACCGCCCAACTTTTGCAAGGTCCAACACCATTTCCAAGCCATATATC
Tupaia_belangeri|12172             CTGGTAACCAAGCACCGCCCAACTTTTGTGAGGTCCAACACCATTTCCAAGCCATATATT
Mus_musculus|22105                 CTAGTGAGCAAGCATCGTCCATCTTTCACGAGGTCCAACACCATTTCCAAACCGTACATT
Rattus_norvegicus|21893            CTAGTGAGCAAGCACCGTCCTTCTTTTACGAGGTCCAACACCATTTCCAAACCCTACATT
Dipodomys_ordii|434                CTCATAAATAAGCACCGCCCATCTTTTACGAGGTCCAATACCATTTCTAAACCCTATGTT
Cavia_porcellus|12650              CTAATAAATAAGCACCGCCCAACTTTTGTGAGATCCAATACCCTCTCCAGGCCATATGTG
Microcebus_murinus|1583            CTAATAAATAAGCACCGCCCGACTTTTGTGAGGTCCAATACCGTTTCTAAACCGTATGTT
Tarsius_syrichta|8004              CTAGTAAATAAGCACCGGCCAACTTTTATGAGATCCAATACCATTTCCAAACCATATACT
Callithrix_jacchus|24298           CTAGTAAACAAGCACCGCCCAACTTTTACAAGGTCCAATACCATTTCCAAACCATATATT
Homo_sapiens|47954                 CTAGTAAATAAGCACCGCCCAACTTTTACAAGGTCCAATACCATTTCCAAACCATATATT
Gorilla_gorilla|17687              CTAGTAAATAAGCACCGCCCGACTTTTACAAGGTCCAATACCATTTCCAAACCATATATT
Pan_troglodytes|24569              CTAGTAAATAAGCACCGCCCGACTTTTACAAGGTCCAATACCATTTCCAAACCATATATT
                                    .  .                  ...     . .         . .              

Spermophilus_tridecemlineatus|3286 TCAAACATCCTGCCATCGGATGCACCCAAGAGGAGGTGTGCTCCATTGCCTCCAATGGCA
Otolemur_garnettii|3416            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGCTCCGTTGCCCCCCATGCCA
Ochotona_princeps|11485            TCAAACACACTGCCTTCAGAGGCACCCAAGAAGAGGCGGGCTCCGTTGCCACCAATGCCA
Tupaia_belangeri|12172             TCAAATACACTACCATCAGATGCACCCAAAAAGAGGCGGGCTCCCTTGCCCCCAATGCCA
Mus_musculus|22105                 TCCAATACCCTGCCCTCGGATGCACCCAAGAAGAGACGTGCCCCACTGCCACCGATGCCC
Rattus_norvegicus|21893            TCCAACACGCTGCCCTCTGATGCACCCAAGAAGAGGCGTGCCCCGCTGCCACCCATGCCC
Dipodomys_ordii|434                TCAAACACCCTGCCATCTGATGCACCCAAGAAGAGACGGGCTCCACTGCCTCCCATGCCA
Cavia_porcellus|12650              TCCAACACCCTGCCATCCGATGCACCCAAGAAGAGGCGGGCCCCACTGCCACCCATGCTG
Microcebus_murinus|1583            TCAAACACCCTGCCGTCGGATGCACCCAAGAAGAGGCGGGCTCCGTTGCCTCCAATGCCA
Tarsius_syrichta|8004              TCAAACACCCTGCCATCAGATGCACCCAAGAAGAGGCGGGCTCCATTGCCCCCGATGTCG
Callithrix_jacchus|24298           TCCAACACCCTGCCGTCGGATGCACCCAAGAAGAGGCGGGCTCCATTGCCCCCAATGCCA
Homo_sapiens|47954                 TCCAACACCCTGCCGTCGGATGCACCCAAGAAGAGGCGGGCTCCACTGCCCCCGATGCCA
Gorilla_gorilla|17687              TCCAACACCCTGCCGTCGGATGCACCCAAGAAGAGGCGGGCTCCACTGCCCCCGATGCCA
Pan_troglodytes|24569              TCCAACACCCTGCCGTCGGATGCACCCAAGAAGAGGCGGGCTCCACTGCCCCCGATGCCA
                                   .         .    .  .  .          . .  . ** **  **** ** ***   

Spermophilus_tridecemlineatus|3286 GCATCTCAGAGTGCCCCTCAGGATCTTACAAACGTACAGGAGAGGCCAGCTTCTTGTGTG
Otolemur_garnettii|3416            GCGTCTCAGAGCGTCCCCCAGGACCTTGCACAGGCCCAGGAGAGTCCAGCTTCTTGTGTA
Ochotona_princeps|11485            GCATCTCAGAGCGAGCCACACGATCTGGCACGCATCCAGGAGAGGCCAGCTTCCCACATG
Tupaia_belangeri|12172             GCATCTCAGAGAGTGCCCCAGGACCCTGTGAACATCCAGGAGAGGCCAGCTTCCTGTGTA
Mus_musculus|22105                 ACATCCCAGGGTGCTGCTCAAGGC------------CAGGAGAGACGAGCGTCTTGTGTG
Rattus_norvegicus|21893            ACATCCCAGGGTGCTGCTCAAGGC------------CAGGAGAGGCGCGCTTCTTGTGTG
Dipodomys_ordii|434                ACCTCCCAGAGTGCACCCCAGGACCTGGAACATACCCAGAACAGGCCAACTTCTTGTGTG
Cavia_porcellus|12650              GCATCGCAGATTGCACCACAGGACCTTGAGCAGCCCCAGGAGAGAGCAGGCTCTTCCGTG
Microcebus_murinus|1583            GCGTCCCAGAGCGTACCCCAGGACCTGGCACACATCCAGGAAAGGCCAGCCTCTTGCGTA
Tarsius_syrichta|8004              GCATCTCAGAGCGCCCCCCAGGACCTTGGACGCATTCAGGAGAGGCCAGTTTCTTGTGTG
Callithrix_jacchus|24298           GCATCTCAGAGTGTCCCCCAGGACCTTGCACACATCCAGGAGAGGCCTGCTTCTTGCATA
Homo_sapiens|47954                 GCATCTCAGAGTGTCCCCCAAGACCTTGCACACATCCAGGAGAGGCCTGCTTCTTGTATA
Gorilla_gorilla|17687              GCATCTCAGAGTGTACCCCAAGACCTTGCACACATCCAGGAGAGGCCTGCTTCTTGTATA
Pan_troglodytes|24569              GCATCTCAGAGTGTCCCCCAAGACCTTGCACACATCCAGGAGAGGCCTGCTTCTTGTATA
                                   .* ** ***.  *   * ** *.             ***.* **    .  **    .*.

Spermophilus_tridecemlineatus|3286 CTGAAATCCACAAGTGTGGAGGAGACTGATAAGAGTCCCTGTGAAGCAGGCATGGTGAGA
Otolemur_garnettii|3416            GTGAAATCCATGAGTGTGGATGAAACAGATAAGAGTCCCCGTGGAGCAGGCATGGTGAGA
Ochotona_princeps|11485            GTGAAGTCCACGAGTGTGGATGAAAATGATAAGAGTCCTGGTGGAGCAGACATCATGAGG
Tupaia_belangeri|12172             GTAAAATCCATGAGTGTGGATGAAACAGAAAAGNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|22105                 GAGAGATCCACCAGTGTGGACGACACAGATAAGAGTTCCTCTGAAGCGATCATGGTGAGG
Rattus_norvegicus|21893            GAGAGATCCACCAGTGTGGACGACACGGATAAGAGTTCCTCTGAAGGATTCATGGTGAGG
Dipodomys_ordii|434                ATGAAATCCACAAGCATGGATGAAACAGACAAGAGTCCCCATGAAGCAGTCATAGTGAGG
Cavia_porcellus|12650              GTGAAGTCCACAGGCGTGGAGGAAGCTGATGAGAGTCCCCGTGAAGCAGGTAGAGCGAGG
Microcebus_murinus|1583            GTGAAATCCATGAGCGTGGAAGAAACAGATAAGNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|8004              ATGAAATCCGTGAGTGTGGATGAAACAGATAAGAGTCCTTGTGAAGCAGGCATAGTGAGG
Callithrix_jacchus|24298           GTGAAATCCATGAGCGTTGATGAGACAGATAAGAGTCCCTGTGAAGAAGGCAGAGTGAGG
Homo_sapiens|47954                 GTGAAATCCATGAGCGTGGATGAGACAGATAAGAGTCCCTGTGAAGCAGGAAGAGTGAGG
Gorilla_gorilla|17687              GTGAAATCCATGAGCGTGGATGAGACAGATAAGAGTCCCTGTGAAGCAGGAAGAGTGAGG
Pan_troglodytes|24569              GTGAAATCCATGAGCGTGGATGAGACAGATAAGAGTCCCTGTGAAGCAGGAAGAGTGAGG
                                    :.*..***.  .* .* ** ** .. ** .** ..     ..  .          . . 

Spermophilus_tridecemlineatus|3286 ACAGGCTTACTGCAGCTCAGT---AGCTCCTCCATCGGGACTTCATCTTTGAGGAGAACA
Otolemur_garnettii|3416            ACAGGCTCCTTGCAGCTCAAG---GGCACGTCCACAGCAAATGCGTCTTTGAGAAGGACA
Ochotona_princeps|11485            ACAGGTTCACTCAGT---------AGTACATCCACAGGGAATTCATCTTTGAAAAGGATG
Tupaia_belangeri|12172             NNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|22105                 ACAGGATCACTGCAGCTCAGC---AGCACGTCGATAGGAACTTCATCTCTGAAGAGAACG
Rattus_norvegicus|21893            ACAGGATCACTGCAACTCAGTGGCAGTACATCAGTAGGAACTTCATCTCTTAAGAGAACG
Dipodomys_ordii|434                ACTGGCTCACTGCAGCTCAGC---CACACATCCACAGGGAATTCCTCTTTGAAAAGAACA
Cavia_porcellus|12650              ACGGGCTCACTGCCGCTCTCC---AGCACATCTGAAGGGAATTTATCTCTGAAAAGGACA
Microcebus_murinus|1583            NNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|8004              ACTGGCTCGCTGCCC---------CATAGCAGCACAGGAAATTCATCTTTGAGAAGGACA
Callithrix_jacchus|24298           GCAGGATCACTGCAGCTCAGC---AGCACATCTGCAGGGAATTCATCTTTGAGAAGGACA
Homo_sapiens|47954                 GCAGGTTCACTGCAGCTCAGC---AGCATGTCTGCAGGGAATTCATCTTTGAGAAGGACA
Gorilla_gorilla|17687              GCAGGTTCACTGCAGCTCAGC---AGCACGTCTGCAGGGAATTCATCTTTGAGAAGGACA
Pan_troglodytes|24569              GCAGGTTCATTGCAGCTCAGC---AGCACGTCTGCAGGGAATTCATCTTTGAGAAGGACA
                                      .. .   .                         .    .   . . .     .    

Spermophilus_tridecemlineatus|3286 AAGCGAAAAGCACCTTCCCCACCGTCCAAAACAGCCCAGCATTCAAGTGATGGAAATGGC
Otolemur_garnettii|3416            AAGCGAAAAGCACCTTCCCCACCCTCCAAACTCCCCCTGCATCAGACTGAGGAAGGCAGC
Ochotona_princeps|11485            AAGCGTAAAGCACCTTCCCCTCCCTCCAAAATTCCATCTCACCAGAGTGTCGAGAATAGC
Tupaia_belangeri|12172             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|22105                 AAGCGAAAAGCACCTGCCCCACCTTCGAAAACCCCCCTGGCTCAGACTGATGAAAGGAAC
Rattus_norvegicus|21893            AAGCGAAAAGCACCTGCCCCACCTTCGAAACCCTCCCTGACTGAGACCGATGAAGGGAGC
Dipodomys_ordii|434                AAGCGGAAAGCACCATCTCCACCCTCCAAACTACCCCTGCATCACAGTGATGAAGATGGC
Cavia_porcellus|12650              AAGCGGAAAGCACCTTCCCCACCCACCAAAATACCGCTGCGTCAAAGCACTGAAAATGGC
Microcebus_murinus|1583            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|8004              AAGCGAAAAGCACCTTCCCCACCTTCCAAAATACCCCAGCATCAAAGTGATGAAAATAGT
Callithrix_jacchus|24298           AAGCGAAAAGCACCTTCCCCACCCTCCAAAATATCCCTGCATCAGAGTGATGAAAATAGT
Homo_sapiens|47954                 AAGCGAAAAGCACCTTCCCCACCCTCCAAAATACCCCCGCATCAAAGTGATGAAAATAGT
Gorilla_gorilla|17687              AAGCGAAAAGCACCTTCCCCACCCTCCAAAATACCCCCGCATCAAAGTGATGAAAATAGT
Pan_troglodytes|24569              AAGCGAAAAGCACCTTCCCCACCCTCCAAAATACCCCCGCATCAAAGTGATGAAAATAGT
                                     . .    .                                         .        

Spermophilus_tridecemlineatus|3286 CCAGTGACTGCC------CTGCAGTTAGTAGATGGGATTCCTCCAGACAGTGCTTTGGAA
Otolemur_garnettii|3416            CCTGTGACGGTT------ATGCAGTCAGTAGATGGAATTTCTCCGGACAGTGTCTCAGAA
Ochotona_princeps|11485            CCTGTAACTGTC------CCGCAATCAGAGGATGGAGTTCCTGCAGACAGTGCCTCAGAG
Tupaia_belangeri|12172             NNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|22105                 TCTGCAATGGCTCATGGCCTACCTTTGGAAGATGGGATTGCTCCAGACAGCATGTTGGAA
Rattus_norvegicus|21893            TCTGCGGCTGCTCATGGCCTACCTTTGGAGGATGGGATTGTTCCAGACAGCATTTCAGAA
Dipodomys_ordii|434                CATGTGACTGCT------CCCAAGTCAGTAGATGGAGTTCCTCCACACAGTGTTTTCAAA
Cavia_porcellus|12650              CATCCGACAGTC------CTGCAGGCAGTAGATGGAGTTTCCCCAGACAGCATTTCAGAA
Microcebus_murinus|1583            NNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|8004              CATGTTACTGCT------GTACATTCAGTAGATGGTGCTCCTCCAGAAAGTGTTTCAGAA
Callithrix_jacchus|24298           CATGTATCTGCC------TTACAGCCAGAAGGTGGGGTTCCTTCAGACAGTGTTTCAGAA
Homo_sapiens|47954                 CGTGTGACTGCC------TTACAGCCAGTAGATGGAGTTCCTCCAGACAGTGCTTCAGAA
Gorilla_gorilla|17687              CGTGTGACTGCC------TTACAGCCAGTAGATGGAGTTCCTCCAGACAGTGCTTCAGAA
Pan_troglodytes|24569              CGTGTGACTGCC------TTACAGCCAGTAGATGGAGTTCCTCCAGACAGTGCTTCAGAA
                                            .                 .  . ...   .          .    .     

Spermophilus_tridecemlineatus|3286 ACAAGCTCTCCTGAGGGGCCCTCCAGCCCAGAAGCCTACCTGGGCCCTGGGCTCCTCAGT
Otolemur_garnettii|3416            GCAAACTCCGCTGAGGGGCTCCCCAGCCCAGAAGCCTCCCTTGGCCCTGGGCTACTCAGT
Ochotona_princeps|11485            GCCAGCTCCCCCGAAGCGCTGTCCAGCCCAGGAGCCTCGCTGGGCCCCGCGTCCCCCCAT
Tupaia_belangeri|12172             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|22105                 CTGAGCTCTCCCGAGGGAATGTCCACCCCAGAGGGCTCCCTTGGTCCCGGGTTCCTAAGC
Rattus_norvegicus|21893            GTGAGCTCTCCTGAGGGTATGTCCAGCCCAGAGTGTAGTGAGGGCCCGGGGTTCCTAAGC
Dipodomys_ordii|434                GCAAACTCTCCTGAGCCACTGAACAGCCCAGAAGCCTCCCTTGGCAGTGGGCTCCTCAGT
Cavia_porcellus|12650              GCAACCTCTCCTGAGGGCCTCCCCAGCCCAGAAGGCTGTCTTGGCCCTGGGCTCTTCCAT
Microcebus_murinus|1583            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAGCCTCCCTTGGTCCTGGGCTCGTCAGT
Tarsius_syrichta|8004              CCAAAATCTCCTGAGGGGCTATCCAGTACAGAATCCTCCCCTAACCCTCAGCTCCCAAGG
Callithrix_jacchus|24298           GCAAACTCTCCTGTGGAGCTATCCAGCCCAGAAACCTCCTTTGGCCCTGGGCTCTCCAGT
Homo_sapiens|47954                 GCAAACTCTCCTGAGGAGCTATCCAGCCCA------------------------------
Gorilla_gorilla|17687              GCAAACTCTCCTGAGGAGCTATCCAGCCCAGAA---ACCTTTCACCCTGGGCTTTCCAGT
Pan_troglodytes|24569              GCAAACTCTCCTGAGGAGCTATCCAGCCCAGAA---ACCTTTCACCCTGGGCATTCCAGT
                                         .     .                                               

Spermophilus_tridecemlineatus|3286 CATGAACACAGCACGGTTCCCAAACTGACAGATGAAGCCTCTCTCTCTGAGGGCCCTGGA
Otolemur_garnettii|3416            GAAGAAGAATGCGTTACCCGCAAAGTGACAGAGGAAAGCTCTTTCTCTGAGGGTTCTGGA
Ochotona_princeps|11485            CAGGAGCAGTGCACCACACCCACACTGCTGGAGGAGCCCACCCTCTCGGAGGGCCCTGGA
Tupaia_belangeri|12172             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|22105                 CAGGAGCAGTGTGCTGTGCCCAAGCCGCCGGATGAA------ATCTCTGAGGGCCCTGGA
Rattus_norvegicus|21893            CAGGAAGAGTGCTCTGTGCCCAAGCCAATGGATGAA------ATCTCTGAGGGCCCTGGA
Dipodomys_ordii|434                CATGAACACTGTACTCTGCCCAAACTGACAGATGAAACCTCTCTCTCTGAGAGTCCAGGA
Cavia_porcellus|12650              CAGGAACGGTGCACTACGCCCAAACTGCCTGACGAATCTTCTCTCTCTGAGGGCCCTGGA
Microcebus_murinus|1583            CATGAAGAGTGCACTGCCCCCAACCTGACGGAGGAAACCCCT------GAGTGCCCTGGA
Tarsius_syrichta|8004              CAGGAGCAGTACACTGTGTCCAAAGTGACAGAGGAATCCTCTTTCTCAGAGAGCCCCGGA
Callithrix_jacchus|24298           CAGGAGCAGTGCACTGCGTCCAACCTGATGGAGGAAACCTCTGTCTTTGAGTGCCCTGGA
Homo_sapiens|47954                 ------------------------------------------------------------
Gorilla_gorilla|17687              CAGGAGCAGTGCACTGCGCCCAAACTGATGGAGGAAACCTCTGTCTTTGAGTGCCCTGGG
Pan_troglodytes|24569              CAGGAGCAGTGCACTGCGCCCAAACTGATGGAGGAAACCTCTGTCTTTGAGTGCCCTGGG
                                                                                               

Spermophilus_tridecemlineatus|3286 ACGCCTGAGGCAGCC---------ATAGCATCATTGACATCTGGAATAAGCTCTGATTAT
Otolemur_garnettii|3416            ACACCTGAGGCGGCA---------GTAGCATCAGTGACATCTAGAATAAATTCTGACTAT
Ochotona_princeps|11485            ACACCCGAGGCAGCTGTGCCCTCGGTAGCATCATTGACCTCTGGAATAAGCTCTGATTAT
Tupaia_belangeri|12172             NNNNNN------------------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|22105                 ACTCCAGAGGCAGCT---------GTAGCATCCTTGACCTCTGGTGTAAGCTCTGATTAC
Rattus_norvegicus|21893            ACTCCAGAGGCAGCT---------GTAGCTTCCATGACCTCTGGCGTAAGCTCGGATTAC
Dipodomys_ordii|434                ACACCTGAGGGAGCG---------GTGGCATCTTTAACATCTGGAATAAGCTCTGATTAT
Cavia_porcellus|12650              ACCCCCGAGGCGGCT---------GTGGCATCCTTGACATCTGGAATAAGCTCGGATTAT
Microcebus_murinus|1583            ACACCTGAGGCAGCA---------GTAGCATCA---CCATCTGGAATAAACTCTGATTAT
Tarsius_syrichta|8004              ACACCTGAGGCAGCT---------GTGACATCATGGACATCTGGAGTAAGCTCTGATTAT
Callithrix_jacchus|24298           ACACCTGAGGCAGCC---------ATAACATCACTGACATGTAGGTGGTCAGGCCTTTCT
Homo_sapiens|47954                 ---------------------------------------GCTGGAATAAGCTCTGATTAT
Gorilla_gorilla|17687              ACACCTGAGGCAGCC---------ATAACATCATTGACATCTGGAATAAGCTCTGATTAT
Pan_troglodytes|24569              ACACCTGAGGCAGCC---------ATAACATCATTGACATCTGGAATAAGCTCTGATTAT
                                                                            . .             .  

Spermophilus_tridecemlineatus|3286 AGCCTGGAAGAAATAGAAGAAAAGGAAGAACTGAGTGAAGGGCCTAAAGATGAGGTGGAA
Otolemur_garnettii|3416            AGCCTTGAAGAGATAGATGAAAAGGAAGAACTGAGTGAAGTGCCTAAAGATGAGGCTGAA
Ochotona_princeps|11485            AGCCTTGAAGAGATAGATGAAAAGGAAGAACTGAGGGAAGTGCCTAAAGATGAAGCTGAA
Tupaia_belangeri|12172             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|22105                 AGTCTTGAGGAGATAGATGAAAAGGAAGAACTCAGCGAGGCATCTAAAGATCCGGCTGGA
Rattus_norvegicus|21893            AGTCTTGAAGAGATAGATGAAAAGGAAGAACTGATGGAGGCGTCTAAAGATCAGGCTGGA
Dipodomys_ordii|434                AGTCTTGAAGAGATAGATGAAAAGGAAGAACTGAACGAAGTGCCTGAAGATCCGTCTGAA
Cavia_porcellus|12650              AGCCTTGAGGAGATAGATGAAAAGGAAGAACTAAGTGAGATGCCTAAACATGAAGCTGAA
Microcebus_murinus|1583            AGCCTTGAAGAGATAGATGAAAAGGAAGAACTGAGTGAAGTGCCTAAAGATGAGGCTGAA
Tarsius_syrichta|8004              GGCCTTGAAGAAATAGATGAAAGGAAAGAACTGAGTGAAGTGCCTGAAGACGAGGCTAAA
Callithrix_jacchus|24298           CGGGTGNNNNNNNNNNNNNNNAAGGAAGAACTGAGTGAAGTGCCTAAAGTAGAAGCTGAA
Homo_sapiens|47954                 AGCCTTGAAGAGATAGATGAAAAGGAAGAACTGAGTGAAGTGCCTAAAGTTGAAGCTGAA
Gorilla_gorilla|17687              AGCCTTGAAGAGATAGATGAAAAGGAAGAACTGAGTGAAGTGCCTAAAGTTGAAGCTGAA
Pan_troglodytes|24569              AGCCTTGAAGAGATAGATGAAAAGGAAGAACTGAGTGAAGTGCCTAAAGTTGAAGCTGAA
                                    .  . .  .   . .  .    .   .   .    .       .               

Spermophilus_tridecemlineatus|3286 AATATTTCTCTGAAGTCACCAGACATTCCTTTTGCATCTACTGATATAACAAATACACTG
Otolemur_garnettii|3416            AATATGTCTCTGAAGTCACAAGATATTTCGTCTGTATCTACTGATATAATAAATGCACTG
Ochotona_princeps|11485            AATATTTCTCTGAAGTCGCCACATAGTTATGTTGTATCTACTGATGTAACAAATGCACTG
Tupaia_belangeri|12172             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|22105                 AGTATTTCTGTGAAGTCGCCTGACATTGCTTCAGCATCGACTGATATGAGAATTACAGTG
Rattus_norvegicus|21893            ------AGTGTGAAGTCGCCTACCATTGCTTCAGCATCTACGGATATGATAATTACAGCG
Dipodomys_ordii|434                AATACTTCCCTGAAGTCACTCAGTGTTCCTTTGTCATCTACTACCACAGTAAATATGTTG
Cavia_porcellus|12650              AATATTTCTCTGAAGTCACCAGACATTGCTTTTGTATCTACTGATATAATAAGCACATTG
Microcebus_murinus|1583            AATATTTCTCTGAAGTCACAAGATATTCCTTTTGTATCTACTGATAAAATAAATGCATTG
Tarsius_syrichta|8004              AATGTTTCTCTGAAGTCACAAGATATTCTTTTTGTATCCCCTGATATAATAAATATCCCA
Callithrix_jacchus|24298           AATATTTGTGTGAAGTCACAAGATATTCCTTTTGTATCTACTGATACAATAAATACACTG
Homo_sapiens|47954                 AATATTTCTCCGAAGTCACAAGATATTCCTTTTGTATCTACTGATATAATAAATACACTG
Gorilla_gorilla|17687              AATATTTCTCCGAAGTCACCAGATATTCCTTTTGTATCTACTGATATAATAAATACACTG
Pan_troglodytes|24569              AATATTTCTCCGAAGTCACAAGATATTCCTTTTGTATCTACTGATATAATAAATACACTG
                                              .  ..          .         .                       

Spermophilus_tridecemlineatus|3286 AAAAATGATTCTGACTCAGCCCTTGGCATCAATAGCAGAGAGGCCTCTCAAAACTCCAAG
Otolemur_garnettii|3416            AAAAATGACCCTGACTCAGCCCTTGGCAATGAGAGTGCAAAGTCCTCACAAAACTCC---
Ochotona_princeps|11485            AAAAATGATCCTGACTCAACCCCTGGCAGTGAGCGAGAAGAGTCCTCACAAAATGACAAG
Tupaia_belangeri|12172             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|22105                 GAGAAGGATCCTGATTCAGCCCTCGGCATCAGTGATGGAGAGACCTCTCCAAGCTCCAAG
Rattus_norvegicus|21893            GAGAATGATCCTGATTCAGCCCTCAGCATCAGTGATGGAGAGACCTCTCCAGGCTCTAAG
Dipodomys_ordii|434                AAAAATGATCTCTACTCAGCCCTTGGCACTGGTAGTGGACAGGCCTCACAAAATGTCAAG
Cavia_porcellus|12650              AAGAAGGATCCTGACTCAGTCCTTGGCACTGATAGTGGAGAGGCTTCACAAAACTCCAAA
Microcebus_murinus|1583            AAAAATGATCCTGACTCAGCCCTTGGCAATGAGAGTGGAAAGTCCTCACAAAACTCCAAG
Tarsius_syrichta|8004              AAAAATGATCCTGACTCAGCCCCCGGCATTGATAGTGGAGAGTCCTTACAAAACTCCAAG
Callithrix_jacchus|24298           AAAAATGACCCTGACTCAGCCCTTGGCAATGATGGTGGAGAGTTCTCACAAAACTCCAAG
Homo_sapiens|47954                 AAAAATGATCCTGACTCAGCCCTTGGCAATGGTAGTGGAGAGTTCTCACAAAACTCCATG
Gorilla_gorilla|17687              AAAAATGATCCAGACTCAGCCCTTGGCAATGGTAGTGGAGAGTTCTCACAAAACTCCATG
Pan_troglodytes|24569              AAAAATGATCCTGACTCAGCCCTTGGCAATGGTAGTGGAGAGTTCTCACAAAACTCCATG
                                         .        .         .               .   .              

Spermophilus_tridecemlineatus|3286 GAAGAAAACCAAGAAACTAGAAACACAGATGGACCNNNNNNN---NNNNNNNNNNNNNNN
Otolemur_garnettii|3416            ------------------------------------GGACCA---CCCAGCGGAGTATAT
Ochotona_princeps|11485            GAAGAAAAACAAAAAACCGGAACCACAGATGGACAAGAGACA---CACACTATTGTGCAT
Tupaia_belangeri|12172             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|22105                 GGAAAAACTCAAGAAGGCAGAAGCACAGAGGGGCAAGGGCCGTATCATCCTGTTGTAGGC
Rattus_norvegicus|21893            GGAAACACTCCAGAAGGCAGAAACCCAGAGGGGCAAGGGCCACATCATCCTGTTGAGTGC
Dipodomys_ordii|434                AACAAAGCCCAAGAAACTAGAAATACAGATGGGAAAGGACAA---CACAATGCTGCACAT
Cavia_porcellus|12650              GAAGAAAATCAAGAAGCTGGAAACACAGATGGACAAGGGTCA---CACAGTGTTGTGTAT
Microcebus_murinus|1583            GAAGAAAAACACAAAACTAGAAGCACAAATGGACAAGGACCA---CACAGCACAATATAT
Tarsius_syrichta|8004              GAAGAAAAACAGAANNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNN
Callithrix_jacchus|24298           GAAGAAAAACAAGAAAGTAGAAGCACAAATGGACAAGAACCA---CACAGTGTAGTATAT
Homo_sapiens|47954                 GAAGAAAAACAAGAAACTAAAAGCACAGATGGACAAGAACCA---CACAGTGTAGTATAT
Gorilla_gorilla|17687              GAAGAAAAACAAGAAACTAAAAGCACAGATGGACAAGAACCA---CACAGTGTAGTATAT
Pan_troglodytes|24569              GAAGAAAAACAAGAAACTAAAAGCACAGATGGAGAAGAACCA---CACAGTGTAGTATAT
                                                                       .                       

Spermophilus_tridecemlineatus|3286 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|3416            GATACAAGCCATAAAGAGGTGGTAGTTGATAATATACGAAGCTCGAAGTCTTTGGGCCAA
Ochotona_princeps|11485            GATACAAGCAATGGAGGGATAGCCATGGACACTGTAACGAACTTGAAGTCACTGGGCCCA
Tupaia_belangeri|12172             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|22105                 CATATAGGCAATGAGGACAGAGTATCTGACAGTATAAAAGACATGAAGACACTGGGCCCA
Rattus_norvegicus|21893            CTTATAGGCAATGAGAACAATGTATCTGACAGTATAAAAGACTTGAAGACACTGAGCCCA
Dipodomys_ordii|434                GATAACAGCAATGAAGACCCTGTAGCTGGCCAT---------------------AGCCCA
Cavia_porcellus|12650              GATTCAAGCAATGAAAATATGTTACCTGATGGTGTCAGAAATTTGCAGTCACTGAGCCCA
Microcebus_murinus|1583            GATACAAGCAACGAAGAGTTGGTAGTTGATAGTATAAGAAGCTCAAAGTCTTTGGGCCCA
Tarsius_syrichta|8004              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------
Callithrix_jacchus|24298           GATACAAGCAATGAAAAGAAGGTAGTTGACAGCCTAAGAAACTTGAAGTCATTGGGCCCA
Homo_sapiens|47954                 GATACAAGCAATGGAAAGAAGGTAGTTGACAGTATAAGAAACTTGAAGTCGTTGGGCCCA
Gorilla_gorilla|17687              GATACAAGCAATGGAAAGAAGGTAGTTGACAGTATAAGAAACTTGAAGTCGTTGGGCCCA
Pan_troglodytes|24569              GATACAAGCAATGGAAAGAAGGTAGTTGACAGTATAAGAAACTTGAAGTCGTTGGGCCCA
                                     .    .                   .                                

Spermophilus_tridecemlineatus|3286 NNNNNNNNNNNN---NTTCAGAATGAAATCATTGTCCTTACAACAAATACAGAAGATACT
Otolemur_garnettii|3416            AACCAAGAGAAT---GTTCAGAATGAAATAATTGTTGTTCCAAAGAATGCAGAAGATAAT
Ochotona_princeps|11485            AATAAAGAAAAT---GTTCCAAATGGAGTAGCTGTCTTTACAACAAATATGGAAGATAAC
Tupaia_belangeri|12172             NNNNNNNNNNNNNNNNTTCATCATGAAAAAACTGTCTTTCCAATGAACACAGAAGATAAT
Mus_musculus|22105                 AACCAGGAGAGTGTAGTTCAAAATGAAATCATGGTCTGTGCCACAAGCACA---GATTAT
Rattus_norvegicus|21893            AACCAAGAGAGTGTAATTCAAAATGAAGTCGTGGTCTGTGCTACAAGCACA---GATTAC
Dipodomys_ordii|434                AACCAAAAGATT---GNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|12650              AATGAAAAGAAT---GTTCAAAATGAAACCAATATCCTTGCAACAAAAACAGAAGATAAG
Microcebus_murinus|1583            AACCAAGAGAAT---GTTCAAAATGAAATA---GTCCTTCCAAAGAATACAGAAGATAAT
Tarsius_syrichta|8004              ---------------NNNNCTCAAAATATAATTATCTTTTCAGAGAACAGAGACGATAAT
Callithrix_jacchus|24298           AACCAAGAGAAT---GTTCAAAATGAAATAATTGTCTTTCCAAAGAACACAGAAGACAAT
Homo_sapiens|47954                 AACCAAGAGAATGTAGTTCAAAATGAAATAATTGTCTATCCAGAGAACACAGAAGACAAT
Gorilla_gorilla|17687              AACCAAGAGAAT---GTTCAAAATGAAATAATTGTCTATCCAGAGAACACAGAAGACAAT
Pan_troglodytes|24569              AACCAAGAGAAT---GTTCAAAATGAAATAATTGTCTATCCAGAGAACACAGAAGACAAT
                                                   ..                .   .               .     

Spermophilus_tridecemlineatus|3286 ATGAAAGATAGAGTGAGGCGAACAGAAATCATTGTAGAAGGGGAAGCAAAA------AAT
Otolemur_garnettii|3416            ATGAAAAACGGAGCGAGGAGGACAGATACCAATGTGGGAGGTGTTACCAAA------AGT
Ochotona_princeps|11485            ATTAAAAACAGA------------GAAAACAGTGTGGGAAGTGTTGCCAAA------AAT
Tupaia_belangeri|12172             ATGAAAACTAGAGTAAAGAAAACAGAAGTCAATGTAGGAGGTGTTGCCACA------AAT
Mus_musculus|22105                 GTGAAAAACAGACCGGGGAAAATGGAAACCACCATAGAAGGCGAAGGCGAAGCTCTGAAG
Rattus_norvegicus|21893            GTGAAAAACAGACCAAGGGAAATGGAAGCCACCATAGAAGGAGAGGCACAG------AAG
Dipodomys_ordii|434                NNNNNNNNNNNNNNNNNNNNNNNNNAAGTCAATGTAGAAGGT---AGCAAA------AAT
Cavia_porcellus|12650              ATGAAAAATAGTGTGAGAAAAACAGAAATCTGTGTAGATGAA---GCCAAA------AAT
Microcebus_murinus|1583            GTGAAAAATGGAGTGAGGACGACAGAAATCAATGTAAGAGGTGTTACCAAA------AGT
Tarsius_syrichta|8004              ATAAAAAATGGAGTGAGGAAAACAGAAATCACTGTAGGAGCTGTTGCCAAA------AAT
Callithrix_jacchus|24298           ATGAAAAATGAAGTGAAGAAAACAGAAATCAACGTAGGAGGTGTTGCCAAA------AAT
Homo_sapiens|47954                 ATGAAAAATGGAGTGAAGAAAACAGAAATCAATGTAGAAGGTGTTGCCAAA------AAT
Gorilla_gorilla|17687              ATGAAAAATGGAGTGAAGAAAACAGAAATCAATGTAGGAGGTGTTGCCAAA------AAT
Pan_troglodytes|24569              ATGAAAAATGGAGTGAAGAAAACAGAAATCAATGTAGGAGGTGTTGCCAAA------AAT
                                    .                      .*:. *:  .*...:.     . . ..      *. 

Spermophilus_tridecemlineatus|3286 AAGGATGCAGTCATGGAAGTTGACAGACAGTCAAGCTATCAAGCACATAAAACTGTTAAT
Otolemur_garnettii|3416            AACAGTGTGGCCATGGAAGTTGACAGACTGTCAAACTCTCTGGCGTGTGAAACTGGTATT
Ochotona_princeps|11485            AAAGATGTAGACATGGAAGTCAACAGACAACCAGACCATCCAGGATTTAAAAGTCACAGT
Tupaia_belangeri|12172             AACAATGTGGACATAAAAGTTGACACACTGCCAAACTTTCAAGTATATAAAACTGATCCT
Mus_musculus|22105                 AAAGCCAGCGACATGGAAACTGATAGATTGTCAGGCTCTCCTGCATGTAGAATGGACAAT
Rattus_norvegicus|21893            AAAGTCGGGGATGTGGAAGCTGAAAGATTGTCAGGCTCTCCTGCAGGTAGAATGGATGAT
Dipodomys_ordii|434                ACAGGCGTGCATAAAGGTAATGATGCTCTA------------------------------
Cavia_porcellus|12650              AAGGACATAAACATGAGAGTTGACAAACTACCACAGTGTCGAGCGTGTGAAACTGATAGT
Microcebus_murinus|1583            AACAACATGGACAGGGAAGTTGACAGACTGTCAAACTCCCAGGCATGTGAAACAGATACC
Tarsius_syrichta|8004              AACGACATGGACACGGATGTTGTCAGACTATCAGACTCTCGGGTACATAAAACTCATACT
Callithrix_jacchus|24298           AACGACATCGATATGGAAGTTGAGAGACCATCAAACTCTCAGGCACATGAAACTGATACT
Homo_sapiens|47954                 AACAACATTGATATGGAAGTTGAGAGACCATCAAACTCTGAGGCACATGAAACTGATACT
Gorilla_gorilla|17687              AACAACATTGATATGGAAGTTGAGAGACCATCAAACTCTGAGGCACATGAAACTGATACT
Pan_troglodytes|24569              AACAACATTGATATGGAAGTTGAGAGACCATCAAACTCTGAGGCACATGAAACTGATATT
                                   *. .  .     . ...:.  .: . :  .                              

Spermophilus_tridecemlineatus|3286 GTTGTAACTTCCAAGGAAAATCATCTAGCAGTAGCATCAGTACCAGACCACAAACTGAAT
Otolemur_garnettii|3416            ATTATGAGTGACGCAGAAAACCATCTATCAGCTTTATCAGGACCAGATCAAAAACTGAAT
Ochotona_princeps|11485            GCTCTAAGTTCCAGGGAAAATGATCTTGCAGCATCCACAGGT------CAAAAGCCGAGT
Tupaia_belangeri|12172             GCTGTAAGCTGCAAGGAAAATCATCCATCAGTTTCATCGGGACCAGACCAAAAGCTGAAT
Mus_musculus|22105                 GTTAAAAGTTCGAGGGAAAATCATCTAACAGCATCGCCAGGACCAGATCAAAAATTGAAT
Rattus_norvegicus|21893            GTTCAAAGTTCAAGGGAAAATCATCTAACAGCATCACCAGGACCAGATCAAAAATCGAAT
Dipodomys_ordii|434                ------------AGGAAGGAAATCCTAGCAGCAACATCAGTACCAGACCAAGCACTGAGT
Cavia_porcellus|12650              TTTATAAGTTCCAAGGAAAATCATGGAGTGGTAGCATCACTGCCAGACCAAAAACTGAAT
Microcebus_murinus|1583            ATTATAAATCACAAGGAAATCCGCGTAGCAGCTTCATCAGTACCAGATCAAAAACTGAAA
Tarsius_syrichta|8004              ACTGTAAATTACAAGGAAAACCATCTAGCAGCTTCATCGGTACCAGATCAAAAAATGAAT
Callithrix_jacchus|24298           TCTATAAGTTACAAGGAAAACCGTCTAGCAGCTTCATTAGTACCAGATCAAAAACTGAAT
Homo_sapiens|47954                 GCTATAAGTTACAAGGAAAACCATCTAGCAGCTTCATCAGTACCAGATCAAAAACTGAAT
Gorilla_gorilla|17687              GCTATAAGTTACAAGGAAAACCATCTGGCAGCTTCATCAGTACCAGATCAAAAACTGAAT
Pan_troglodytes|24569              GCTATAAGTTACAAGGAAAACCATCTAGCAGCTTCATCAGTACCAGATCAAAAACTGAAT
                                               . ..*..:         .* :     .         **....  **.:

Spermophilus_tridecemlineatus|3286 CAGCTTGGTGCAGAAAAGATGAAAATGCAAGATGCGGCAATTCAGACAATCCCTTCCAGC
Otolemur_garnettii|3416            CAACCCAGTGGAGAAAAAACG------CAAGATGCAGCAATTCAGACAGCCCCTTCCTGT
Ochotona_princeps|11485            CAGCCTACTGCAGAAAAGACAACAATGCAAGATGCAGCTATTCAGACAGCCCCTTCCTGT
Tupaia_belangeri|12172             CAACTCATTGCAGAAAAGATAAAAATGCAAGATGCAGCAATTCAGACAACCCCTTCCTCT
Mus_musculus|22105                 CAACCAGGTGTAGAGAAGACGAAAATGCAGGATGCAGCAATTCAGGCCACCCCTGCCCGC
Rattus_norvegicus|21893            CAACCACGTGTAGAGAAGACAAAAATGCAGGATGCAGCAATTCAGGCCACCCCTGCCTGC
Dipodomys_ordii|434                CAGCTGGAA---GAGAAGACAAAAATGCAAGATGTAGCAACTCAGACAGCATCTTCCTGT
Cavia_porcellus|12650              CAACACAGAACAGAAAAGACAAAAATGCAAGATGCAGCAATTCAGACCACCCCTTCCTGT
Microcebus_murinus|1583            CAACCCAGTGCAGAGAAGACAAAAATGCAAGATGCAGCAATTCAGACAACTCCTTCCTAT
Tarsius_syrichta|8004              CAACCTGATGCAGAAAAGACAAAAATGCAAGATGCAGCAATTCAGACAACCCCTTCCAGT
Callithrix_jacchus|24298           CAACCCAGTGCAGAAAAGACAAAAATGCAAGATGTAGCAATTCAAACAACCCCTTCTTGT
Homo_sapiens|47954                 CAACCCAGTGCAGAAAAGACA------AAAGATGCAGCAATTCAGACAACCCCTTCTTGT
Gorilla_gorilla|17687              CAACCCAGTGCAGAAAAGACAAAAATGCAAGATGCAGCAATTCAGACAACCCCTTCTTGT
Pan_troglodytes|24569              CAACCCAGTGCAGAAAAGACAAAAATGCAAGATGCAGCAATTCAGACAACCCCTTCTTGT
                                   **.*    :   **.**.* .      .*.**** .**:* ***..*..   ** *    

Spermophilus_tridecemlineatus|3286 AACAGTTCTGAGGGGAATCATCAAGATCATAATTTGCCTGCTTTCAAAGTTGATGAAAGT
Otolemur_garnettii|3416            GACGGTTTTTACAGGAATCACCAAGATCATAATTTGCCTGACCTCAAAGTCAATGAAAGA
Ochotona_princeps|11485            AGCAACTTCACGGAGAATCACCAAGATCAAAATCTGTCAACCTTCAAAGTCGATGAAATT
Tupaia_belangeri|12172             AACAGTTTTGGCAAGAATCACCAAGCTAATAATTTGTCTGACTTCAAAGTTGATGAAAGT
Mus_musculus|22105                 GGCACTTTTGATGGGAATCACGAAGTCAGTAATTCATCTGACCCCAGGGCTGATGAGACT
Rattus_norvegicus|21893            AGCACTTTTGATGGGAATCACGAAGCCCATAATTCACCTGACCTCAGGGTTGATGAGACT
Dipodomys_ordii|434                AACAGTTTGAATGAGAGTCATCAAGATCATAATTTGTCTGACTTCAAGACTGATGAAAGT
Cavia_porcellus|12650              AACAGCTTGAATGGGAACCACCAAGATCGTAATTTATCTGACTTCAAAGTTGATGAAAGT
Microcebus_murinus|1583            AACAGTTTTCACAGGAATCACCAAGATCAGAATTTGTCTGACCTCAAAGTTGATGAAAGT
Tarsius_syrichta|8004              AACAGTTTTTGTGGGAATCAACAAGATCATTATTTGTCTGACTTTAAAATTAATGAAAGT
Callithrix_jacchus|24298           AACAGTTTTGATTGGAAACACCAAGATCATAATTTGTCTGACTTCAAAGTTGAAGAAAGT
Homo_sapiens|47954                 AACAGTTTTGATGGGAAACACCAAGATCATAATTTATCTGACTCCAAAGTTGAAGAATGT
Gorilla_gorilla|17687              AACAGTTTTGATGGGAAACACCAAGATCATAATTTGTCTGACTCCAAAGTTGAAGAATGT
Pan_troglodytes|24569              AACAGTTTTGATGGGAAACACCAAGATCATAATTTATCTGACTCCAAAGTTGAAGAATGT
                                   ..*.  *      .**. **  ***  .. :**  . *:..    *...  .*:**.: :

Spermophilus_tridecemlineatus|3286 GTGCAAACTTCA---AATAACAAACCAACTCAACACCTATCTTTAAATCTACAAAATTCT
Otolemur_garnettii|3416            ATACAAACTTCACATAATAATAAATCAACTCAACACTCATTCTTAAACCCAAAANNNNNN
Ochotona_princeps|11485            GTACAAACTTCA---AATAGCAGATCAACTCAGCACTTGGCCTTAAGTCCACACGATTCT
Tupaia_belangeri|12172             GTGCAAACATTGAATAACAGCAAATCAATTCAACACCCACCCTTTAGTCAGCGAGATTCT
Mus_musculus|22105                 GTGCAGACTTCGGATGGCAGCATATCAGCTCAGCACTCCTCTGCAAGTCTCCAGGATTCT
Rattus_norvegicus|21893            GCACAGACTTTGGGTAGCAGCACATCAACTCAGCACTCCTCTGCAAGCTTCCAGGATTCT
Dipodomys_ordii|434                GTGCAAACTTCA---AATGACAAATCAACTCAACACTCTTTCCCAAGTCTACAAGATTCT
Cavia_porcellus|12650              GTGCAAACTTCA---AATAACAAGTCAACTCAACATTCATCCTTAATTCTACAAGATTCT
Microcebus_murinus|1583            GTACAAATTTCAAATAATAACAAATCAACTCAACACTCGTCCTTATGTCCACAAGATTCT
Tarsius_syrichta|8004              GTGAAAACTTCA---AATAACAAATCAACTAAACATTTATCCTTAAGTTCACAAGATTCT
Callithrix_jacchus|24298           GTGCAAACTTCA---AATAACGTATCAACTCAACACTCATTCTTAAGCTCACAAGATTCT
Homo_sapiens|47954                 GTGCAAACTTCAAATAACAACATATCAACTCAACACTCATGCTTAAGTTCACAAGATTCT
Gorilla_gorilla|17687              GTGCAAACTTCAAATAACAACATATCAACTCAACACTCATGCTTAAGTTCACAAGATTCT
Pan_troglodytes|24569              GTGCAAACTTCAAATAACAACATATCAACTCAACACTCATGCTTAAGTTCACAAGATTCT
                                   . ..*.* :* .   .. .. . . **. *.*.**         ::     ..   .. .

Spermophilus_tridecemlineatus|3286 ATAACTACCTCAAGAGAATTGAGGATTCAGAGCACCCCAGTCATATATTCAGAAGACAGA
Otolemur_garnettii|3416            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|11485            GTTGATATCTCAAATGAATTCAGGAATCAGGATACCCTAGCTAAACCTTCAGAAGGTGAA
Tupaia_belangeri|12172             GTAGGCACTTCAAGAGAATTCAGGAGTCAGGGTACCTTAAACACACAGTCAGAAGAGCAG
Mus_musculus|22105                 GTAAATGCCTCAAGAGAATTCAGGAGTCAGGGCACC---TCAACTTATGTACAAGATAGA
Rattus_norvegicus|21893            GTAAATGCCTCAAGAGAAGTCAGGAGTCAGGGCACC---TCAACCTATGTACAAGATAGA
Dipodomys_ordii|434                CTGGATACCTCAAAAGGTTACAGGAGTCAG---AGCATTCTAATACATTCAGAAGATAGA
Cavia_porcellus|12650              GCAAATACCACAAGCAAATTGAGGAGTCAGGGTACCCTAACAGTATATACAGAAGATAGG
Microcebus_murinus|1583            TTGGCTACCTCAAGGGAATTGAGGAGCCAGGGCACCCTAATTATACAATCAGGAGGTCAA
Tarsius_syrichta|8004              GTAGAAACCTCAAGGGAATTCAGGAGTCAAGGCACCCTAATTATACATTCAGAAGAGCGT
Callithrix_jacchus|24298           GTAGATCACTCAAAGGAATTCAGGAGCCAAGGCACCCTAACTATACATTCAGAAGATCTG
Homo_sapiens|47954                 GTAAATACCTCAAGGGAATTCAGGAGTCAAGGCACCCTAATTATACATTCAGAAGATCCG
Gorilla_gorilla|17687              GTAAATACCTCAAGGGAATTCAGGAGTCAAGGCACCCTAATTATACATTCAGAAGATCCA
Pan_troglodytes|24569              GTAAATACCTCAAGGGAATTCAGGAGTCAAGGCACCCTAATTATACATTCAGAAGATCCG
                                                         ..                              .     

Spermophilus_tridecemlineatus|3286 CTTGCCATAAAAGATCCAGCTTGTGCACAAGGCAATGATGATCTTTTGTCTCCTGTAGAT
Otolemur_garnettii|3416            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|11485            CATGCCATGAAAGTTCCAGTTTCCGCACACAACAATGAGGATCATTTGTTGCTCACAAAC
Tupaia_belangeri|12172             CTCCCCAGAAAAGATCCCATTTGTACACAT---AATGATGATCTTTTGCTTCCTATAGAT
Mus_musculus|22105                 CTCCCTGAGAAAGAGCCAGCTTGTACATATGGGAACAATGTCCCTTTGTCACCTGTAGAT
Rattus_norvegicus|21893            CTCCCTGTGAAAGAGGCAGCTTGTACTTATGGGAACAATGACGCTTTATCTCCTATAGAT
Dipodomys_ordii|434                CTTTCCATGAAAAACCCAGTGTGTGTACAAGGGAGGGATCATATTTTGTCTCCTACAGAT
Cavia_porcellus|12650              CTTGCCAGAAAGGATCCAGTCTATGCCTATGGTAGTGATGATCTTTCATCTCCCATAGAT
Microcebus_murinus|1583            CCCACCATAAAAGATCCCATTTGTGCACGTGGTAATGAAGATCTTTTGCCTCCTACAGAT
Tarsius_syrichta|8004              CTTACCATGAAAGATCCAATTTGTGCACGTAGTGATGATGATCTTTTGCCTTCTGTAGAT
Callithrix_jacchus|24298           TTTACCACAAAAGATCCAATTTGTGCACATAGTAATGATGATCTTTTGCCTTCTATTGAT
Homo_sapiens|47954                 CTTACCGTAAAAGATCCAATTTGTGCACATGGTAATGATGATCTTTTGCCTCCTGTAGAT
Gorilla_gorilla|17687              CTTACTGTAAAAGATCCAATTTGTGCACATGGTAATGATGATCTTTTGCCTCCTATAGAT
Pan_troglodytes|24569              CTTACCGTAAAAGATCCAATTTGTGCACATGGTAATGATGATCTTTTGCCTCCTATAGAT
                                                        .                      ..              

Spermophilus_tridecemlineatus|3286 GGAACCGATAAATATTCATCTGCTTCTTACCTAAAGAATCTGCCACTTTATAGACAAGAC
Otolemur_garnettii|3416            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|11485            GAAAATGTTAAAAATTCACCGGCTTCCTCCCTAAAGAATCATCCACTCTACAGACAGGAC
Tupaia_belangeri|12172             GGGATTGAGAAAAATTCACCTGCTTCTTACCTAAAGAATCATCCACTTTACAGACAGGAC
Mus_musculus|22105                 GGAAGTAATAAGAATCCAGCTGCTTCTTACCTAAAGAACTTTCCACTTTATAGGCAAGAC
Rattus_norvegicus|21893            GGAAGTGGTAAGAATCCGGCTGCTTCTTCCCTAAAGAACTTTCCACTTTATAGGCAAGAC
Dipodomys_ordii|434                GGAAGTGATAAAAATGCAACTGCTTCTCACCCAAAGAATTTTCCACTTTACAGACCGGAC
Cavia_porcellus|12650              GGAATTGATAAAAACTCAACTGTTTCTTACCTACAGAACTCTCCACTTTACCGACAGGAC
Microcebus_murinus|1583            GGGATTGACAAAAATTCAACTGTTTCTTACCTAAAGAATTATCCATTTTATAGACAGGAC
Tarsius_syrichta|8004              AGGATTGACAAAAATTCGAATGCTTCTTACCTGAAGAATTATCCATTTTACAGACAGGAC
Callithrix_jacchus|24298           AGGATTGATAAAAATTCAACTGCTTCTTACCTAAAGAATTATCCACTTTATAGACAGGAC
Homo_sapiens|47954                 AGGATTGACAAAAATTCCACTGCTTCTTACCTAAAGAATTACCCACTTTATAGACAGGAC
Gorilla_gorilla|17687              AGGATTGACAAAAATTCAACTGCTTCTTACCTAAAGAATTACCCACTTTATAGACAGGAC
Pan_troglodytes|24569              AGGATTGACAAAAATTCAACTGCTTCTTACCTAAAGAATTACCCACTTTATAGACAGGAC
                                                        . ..          .          . .   .    .  

Spermophilus_tridecemlineatus|3286 TATAATCCCAAACCAAAACCTTCCAATGAAATTACAAGAGAGTATATACCCAAAATTGGA
Otolemur_garnettii|3416            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|11485            TATAATCCCAAGCCAAAACCTTCAAATGAAATTACAAGAGAGTATATTCCCAAAATTGGA
Tupaia_belangeri|12172             TATAGTCCTAAGCCAAAACCTTCAAATGAAATTACAAGAGAGTATATACCTAAAATCGGA
Mus_musculus|22105                 TCCAACCCCAAGCCAAAACCGTCAAATGAAATCACGAGAGAGTATATACCTAAAATTGGA
Rattus_norvegicus|21893            AACCACCCCAAGCCAAAACCTTCAAATGAAATTACGAGAGAGTACATACCTAAAATTGGA
Dipodomys_ordii|434                TATAATCCCAAACCCAAACCTTCAAATGAAATTACAAGAGAATACATACCCAAAATTGGA
Cavia_porcellus|12650              TATAGTGCCAAACCAAAACCTTCTAATGAAATTACAAGAGATTATATACCCAAAGTTGGA
Microcebus_murinus|1583            TACAATCCCAAACCAAAACCTTCAAATGAAATTACAAGAGAGTATATACCCAAAATTGGA
Tarsius_syrichta|8004              TACAACTCCAAGCCAAAACCTTCAAACGAAATCACACGAGAGTATATACCCAAAATCGGA
Callithrix_jacchus|24298           TACAATCCCAAGCCAAAACCTTCAAATGAAATTACACGAGAGTATATACCCAAAATTGGA
Homo_sapiens|47954                 TACAATCCCAAGCCAAAACCTTCAAATGAAATTACACGAGAGTATATACCCAAAATTGGC
Gorilla_gorilla|17687              TACAATCCCAAGCCAAAACCTTCAAATGAAATTACACGAGAGTATATACCCAAAATTGGC
Pan_troglodytes|24569              TACAATCCCAAGCCAAAACCTTCAAATGAAATTACACGAGAGTATATACCCAAAATTGGC
                                                        .     .   .     . .  .   .        . .. 

Spermophilus_tridecemlineatus|3286 ATGACTACTTATAAAATAGTACCTCCCAAATCCCTGGATATACTGAAAGACTGGGAATCA
Otolemur_garnettii|3416            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|11485            ATGACTACTTATAAAATAGTACCTCCCAAATCCCTGGAAATATCAAAAGATTGGGAATCA
Tupaia_belangeri|12172             ATGACTACTTATAAAATAGTGCCTCCCAAATCTCTGGACATAGGGAAAGACTTGGAGTCA
Mus_musculus|22105                 ATGACTACTTATAAAATAGTACCTCCGAAATCCCTGGAAATGGCGAAAGACTGGGAATCA
Rattus_norvegicus|21893            ATGACTACTTACAAAATAGTGCCTCCGAAATCCCTGGAAGTGGTGAAAGACTGGGACTCA
Dipodomys_ordii|434                ATGACTACTTATAAAATAGTGCCTCCCAAATCCCTGGATATATTGAAAGACGGGGAATCG
Cavia_porcellus|12650              ATGACGACTTATAAAATAGTGCCTCTCAAATCCCTGGAAATACTGAAAGACGGGGAGTCA
Microcebus_murinus|1583            ATGACTACTTATAAAATAGTGCCTCCCAAATCCTTGGAAATATTGAAGGACTGTGAATCA
Tarsius_syrichta|8004              ATGACTACTTATAAAATAGTGCCTCCCAAATCCTTGGAAATATCAAAAGACTGGGAATCG
Callithrix_jacchus|24298           ATGACTACTTATAAAGTAGTGCCTCCCAAATCCTTGGAAATACTGAAAGACTGGCAATCA
Homo_sapiens|47954                 ATGACTACTTATAAAATAGTGCCTCCCAAATCCTTGGAAATATCGAAAGACTGGCAATCA
Gorilla_gorilla|17687              ATGACTACTTATAAAATAGTGCCTCCCAAATCCTTGGAAATATCGAAAGACTGGCAATCA
Pan_troglodytes|24569              ATGACTACTTATAAAATAGTGCCTCCCAAATCCTTGGAAATATCGAAAGACTGGCAATCA
                                    ..     ..      . ..   .      .   ...   .       .        .  

Spermophilus_tridecemlineatus|3286 GAAACCACAGGGTATAAAGATGATCAAAAGATTCATGCTTCAGGG---------------
Otolemur_garnettii|3416            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|11485            GAAACCGTTGGACATAAAGATGATCAAAAGCTACCTAAATTAGACGAAAGACATGTGAAC
Tupaia_belangeri|12172             GAAACCATAGGATATAAAGACAGTCAAGAGACACACACCTTAGAGAAAAAGCATACTCAT
Mus_musculus|22105                 GAAGCAATGGGGAGGAAAGATGACCAAAAGATGCTCCCTGTAGGGCAGAGGCATACGATT
Rattus_norvegicus|21893            GAAGCAGCGGGGAAGAAAGATAACCAAAAGACGCTTGCTGTAGCACAGAAGCATGCGATT
Dipodomys_ordii|434                GAAACTATAGGATATAAAGATGACCAAAAGTTACATGCTTTTGGACAAAAGCCCACTTAT
Cavia_porcellus|12650              GAATCTGTAGTATTTAAAGATGATCAGAAGTTACATACTTTAGGAAAAAAGCATGCTTAC
Microcebus_murinus|1583            GAAACCATAGGGTATAAAAATGATCAGGAGATACATACTGTAGGA---AAGCACACTCAA
Tarsius_syrichta|8004              GAAACTGTAGGGTATAAAGATGATCAAGAGATATATACTTTAGTAAAAAAGCCCACTGAT
Callithrix_jacchus|24298           GAGACCATAGGGTATAAAGATGATCAGGACATACATACTTTAGGGAAAAAGCACACTCAT
Homo_sapiens|47954                 GAAACCATAGAGTATAAAGATGATCAGGACATGCATGCTTTAGGGAAAAAGCACACTCAT
Gorilla_gorilla|17687              GAAACCATAGAGTATAAAGATGATCAGGACATGCATGCTTTAGGGAAAAAGCACACTCAT
Pan_troglodytes|24569              GAAACCATAGAGTATAAAGATGATCAGGACATGCATGCTTTAGGGAAAAAGCACACTCAT
                                   .        .                                .                 

Spermophilus_tridecemlineatus|3286 ---AATGTGAAGGAGGTTGCCCTGCAAACACAAGACCTTGTTACTTCTGAAGGCCCA---
Otolemur_garnettii|3416            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---
Ochotona_princeps|11485            AAGAATGTGAAAGAAACTGCCATTCCAACAGAAGGCTTAGTTATTTCTGAAGGCGCG---
Tupaia_belangeri|12172             GAGAATATGAAAGAAACTGCAATTCAGACAGAAGACCTCATTATTTCAGAAGGCCCA---
Mus_musculus|22105                 GAGAATATGACAGAAACTTCCATGCAAACAGAAGTCCCTGCTACTTCTAAAAGCTCA---
Rattus_norvegicus|21893            GAGACTATGACAGAGACTGCCGTGCAAGCAGAAGCCCTTGTCACGTCTAAAAACTCA---
Dipodomys_ordii|434                GAGAATGTGAAAGAAACTTACATGCAAACAGAAGACCTTATCATTCCTGAGGGCTCT---
Cavia_porcellus|12650              GAGAATGTGAAAGAAACTTCCATCCAGACAGAAAACACTGCTGCTTCTGACGGCCCAGTG
Microcebus_murinus|1583            GAGAATGTGAAAGAAACTGCCATCCAAACAGAAGATCCTGCTATTTCTGAAGTTCCA---
Tarsius_syrichta|8004              GAGAATGTGAGAGAAACTGCCATCCAAACAGAAGAGCCTGCCATTTCTGCTGGACCA---
Callithrix_jacchus|24298           GAGAATGTGAAAGAAACTGCCATCCAAACAGAAGATTCTGCTATTTCTGAAGGCCCG---
Homo_sapiens|47954                 GAGAATGTGAAAGAAACTGCCATCCAAACAGAAGATTCTGCTATTTCTGAAAGCCCA---
Gorilla_gorilla|17687              GAGAATGTGAAAGAAACTGCCATCCAAGCAGAAGATTCTGCTATTTCTGAAAGCCCA---
Pan_troglodytes|24569              GAGAATGTGAAAGAAACTGCCATCCAAACAGAAGATTCTGCTATTTCTGAAAGCCCA---
                                        . ..   .    .    .                                     

Spermophilus_tridecemlineatus|3286 GGGAAGCTACAGCTAGACCCTAAACCAAAGCCTAACTTGAGAACAGAGCAACAGTTGCAC
Otolemur_garnettii|3416            NNNNNNNNNNNNNNNNNNNNTGGACCTCTT---AACTTGAGAACCGACCATCAGGTACCC
Ochotona_princeps|11485            AAGGAGCCACCTCCAGATCTCAAACCAAAGCCAAGCTTGAGAGCAGAACATCAGGTGCTC
Tupaia_belangeri|12172             AAGGAGCCGCCGCCAGACCTTAAACCAAAACCAATCTTGAGGACAGGACATCAGGTTCCC
Mus_musculus|22105                 CAGCAGCCTCAGCCTGACCTTAAACCAAAGCCCAGCTCAGGAACAGAGCGTCATTTGCAC
Rattus_norvegicus|21893            CAGCAGCCTCAGCCTGACCGTACACCAAAGCCCAGCTCAGGAACAGAGCATCCTTTGCAC
Dipodomys_ordii|434                AAGGAACCCCTGCTAGACCTCAAGCCACAATCAAGCATGAGAACAGAGCATCAGTTGCAC
Cavia_porcellus|12650              GAGGAGCACAAACAAGGCCTCACACCCAAGCCCAGCTTGAGAGCAGCACAGCAGTTGCAC
Microcebus_murinus|1583            AAGGAACCACCACCGGACCTTAAACCTAAACCTAATTTGAGAACCGAGCATCAGGTACGC
Tarsius_syrichta|8004              AAGGAGTCACCACCAGACCTTAAACCTAAGCCTAACTTGAAAACAGAGAATGAGGTGCAC
Callithrix_jacchus|24298           AAAGGGCCACTGCCAGACCTTAAACCAAAGCCAAACCTGAGAACAGAGCATCAGGTACAC
Homo_sapiens|47954                 GAAGAGCCACTGCCAAACCTTAAACCGAAGCCTAACCTGAGAACAGAGCATCAAGTGCCC
Gorilla_gorilla|17687              AAAGAGCCACTGCCAAACCTTAAACCGAAGCCTAACCTGAGAACAGAGCATCAAGTGCCC
Pan_troglodytes|24569              GAAGAGCCACTGCCAAACCTTAAACCGAAGCCTAACCTGAGAACAGAGCATCAAGTGCCC
                                                        . .** .:    *    .....*.*  ..  .  * * *

Spermophilus_tridecemlineatus|3286 AGGGCTGTGAGCTCACCCGATGGTGCTGTGACTAATCCTCTC------------AGAATG
Otolemur_garnettii|3416            AGTGCCCTGAGCTCACCTGATGGTGCCACGGTTAATTCTCTGAAACCTACTTCCAAAGTG
Ochotona_princeps|11485            AGGGCTGTGAACTCCCCTGTTGGGACCACAGCAAATCCTCCGAAACCT---CCTAGAATG
Tupaia_belangeri|12172             AGTTCTGCAGGTTCGCCTGATAGTGCTTTGGCTAATCCTCTGAGAACTGTTCCTAGAATG
Mus_musculus|22105                 AGGACTTTGAGCTCACCAACTGGTACCGAGACGAACCCTCCCAAAGCA---CCCAGAGTG
Rattus_norvegicus|21893            AGGACTGTGAGCTCACCAGTTGGTACCGAGATGAACCCTCCCAAGCCT---CCCAGGATG
Dipodomys_ordii|434                AGGGCAGTGAGCTCACCAGAGAGTGCCACAACCAGTCCTCTGAAACCT---CCCAGAATA
Cavia_porcellus|12650              AGGGCTATGAGCTTTACTGATGAGGTAGTGACTAAGCCTCCAAAGCCT---CCCAGGATG
Microcebus_murinus|1583            AGTGCTGTGAGCCCAACTGAGGATGCGACAGTTAATCCTCTGAAACCTGCTCCCAAAGTG
Tarsius_syrichta|8004              AGTGCTGTGAGCTCATCGGATGGTGCCATCGTTAATCCTCTGAGACCT---CCCAAAGTG
Callithrix_jacchus|24298           GGTTCTGTGAGCTCACCTGTTAGTGCCATGGTTAGTCCTCTGAAACCTTCTCCCAAAATG
Homo_sapiens|47954                 AGTTCTGTGAGCTCACCTGATGATGCCATGGTTAGTCCTCTGAAACCTGCTCCCAAAATG
Gorilla_gorilla|17687              AGTTCTGTGAGCTCACCTGATGGTGCCATGGTTAGTCCTCTGAAACCTGCTCCCAAAATG
Pan_troglodytes|24569              AGTTCTGTGAGCTCACCTGATGGTGCCATGGTTAGTCCTCTGAAACCTGCTCCCAAAATG
                                   .*  *   ...     * .  .. .     .  *.  ***              *...*.

Spermophilus_tridecemlineatus|3286 ACAAGAGACACTGGCACAGCTCCTTTTGCGCCAAATTTGGAAGAAATAAACAATATTTTG
Otolemur_garnettii|3416            ATGAGACACACTGGCACAGCTCCTTTTGCACCAAATTTGGAAGATATAAACAATATTTTG
Ochotona_princeps|11485            ACTAGAGACTCTGGTCTTACTCCTTTTGCACCAAATTTGGAGGATATACACAATATTTTG
Tupaia_belangeri|12172             GCTAGAGACACTGGTACAGTTCCTTTTGCACCAAATTTGGAAGACATAAACAATATTTTG
Mus_musculus|22105                 ACTACAGACACTGGCACCATTCCTTTTGCGCCAAATTTGGAAGATATAAACAATATTTTG
Rattus_norvegicus|21893            ACTACGGACACTGGCACCATTCCTTTTGCACCGAATTTGGAAGATATTAACAATATTTTG
Dipodomys_ordii|434                ACCAGAGACATATGCACAGCTGCTTTTGCACCAAATTTGGAAGATATAAACAATATCTTG
Cavia_porcellus|12650              ACTGGAGACACTGGCACGGCTCCTTTTGCGCCAACTTTGGAAGACATAAACAATATTTTG
Microcebus_murinus|1583            ACAAGACACGCCGCAACAGCTCCTTTTGCGCCAAATTTGGAAGATATAAACAATATTTTG
Tarsius_syrichta|8004              ATAAGAGACACTGGCACAGCTCCTTTTGCACCAAATTTGGAAGATATAAACAATATTTTG
Callithrix_jacchus|24298           ACAAGAGACACTGGCACTGCTCCTTTCGCACCAAATTTGGAAGACATAAACAATATTTTG
Homo_sapiens|47954                 ACAAGAGACACTGGCACAGCTCCTTTTGCACCAAATTTGGAAGAAATAAACAATATTTTG
Gorilla_gorilla|17687              ACAAGAGACACTGGCACAGCTCCTTTTGCACCAAATTTGGAAGAAATAAACAATATTTTG
Pan_troglodytes|24569              ACAAGAGACACTGGCACAGCTCCTTTTGCACCAAATTTGGAAGAAATAAACAATATTTTG
                                   .  . . **      .  . * **** **.**.*.******.** **:.******* ***

Spermophilus_tridecemlineatus|3286 GAATCGAAATTTAAATCTCGGATTTCAAATCCCCAGGCCAAACCAAGTTCTTTTTTCTTG
Otolemur_garnettii|3416            GAGTCAAAATTTAAATCACGGGGTTCAAATCCCCAGGCCAAACCAAGCTCTTTTTTCTTG
Ochotona_princeps|11485            GAGACAAAATTTAAACCTCGGATTTCAAATCCCCAGGCCAAACCAAGTTCCTTTTTCTTA
Tupaia_belangeri|12172             GAGTCAAAATTTAAATCTCGGGGTTCAAATCCCCAGGCCAAACCAAGTTCTTTTTTCTTA
Mus_musculus|22105                 GAGTCAAAATTTAGATCCCGAGCTTCAAATCCCCAGGCCAAACCAAGTTCATTCTTTTTG
Rattus_norvegicus|21893            GAGTCAAAATTCAGATCCCGAGCTTCGAATCCCCAGGCCAAACCAAGTTCATTCTTTTTG
Dipodomys_ordii|434                GAGTCAAAATTTAAATCTCGGGTTTCAAATCCCCAGGCCAAACCAAGTTCATTTTTCTTG
Cavia_porcellus|12650              GAGTCAAAAATAAAACCTCAGATTTCAAATCCCCAGGCCAAACCAAATTCTTTTTTCTTG
Microcebus_murinus|1583            GAATCAAAATTTAAATCTCGGGTTTCAAATCCCCAAGCCAAACCAAGTTCTTTTTTCCTG
Tarsius_syrichta|8004              GAGTCAAAATTTAAATCTCGGGCTTCAAATTCCCAGACAAAACCCAGTTCTTTTTTCTTG
Callithrix_jacchus|24298           GAATCAAAATTTAAATCTCGAGCTTCAAATCCCCAGGCCAAACCCAGTTCCTTTTTCTTG
Homo_sapiens|47954                 GAATCAAAATTTAAATCTCGGGCTTCAAATGCCCAGGCCAAACCCAGCTCTTTTTTTTTG
Gorilla_gorilla|17687              GAATCAAAATTTAAATCTCGGGCTTCAAATGCCCAAGCCAAACCCAGCTCTTTTTTTTTG
Pan_troglodytes|24569              GAATCAAAATTTAAATCTCGGGCTTCAAATGCCCAGGCCAAACCCAGCTCTTTTTTTTTG
                                   **.:*.***:* *.* * *... ***.*** ****..*.*****.*. ** ** **  *.

Spermophilus_tridecemlineatus|3286 CAGATGCAGAAGAGAGTATCAGGTCAGTATGTGACATCTGCAGCTGCCAAGAATGTCCAT
Otolemur_garnettii|3416            CAGATGCAGAAGAGAGTATCAGGTCACTATGTGACGTCCGCAGCTGCCAAAAGTGTCCAC
Ochotona_princeps|11485            CAGATGCAGAAGAGAGCTTCAGGT---TACGTGACTTCTGCAGCTGCCAAAAGTGTTCNN
Tupaia_belangeri|12172             CAAATGCAGAAGAGAGCATCAGGTCACTATGTGACATCTGCCGCTGCCAAGAGTGTCCAC
Mus_musculus|22105                 CAGATGCAAAAGAGAGCATCAGGCCACTATGTGACATCTGCAGCTGCTAAGAGCGTCCAC
Rattus_norvegicus|21893            CAGATGCAAAAGAGAGCCTCAGGCCACTATGTGACATCTGCAGCTGCTAAGAGCGTCCAC
Dipodomys_ordii|434                CAGATGCAGAAGAGAGTATCAGGTCATTATGTCACATCTGCAGCTGCTAAGAGTGTCCAT
Cavia_porcellus|12650              CAGATGCAAAAGAGAGCATCAGGCCATTATGTCACGTCTGCAGCTGCCAAGAGCACACAC
Microcebus_murinus|1583            CAGATGCAGAAGAGAGTATCAGGTCACTATGTGACATCTGCAGCTGCCAAAAGTGTCCAT
Tarsius_syrichta|8004              CAGATGCAGAAGAGAGCATCTGGCCAGTATGTGACATCTGCTGCAGCCAAGAATGCCCAC
Callithrix_jacchus|24298           CAGATGCAGAAGAGAGTATTGGGTCACTATGTGACCTCTGCAGCTGCCAAGAGCGTCCAT
Homo_sapiens|47954                 CAGATGCAGAAGAGAGTATCGGGTCACTATGTGACATCTGCAGCTGCCAAGAGTGTCCAT
Gorilla_gorilla|17687              CAGATGCAGAAGAGAGTATCGGGTCACTATGTGACATCTGCAGCTGCCAAGAGTGTCCAT
Pan_troglodytes|24569              CAGATGCAGAAGAGAGTATCGGGTCACTATGTGACATCTGCAGCTGCCAAGAGTGTCCAT
                                   **.*****.*******  *  **    ** ** ** ** ** **:** **.*. .  *  

Spermophilus_tridecemlineatus|3286 ACTGTCCCTAATCCTGCCCCCAAGGAACTAATGAAAAAAGAGATAGAAAGGGACACACTG
Otolemur_garnettii|3416            CCTGCCCCTAACCCGACCCCCAAAGAACTAACAAGTAAAGAGGCAGAAAGGGACATGCCG
Ochotona_princeps|11485            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|12172             ACTGCCCCTAATCTTATTCCAAAGGAACCGACACATGCAGAGGTAGAAAGGGATCTGCAA
Mus_musculus|22105                 ACTGCCCCTGGGCCTGCCCCTAAAGAGCCAACAATCAAGGAGGTGCAGAGGGACCCACAG
Rattus_norvegicus|21893            ACTGCCCCTGGGCCTACCCCTAAAGAACCAACAATCAAGGAGGTGCAAAGGGACCCACAG
Dipodomys_ordii|434                ACTGTCCCTACTCCTACTCCAAAAGAGCTAACAAGTAAAGAGATGGAAAAGGATGTACTG
Cavia_porcellus|12650              ACTGCACCTAACGTTACTCCCAAAGAACTCCCAAATAGAGACTCAGGCAAGGACACACTG
Microcebus_murinus|1583            GCTGCCCCTAATCCTACACCAAAAGAACTGACGAATAAAGAGGCAGAAAGGGATACGCTG
Tarsius_syrichta|8004              GCTGCCCCCAGTCCTACTCCAAAAGAATTACCAAATAAGGTGGTAGGAAAGGATATGCTG
Callithrix_jacchus|24298           GCTGCCCCTAATCCTGCTCCAAGAGAACTGACAAATAAAGAGGCAGAAAAGAATACACTG
Homo_sapiens|47954                 GCTGCCCCTAATCCTGCTCCAAAAGAACTGACAAATAAAGAGGCAGAAAGGGATATGCTG
Gorilla_gorilla|17687              GCTGCCCCTAATCCTGCTCCAAAAGAACTGACAAATAAAGAGGCAGAAAGGGATATGCTG
Pan_troglodytes|24569              GCTGCCCCTAATCCTGCTCCAAAAGAACTGACAAATAAAGAGGCAGAAAGGGATATGCTG
                                     ..                    .              .          .         

Spermophilus_tridecemlineatus|3286 CCTCATTCAGAACAGACACTTCCTCCCTTAAGTAAAACTACTCACCCAGCTCCACAGCCC
Otolemur_garnettii|3416            CCTCCTCCAGAGCAGACTCTTTCTTCCTTAAGTAAAACAACCCACTCGGTCCCACAACCC
Ochotona_princeps|11485            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|12172             CTCCCGCCAGAGCAGCCTCTTTCTCCCTTAAGTAAAACAACTCACCTT---CCTCTCCCA
Mus_musculus|22105                 CTTTCTCCAGAACAGCATCCTTCTTCCTTAAGTGAAAGGACTCACTCTGCTCCGCTGCCC
Rattus_norvegicus|21893            CTTCCTCCAGAGCAGTGTCTTTCTCCCTTGAGTGAAAGGACTCACTCTGCTCCTCTGCCC
Dipodomys_ordii|434                CCTCCATCAGAACCGAGGCTGTCTCCCCTGAGTAAAACAATTCCCTCTGCTCCAGGGCAG
Cavia_porcellus|12650              CCTTCTCCAGAGCAGACTCTTTCTCCCTTAAGTAAAACAACTCACTGTACTCCCCTGCCC
Microcebus_murinus|1583            CCTCCTTCGGAGCAGACTCTTTCTCCCTTAAGTAAAACAACTCACTCTGGTCCACCACCC
Tarsius_syrichta|8004              CCTCCTCCTGAGCAGACTCTTTCTCCCTTAAGTAAAACAGCTCGCTCTGTCTCACAACCC
Callithrix_jacchus|24298           CCTTCTCCAGAGCAAACTCTTTCTCCATTAAGTAAAACGGCTCACTCTGTTCCACAGCCC
Homo_sapiens|47954                 CCTTCTCCGGAGCAGACTCTTTCTCCCTTAAGTAAAATGCCTCACTCTGTTCCACAACCC
Gorilla_gorilla|17687              CCTTCTCCGGAGCAGACTCTTTCCCCCTTAAGTAAAATGCCTCACTCTGTTCCACAACCC
Pan_troglodytes|24569              CCTTCTCCGGAGCAGACTCTTTCTCCCTTAAGTAAAATGCCTCACTCTGTTCCACAACCC
                                            .                  .  ..                           

Spermophilus_tridecemlineatus|3286 CAA---ATTAAAAAGATGGAGGATGACATCATCAACCAGAAACCTGCTGAAACCTCT---
Otolemur_garnettii|3416            CAT---GTGAAAAAAACTGATGCTAATGTCATCAGTCAGAAGCCTGCTGAAACCTCT---
Ochotona_princeps|11485            NNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---
Tupaia_belangeri|12172             CATCCCATTAAAAGTACCGGTGATGACATCATCAGTCAGAAGCCTGTGGAAACCTCT---
Mus_musculus|22105                 AAT---ATTTCAAAAGCTGATGATGATATAATT---CAGAAGCCTGCCGAGACCTCTCCT
Rattus_norvegicus|21893            AAT---ATTTCAAAAGCTGATGATAATAGAATT---CAGAAGCCTGCTGAGACTTCTCCT
Dipodomys_ordii|434                CAT---TTTACACAAACAGATGATGACATCATCAGACAGATTCCTGTTGAAACCTCC---
Cavia_porcellus|12650              CAT---GTTAGACACACTGGCGAGGCCGTCCTCACCCAGAAGCCTGCT------------
Microcebus_murinus|1583            CAT---GTTAAAAAAACTGATGATGACATCGTCAATCAGAAGCCTGCTGAAAGCTCT---
Tarsius_syrichta|8004              CAA---ATTCAAAATACGGATGATGACATCGTCAGTCAGAAGCCCACGGAAACCTCTCCT
Callithrix_jacchus|24298           CTT---GTTGAAAAAACTGATGATGATGTCATCGGTCAGAAGCCTGATGAAGCCTCT---
Homo_sapiens|47954                 CTT---GTTGAAAAAACTGATGATGATGTCATCGGTCAGGCTCCTGCTGAAGCCTCC---
Gorilla_gorilla|17687              CTT---GTTGAAAAAACTGATGACGATGTCATCGGTCAGGCTCCTGCTGAAGCCTCC---
Pan_troglodytes|24569              CTT---GTTGAAAAAACTGATGATGATGTCATTGGTCAGGCTCCTGCTGAAGCCTCC---
                                          .          .  .         .      .                     

Spermophilus_tridecemlineatus|3286 ------------------------------------------------------------
Otolemur_garnettii|3416            ------------------------------------------------------------
Ochotona_princeps|11485            ------------------------------------------------------------
Tupaia_belangeri|12172             ------------------------------------------------------------
Mus_musculus|22105                 CCTCCTGTAGCTCCCAAACCAATGACTCTTCGTGCCGAGACCTCTCCTCCTCCTGTATTT
Rattus_norvegicus|21893            CCTCCTGTAGCTCCCAAGCCTATGGCTCTTCCTGCCGAGACCTCTCCTCCTGCTGTAGCT
Dipodomys_ordii|434                ------------------------------------------------------------
Cavia_porcellus|12650              ------------------------------------------------------------
Microcebus_murinus|1583            ------------------------------------------------------------
Tarsius_syrichta|8004              ------------------------------------------------------------
Callithrix_jacchus|24298           ------------------------------------------------------------
Homo_sapiens|47954                 ------------------------------------------------------------
Gorilla_gorilla|17687              ------------------------------------------------------------
Pan_troglodytes|24569              ------------------------------------------------------------
                                                                                               

Spermophilus_tridecemlineatus|3286 ------------------------------------------------------------
Otolemur_garnettii|3416            ------------------------------------------------------------
Ochotona_princeps|11485            ------------------------------------------------------------
Tupaia_belangeri|12172             ------------------------------------------------------------
Mus_musculus|22105                 CCCAAACCAATGACTCTTCCTGCTGAGACC---------------TCTCCTCCTCCTGTA
Rattus_norvegicus|21893            CCCAAGCCTATGGCTTTTCCTGCCGAGACCTCTCTTCCTCCTGCCTCTCCTCTTCCTGTA
Dipodomys_ordii|434                ------------------------------------------------------------
Cavia_porcellus|12650              ------------------------------------------------------------
Microcebus_murinus|1583            ------------------------------------------------------------
Tarsius_syrichta|8004              ------------------------------------------------------------
Callithrix_jacchus|24298           ------------------------------------------------------------
Homo_sapiens|47954                 ------------------------------------------------------------
Gorilla_gorilla|17687              ------------------------------------------------------------
Pan_troglodytes|24569              ------------------------------------------------------------
                                                                                               

Spermophilus_tridecemlineatus|3286 ------------------------------------------------------------
Otolemur_garnettii|3416            ------------------------------------------------------------
Ochotona_princeps|11485            ------------------------------------------------------------
Tupaia_belangeri|12172             ------------------------------------------------------------
Mus_musculus|22105                 TTTCCCAAACCAATGACTCTTCCTGCCGAGACCTCTCTTCCTCTTGTATTTCCCAAACCA
Rattus_norvegicus|21893            GCTCCTAAGCCTATGGCTTTTCCTGCCGAGACCTCTCTTCCTCCTGTAGCTCCCAAGCCT
Dipodomys_ordii|434                ------------------------------------------------------------
Cavia_porcellus|12650              ------------------------------------------------------------
Microcebus_murinus|1583            ------------------------------------------------------------
Tarsius_syrichta|8004              ------------------------------------------------------------
Callithrix_jacchus|24298           ------------------------------------------------------------
Homo_sapiens|47954                 ------------------------------------------------------------
Gorilla_gorilla|17687              ------------------------------------------------------------
Pan_troglodytes|24569              ------------------------------------------------------------
                                                                                               

Spermophilus_tridecemlineatus|3286 ------------------------CCTCCTCCCGTAGCTCCCAAGCCTATGCCTCTTCCC
Otolemur_garnettii|3416            ------------------------CCTCCTCCCACGGCCCCGAAACCCGCGACGCTGCCT
Ochotona_princeps|11485            ------------------------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|12172             ------------------------CCTCCTCCCACAGCTCCAAAACCTGTGCCTCTTCCT
Mus_musculus|22105                 ATGACTCTTCGAGCCGAGACCTCTCCTCCTCCTGTAGCTGCCAAGCCTGTGGCTCTCCCT
Rattus_norvegicus|21893            ATGGCTCTTCCTACAGAGGCCTCTCCTCCTCCTGTAGCTCCCAAGCCTTTGGCTCTTCCT
Dipodomys_ordii|434                ------------------------CCGCCTCCCATAGCTCCCAAACCTGTGTCTCTTCCT
Cavia_porcellus|12650              ------------------------CCTCCCCCCATAGCACCCAAGCCTGTGCCTCTTCCC
Microcebus_murinus|1583            ------------------------CCTCCTACCATAGCTCCCAAACCTGCGACTCTTCCC
Tarsius_syrichta|8004              ------------------------CCTCCCCCCGTAGCACCAAAACCTGGGACTCTTCCC
Callithrix_jacchus|24298           ------------------------CCTCCTCCCATAGCTCCGAAACCTGTGACAATTCCT
Homo_sapiens|47954                 ------------------------CCTCCTCCCATAGCTCCAAAACCTGTGACAATTCCT
Gorilla_gorilla|17687              ------------------------CCTCCTCCCATAGCTCCAAAACCTGTGACAATTCCT
Pan_troglodytes|24569              ------------------------CCTCCTCCCATAGCTCCAAAACCTGTGACAATTCCT
                                                                       .             .    .    

Spermophilus_tridecemlineatus|3286 GCTAGTCAGGTAGCAGCAGTAAACCTGAAGACTTTGAAAACTTTTGGTGCCCCAAGACCA
Otolemur_garnettii|3416            GCTAGCCAGGTAGCAGCACTAAATCTGAAGACACTGAAAACTTTTGGTGCTCCACGACCC
Ochotona_princeps|11485            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|12172             GCTAGTCAGGTAGCAGCACTAAACCTGAAGACTTTGAAAACTTTCGGTGCCCCACGACCT
Mus_musculus|22105                 GGTAGTCAGGGAACATCACTAAACCTGAAGACCTTGAAAACATTTGGGGCCCCAAGACCA
Rattus_norvegicus|21893            GGTAGTCAGGGAGCCTCACTAAACCTGAAGACCTTGAAAACATTCGGGGCCCCGAGACCA
Dipodomys_ordii|434                GCTGGTCAGGCAGCATCACTGAATCTGAAGACTTTGAAAACTTTCGGTGCCCCACGGCCA
Cavia_porcellus|12650              ACTCCTCAGCCAGCAGCAGTAAATCTGAAGACTCTGAAAACTTTTGGCGCCCCCCGACCA
Microcebus_murinus|1583            TCTAGTCAGGTAGCAGCACTAAATCTGAAGACTTTGAAAACTTTTGGTGCCCCGCGACCA
Tarsius_syrichta|8004              ACTAGCCAGGCAGCAGCGCTAAATCTGAAGACTTTGAAAACTTTTGGTGCCCCACGGCCA
Callithrix_jacchus|24298           GCTAGTCAGGTATCCGCACAAAATCTGAAGACTCTGAAAACTTTTGGTGCCCCACGACCA
Homo_sapiens|47954                 GCTAGTCAGGTATCCACACAAAATCTGAAGACTTTGAAAACTTTTGGTGCCCCACGACCA
Gorilla_gorilla|17687              GCTAGTCAGGTATCCACACAAAATCTGAAGACTTTGAAAACTTTTGGTGCCCCACGACCA
Pan_troglodytes|24569              GCTAGTCAGGTATCCACACAAAATCTGAAGACTTTGAAAACTTTTGGTGCCCCACGACCA
                                     .     .                ..  .    ..      .. .. .      .    

Spermophilus_tridecemlineatus|3286 TACTCAAGTTCTGCTCCTTCGCCATTTGCCCTTGCTGTTGTGAAGAGGTCACAGTCTTTC
Otolemur_garnettii|3416            TACTCAAGCTCTGCTCCTTCGCCATTTGCCCTTGCTGTGGTGAAAAGGTCCCAGTCTTTC
Ochotona_princeps|11485            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTGAAAAAGCCCCAGTCCTTC
Tupaia_belangeri|12172             TTCTCCAGTTCTGCTCCTTCGCCATTTGCCCTTGCTGTAGTGAAAAGGTCACAGTCTTTC
Mus_musculus|22105                 TACTCCAGTTCTGGCCCCTCACCCTTTGCCCTTGCTGTGGTGAAAAGGTCACAGTCGTTC
Rattus_norvegicus|21893            TACAACAGTTCTGCCCCCTCACCCTTTGCCCTTGCTGTGGTGAAAAGGTCACAGTCGTTC
Dipodomys_ordii|434                TACTCAAGTTCTGCTCCTTCACCCTTTGCTCTGGCTGTAGTGAAAAGGTCACAGTCTTTC
Cavia_porcellus|12650              TTCTCCAGTTCCACTTCTTCACCATTTGCCCTTGCCGTCGTGAAAAGGTCACAGTCTTTC
Microcebus_murinus|1583            TACTCAAGCTCTGCACCTTCGCCGTTTGCCCTCGCTGTAGTGAAAAGGTCACAGTCTTTC
Tarsius_syrichta|8004              TACTCAAATTCGGGTCCTTCACCATTTGCCCTCGCTGTAGTGAAAAGGTCACAGTCTTTC
Callithrix_jacchus|24298           TACTCAAGTTCTGGTCCTTCACCATTTGCTCTCGCTGTAGTGAAAAGGTCACAGTCTTTC
Homo_sapiens|47954                 TACTCAAGTTCTGGTCCTTCACCGTTTGCTCTTGCTGTAGTGAAAAGGTCACAGTCTTTC
Gorilla_gorilla|17687              TACTCAAGTTCTGGTCCTTCACCATTTGCTCTTGCTGTAGTGAAAAGGTCACAGTCTTTC
Pan_troglodytes|24569              TACTCAAGTTCTGGTCCTTCACCGTTTGCTCTTGCTGTAGTGAAAAGGTCACAGTCTTTC
                                   .        .        .     ....   . .  .. *****.*.* *.***** ***

Spermophilus_tridecemlineatus|3286 AGTAAGGCACGGCCAGAGTCGCCCAGTGTGGGTGCATCCACCCAACCTCCAGCTCACACA
Otolemur_garnettii|3416            AGTAAAGCCCGTACTGAATCACCCAGTGACAGTGCACCTGCCTGCCCGCCAGCCAACCCA
Ochotona_princeps|11485            AGCAAGGAGCGTGCTGAGTCTTGCAGTGATCATGTGTCTGCC------CCAGCTGACTCA
Tupaia_belangeri|12172             AGTAAAACACGTACTGAGACATCCAGGGATGGTGCACCTGTCCAGCCTCTGAGTGACACA
Mus_musculus|22105                 AGTAAGGCATGCCCAGAGTCAGCCAGTGAGGGCTCCTCTGCCCTGCCTCCAGCTGCCACA
Rattus_norvegicus|21893            AGCAAGGCATCTCCAGAGTCACCCAGTGAGGACTCCTCTGCCCAGCCTCCAGCTGCCATA
Dipodomys_ordii|434                AGTAAGACGCGTCCTGAGACCTCCAGGGAGAGGATGTGTGCCCAGTCTCCAACTGACATA
Cavia_porcellus|12650              AGTAAGGTGCACACGGAGCCCTCCAGTGAGGAAGAAGCTGCCCAGCCTCCAGCCAGTGCA
Microcebus_murinus|1583            AGCAAAACACGCACCGAATCACCCAGCGATGGTGCATCTGCCCAACCTGCAGCCAACACA
Tarsius_syrichta|8004              AGTAAAACACGTACTGAGTCATGCAGTGAAGGGGCATCTGCCCAACCTCCAGCCAACACA
Callithrix_jacchus|24298           AGTAAAGAACGTACTGAGTCATCTAGTGCTGGTGCATCGGTTCAACCTCCAGCCAACACA
Homo_sapiens|47954                 AGTAAAGAGCGCACCGAGTCACCTAGTGCCAGTGCATTGGTCCAACCTCCAGCCAACACA
Gorilla_gorilla|17687              AGTAAAGAGCGCACCGAGTCACCTAGTGCCAGTGCATTGGTCCAACCTCCAGCCAACACA
Pan_troglodytes|24569              AGTAAAGAGCGCACCGAGTCACCTAGTGCCAGTGCATTGGTCCAACCTCCAGCCAACACA
                                   ** **..      * **. *    ** *   .       .          ..       *

Spermophilus_tridecemlineatus|3286 GAGGATGGGAAGACTTGCTGTGTACATAGGTGTGCAGACATCCCACAAATTGATATGATG
Otolemur_garnettii|3416            GAGGAGGGGAAGGCTCAGTCGGTAAATAAGTCTGTGGACAGTCCACAATTCAGTGTGACT
Ochotona_princeps|11485            AGGGAAGGCGCATTCTGTTCTGCAAACACAGTTGAGGATACCCCGCAACTCGATGCGGTT
Tupaia_belangeri|12172             GAAAAAGGGAACACTCATTCTGTAAATACATCAGTGGACATCCCACAGCTTGGTGTGACT
Mus_musculus|22105                 CAGGATGAAAAGACACATACAGTAAACAAGCCTACGGTGGGCTCCCAACATGGTGATGGT
Rattus_norvegicus|21893            CAGGATGGAAAGACACAAACAGTAAATCAGCCTACAGTGGGCTCCCAACATGATGGTGTT
Dipodomys_ordii|434                GAAGATAGGAAGATTTTTGCA---AATAAGTCCACAGACATTCCACAACCTGATGGGAGT
Cavia_porcellus|12650              GATGACAGGAAGACAGGCTCTGTAAACAAGTTTCCTGACGTTCCACGACTTGATGCGACA
Microcebus_murinus|1583            GAGGAAGGGAAGACTCATTCGCTAAATGAGTTTGTGGACATTCCACAATTCGGTGGGATT
Tarsius_syrichta|8004              GAGGAAGAGAAGACTCATTCTGTAAATAAATGTGTGGACATCCCACAGCCTGAGGTGATT
Callithrix_jacchus|24298           GAGGAAGGGAAGACTCATCCTGTAAATAAATTCGTGGACATCCCACAACTTGGTGTGATG
Homo_sapiens|47954                 GAGGAAGGGAAGACTCATTCTGTAAATAAATTTGTGGACATCCCACAGCTTGGTGTGTCT
Gorilla_gorilla|17687              GAGGAAGGGGAGACTTATTCTGTAAATAAATTTGTGGACATCCCACAGCTTGGTGTGTCT
Pan_troglodytes|24569              GAGGAAGGGAAGACTCATTCTGTAAATAAATTTGTGGACATCCCACAGCTTGGTGTGTCT
                                    . .* .. ..             .*   .      *: .   * *..   .. .     

Spermophilus_tridecemlineatus|3286 GATAAGCAAAACAACTCTGCACATAATGAACAAAATTCTCCAACACCAACTCCAGTTGAC
Otolemur_garnettii|3416            GATCAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|11485            GAGAAGGAAAATAAATCTGCCCATAATGAGCAAAATTCCAAAGAACCAACTGCAGCTGAC
Tupaia_belangeri|12172             GATCAGGGAAATAACTCTGCACATAATAAACAGAATCCCCAGATACCACCTCCAACCGAC
Mus_musculus|22105                 GATAAGCAAAATAATCCTGTACAGAATGAGCACAGTTCTCAAGTGCTGACTCCAGCTGAT
Rattus_norvegicus|21893            GATAAGCAAAATAAACCTGTTCAGAATGAGCACAGTTCTCAGAGGCTGACTCCCGCTGAT
Dipodomys_ordii|434                GATAAGCAAAATAACTCTCCATACAGTGAGCCCAACTCTCAAGTATCAACTCCAACTGAC
Cavia_porcellus|12650              GAGAATCAAAATAACTCTGCACATAATGAACAGAATTCTAAAATGCCAACTCCAACTGAC
Microcebus_murinus|1583            GATAAGGACAATAACTCTGCATATAATGAACAGAATTCTCAAATACCAACTCCAACTGAC
Tarsius_syrichta|8004              GATAAGGAAAATAACTCTGCACGTAATGAAGAGAATTCCCAAATACTGACTCCAACTGTC
Callithrix_jacchus|24298           GATAAGGAAAATAACTCTGCACATAATGAACAGAATTCTCAAATAACAACTCCAACTGAT
Homo_sapiens|47954                 GATAAGGAAAATAACTCTGCACATAATGAACAGAATTCCCAAATACCAACTCCAACTGAT
Gorilla_gorilla|17687              GATAAGGAAAATAACTCTGCACATAATGAACAGAATTCCCAAATACCAACTCCAACTGAT
Pan_troglodytes|24569              GATAAGGAAAATAACTCTGCACATAATGAACAGAATTCCCAAATACCAACTCCAACTGAT
                                   ** .*            .        .                       .      .  

Spermophilus_tridecemlineatus|3286 TGCCCA---TCATTCACCCTTAAGAGACAAAGTTCTTTAACATTCCAAAGCCCTGACCCA
Otolemur_garnettii|3416            NNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|11485            AGCCCA---TCCTTCACCCTTAAGAGACAAAGCTCTTTGACGTTGCAAAGCTCTGACCCA
Tupaia_belangeri|12172             TGCCCA---TCACTTACCCTTAAGAGACAAAGTTCTTTAACATTCCAAAGCTCTGACCCA
Mus_musculus|22105                 GGCCCA---TCGTTCACCCTTAAGAGACAGAGTTCTCTAACATTCCAGAGCTCTGACCCA
Rattus_norvegicus|21893            GGCCCGTCATCGTTCACCCTTCAGAGACAGAGTTCTCTCAACTTCCAGAGCTCTGACCCG
Dipodomys_ordii|434                TGCCCT---TCGTTCACCCTTAAGAGACAAAGTTCTTTAACATTCCAAAGCTCTGACCCA
Cavia_porcellus|12650              TGCCCA---TCATTCACTCTTAAGAGACAAAGTTCCTTAACATTCCAAAGCTCTGACCCA
Microcebus_murinus|1583            TGCCCA---TCATTCACCCTTAAGAGACAAAGTTCTTTAACATTCCAAAGCTCTGACCCA
Tarsius_syrichta|8004              TGTCCA---TCATTCACCCTTCAGAGACAAAATTCTTTAACATTCCAAAGCTCTGACCCA
Callithrix_jacchus|24298           CGCTCA---TCATTCACTCTTATGAGACAAAGTTCTTTACCATTGCAAAGCTCTGACCCA
Homo_sapiens|47954                 GGCCCA---TCATTCACTGTTATGAGACAAAGTTCTTTAACATTCCAAAGCTCTGACCCA
Gorilla_gorilla|17687              TGCCCA---TCATTCACTGTTATGAGACAAAGTTCTTTAACATTCCAAAGCTCTGACCCA
Pan_troglodytes|24569              TGCCCA---TCATTCACTGTTATGAGACAAAGTTCTTTAACATTCCAAAGCTCTGACCCA
                                    .       .   .     ..  . .       .   .    ..     .   ..     

Spermophilus_tridecemlineatus|3286 GAACAGATCCGACAGAGTTTACTGACTGCCATCCGTTCCGGAGAGGCTGCTGCCAAATTG
Otolemur_garnettii|3416            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTG
Ochotona_princeps|11485            GAACAGATCCGACAGAGTTTGCTGACTGCGATCCGTACTGGGGAGGCTGCGGCCAGGCTG
Tupaia_belangeri|12172             GAGCAGCTCCGACAGACTTTGCTGACTGCAATCCGTTCTGGAGAGGCTGCTGCCAAATTG
Mus_musculus|22105                 GAGCACGTACGACAGAGCTTGCTCACTGCAATCCGGTCTGGAGAGGCTGCTGCCAAGTTG
Rattus_norvegicus|21893            GAGCACATCCGGCAGAGCTTGCTCACCGCAATCCGGTCTGGAGAGGCTGCTGCCAAGTTG
Dipodomys_ordii|434                GAACAGATCCGACAAAGCTTGCTGACTGCAATTCGTTCTGGAGAGGCTGCTGCCAAGCTG
Cavia_porcellus|12650              GAACAGATCCGACAGAGTTTGCTGACTGCAATCCGTTCTGGAGAGGCTGCTGCTAAATTG
Microcebus_murinus|1583            GAACAGATCCGACAGAGTTTGCTGACTGCGATCCGTTCTGGAGAGGCTGCTGCCAAATTG
Tarsius_syrichta|8004              GAACAGATTCGACAGAGTTTGCTGACTGCAATCCGTTCTGGAGAGGCTGCTGCCAAATTG
Callithrix_jacchus|24298           GAACAGATGAGACAGAGTTTGCTGACTGCAATCTGTTCAGGAGAGGCTGCTGCCAAATTG
Homo_sapiens|47954                 GAACAGATGCGACAGAGTTTGCTGACTGCAATCCGTTCGGGAGAGGCTGCTGCCAAATTG
Gorilla_gorilla|17687              GAACAGATGCGACAGAGTTTGCTGACTGCAATCCGTTCGGGAGAGGCTGCTGCCAAATTG
Pan_troglodytes|24569              GAACAGATGCGACAGAGTTTGCTGACTGCAATCCGTTCGGGGGAGGCTGCTGCCAAATTG
                                   .      .  .       ..  .    .   .  .    .. . .. ..  .      **

Spermophilus_tridecemlineatus|3286 AAAAGGGTTACTGTTCCACCAAATACGATATCTGTGAATGGGAGGTCAGGACTCAGCCAT
Otolemur_garnettii|3416            AAAAGGGTCACTGTTCCGTCAAATACTGTATCTGTGAACGGAAGGTCAAGACTCGGCCGT
Ochotona_princeps|11485            AAGCGGGTTACTGTTCCATCAAATACGATATCTGTGAATGGAAGATCTGGACTCGGTCAG
Tupaia_belangeri|12172             AAAAGGGTCACTGTTCCTTCAAATACAATATCTGTGAACGGAAGGTCAAGACTCAGCCAG
Mus_musculus|22105                 AAGAGAGTTACTGTTCCATCGAATACAATATCTGTGAATGGGAAGTCGGGCCTCAGCCAG
Rattus_norvegicus|21893            AAGAGAGTTACTGTTCCGTCAAATAGAATATCTGTGAATGGGAAGTCGGGGCTCAGCCAG
Dipodomys_ordii|434                AAAAGAGTTACTGTTCCATCAAATACAATATCTGTGAATGGAAGGTCACGATTGAGCCGT
Cavia_porcellus|12650              AAAAGAGTTACTGTTCCATCGAATACGATATCTGTGAATGGAAGGTCACGACTTAGCCAA
Microcebus_murinus|1583            AAAAGGGTTACCGTTCCATCAAATACAATATCTGTGAATGGAAGGTCAAGACTCAGCCAG
Tarsius_syrichta|8004              AAAAGGGTTACCATTCCATCAAATACATTATCTGTGAATGGAAGGTCAAGACTCAGCCAT
Callithrix_jacchus|24298           AAAAGGGTTACTATTCCATCAAATACAATATCTGTGAATGGAAGGTCAAGACTCAGCCAT
Homo_sapiens|47954                 AAAAGGGTTACCATTCCATCAAATACAATATCTGTGAATGGAAGGTCAAGACTCAGCCAT
Gorilla_gorilla|17687              AAAAGGGTTACCATTCCATCAAATACAATATCTGTGAATGGAAGGTCAAGACTCAGCCAT
Pan_troglodytes|24569              AAAAGGGTTACCATTCCATCAAATACAATATCTGTGAATGGAAGGTCAAGACTCAGCCAT
                                   **..*.** ** .****  *.****   ********** **.*..**  *  * .* *. 

Spermophilus_tridecemlineatus|3286 ---TCCATGTCCTCTGATGCCCAGGATGGCCATTAA
Otolemur_garnettii|3416            ---TCCTTGTCTTCTGATGCCCAGGACGGCCCTTGA
Ochotona_princeps|11485            ---CCCATGCCCCCAGACGCCCAGCACAGCTGTTAA
Tupaia_belangeri|12172             ---CCCGTGTCCTCTGATGTCCAGGATGGCCATTAA
Mus_musculus|22105                 ---TCCATGTCCATTGACGCCCAGGACAGTCGCTAA
Rattus_norvegicus|21893            ---CCCATGTCCATTGATGCCCAGGACAGTTGCTGA
Dipodomys_ordii|434                ---TCCCTATCCTCTGATGCCCAGGAGAGCCCTTAA
Cavia_porcellus|12650              ---TCCCTGTCCTCCGATGCCCAGGAAGGCTGTTAA
Microcebus_murinus|1583            ---TCCATATCCCCTGATGCCCAGGATGGCCATTGA
Tarsius_syrichta|8004              ---TCTGTGTCCCCTGATGCCCAGGACGGCCGTTAA
Callithrix_jacchus|24298           TATTCCATGTCCACTGATGCCCAGGACGGC------
Homo_sapiens|47954                 ---TCCATGTCCCCTGATGCCCAGGACGGCCATTAA
Gorilla_gorilla|17687              ---TCCATGTCCCCTGATGCCCAGGACGGCCGTTAA
Pan_troglodytes|24569              ---TCCATGTCCCCTGATGCCCAGGACGGCCGTTAA
                                       *  *. *    ** * **** * .*       

multiple sequence alignment in CLUSTALW format


Spermophilus_tridecemlineatus|2930 ---------------------------------------MDSQPPCPRAAPAGXXXXXXX
Otolemur_garnettii|2945            -----------------------------------------------------RKPKAKA
Ochotona_princeps|10018            RPTSFPALEGQAARPDLPFPTPAVTRRFRAGARAEPRRAMDGRASSAHDARAGRKPKAKA
Tupaia_belangeri|10540             ---------------------------------------MDCRTPSVQDAP--RKPKGKA
Mus_musculus|2394                  ---------------------------MDRSVPDPLPRSAPRTPAMQPAGSAGRKTKGKA
Rattus_norvegicus|11886            -----------------------------------------------------RKTKAKA
Dipodomys_ordii|406                -----------------------------------------------------RKPKARA
Cavia_porcellus|9905               ----------------------------------------------------RRKTKAKA
Microcebus_murinus|1349            ------------------------------------------------------------
Tarsius_syrichta|7329              -----------------------------------------------------RKPKAKA
Callithrix_jacchus|16511           ---NRAAEAAASSRTPGREMGQAVTRRLGAGARATPRRAMDGRTPHSQDAQFRRKPKAKA
Homo_sapiens|389                   ---------------------------------------MDGRTPRPQDAPARRKPKAKA
Gorilla_gorilla|14125              -MCGRAAEAAASSRTPGREMGQAVTRRLGAGARAAPRRAMDGRTPRPQDAPARRKPKAKA
Pan_troglodytes|8774               -MCGRAAEAAASSRTPGREMGQAVTRRLGAGARAAPRRAMDGRTPRPQDVPAGRKPKAKA
                                                                                               

Spermophilus_tridecemlineatus|2930 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Otolemur_garnettii|2945            PLPPAETKHVDVSSVSNSEESAAFNMEQKENTIDKDIELSVVLPGDVIKSTTVPGSKPMM
Ochotona_princeps|10018            PLPPTDTKNVDVSSTEDSVESASFIMEQKENMIDRDIELSVVLPGDIIKSTTVHGSKPMM
Tupaia_belangeri|10540             PLPPAETKSVDVSAVDESVESTPFSMEQKENMIERDIELSVVLPGDVIKSTTVHGSKPMM
Mus_musculus|2394                  PLPPAETKGTDVSSAEDPVESTAVVTEQQDNMIDKDIELSVVLPGDILKSTTVHGSKPMM
Rattus_norvegicus|11886            PLPPAEMKGMDVSSAEDPVESIPVSTEQHDNMIDKDIELSVVLPGDVLKSTTVHGSKPMM
Dipodomys_ordii|406                PLPPCETKCVDVSSADGSAKPT---MEQKENRTDKDIELSVVLPGDIIKSTTVHGXXXXX
Cavia_porcellus|9905               PLPPAETKYVDASSFDDSVESAAFIMEQKENIIDKDIDLTVVLPGDIIKSTTVHGSKPMM
Microcebus_murinus|1349            ------------------------------------------------------------
Tarsius_syrichta|7329              PLPPAEIKYADFASVPDSVESTAFSMEQK-NMIDRDIEFSVVLPGDVIKSTTVHGS-PMM
Callithrix_jacchus|16511           PLPPAETKYVDVSSAADSVESTTFIMEQKENMIDKDIELSVVLPGDIIKSTTVHGSKPMM
Homo_sapiens|389                   PLPPAETKYTDVSSAADSVESTAFIMEQKENMIDKDVELSVVLPGDIIKSTTVHGSKPMM
Gorilla_gorilla|14125              PLPPAETKYTDVSSAADSVESTAFIMEQKENMIDKDVELSVVLPGDIIKSTTVHGSKPMM
Pan_troglodytes|8774               PLPPAETKYTDVSSAADSVESTAFIMEQKENMIDKDVELSVVLPGDIIKSTTVHGSKPMM
                                                                                               

Spermophilus_tridecemlineatus|2930 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Otolemur_garnettii|2945            DLLIFLCAQYHLNPSSYTIDLLSAEKNHIKFKPNTPIGMLEVEKVILKPKLLDKKKPTPI
Ochotona_princeps|10018            DLLIFLCAQYHLNPSSYTIDLLSAEKNPIKFKPNTPIGMLEAEKVVLKPKVLDRKKPTPI
Tupaia_belangeri|10540             DLLIFLCAQYHLNPSSYTIDLLSAEKNHVKFKPNTPIGMLEVEKVILKPKNVDKKKPTPI
Mus_musculus|2394                  DLLVFLCAQYHLNPSSHTIDLLSAEENLIKFKPNTPIGMLDVEKVILKPKSLDKKKPTPI
Rattus_norvegicus|11886            DLLVFLCAQYHLNPSSHTINLLSAEENLIKFKPNTPIGMLEVEKVILKPKSLDKKKPTPI
Dipodomys_ordii|406                XXXXXXXAQYHLNPSSYTIDLLSADQNHIKFKPNTPIGILEVEKVILKPKNLDKKKPTPL
Cavia_porcellus|9905               DLLIFLCAQYHLNPSSYTIDLLSAEKNNIKFKPNTPIGMLDVEKVILKPKNLDKKKPTPI
Microcebus_murinus|1349            ---------YHLNPSSYTIDLLSAEKNHIKFKPNTPIGMLEVEKVILKPKILDKKKPTPI
Tarsius_syrichta|7329              DLLIFLCAQYHLNPSSYTIDLLSAEKRHIKFKPNTPIGMLEVEKVILKPKILDKKKPTPI
Callithrix_jacchus|16511           DLLIFLCAQYHLNPSSYTIDLLSAEQNHIKFKPNTPIGMLEVEKVILKPKMLDKRKPTPI
Homo_sapiens|389                   DLLIFLCAQYHLNPSSYTIDLLSAEQNHIKFKPNTPIGMLEVEKVILKPKMLDKKKPTPI
Gorilla_gorilla|14125              DLLIFLCAQYHLNPSSYTIDLLSAEQNHIKFKPNTPIGMLEVEKVILKPKMLDKKKPTPI
Pan_troglodytes|8774               DLLIFLCAQYHLNPSSYTIDLLSAEQNHIKFKPNTPIGMLEVEKVILKPKMLDKKKPTPI
                                                                                               

Spermophilus_tridecemlineatus|2930 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Otolemur_garnettii|2945            IPEKTVRVVINFKKTQKTIVRVSPHASLQELVPTICSKCEFDPFHTLLLKDYQSQEPLDL
Ochotona_princeps|10018            IPEKTVRVVINFKKSQKAIVRVNPHASLQELTPIICSKCDFDPSHTLLLKDYQSQEPLDL
Tupaia_belangeri|10540             IPEKTVRVVINFKKTQKAIVRVSPHASLQELAPIICSKCEFDPLHTLLLKDYQSQEPLDL
Mus_musculus|2394                  IPEKTVRVVINFKKTQKTIVRVSPHAPLQDLAPIICSKCEFDPLHTVLLKDYQAQEPLDL
Rattus_norvegicus|11886            IPEKTVRVVINFKKTQKTIVRVSPHSPLQDLAPIICSKCEFDPLHTVLLKDYQAQEPLDL
Dipodomys_ordii|406                IPEKTVRVVINFKKTQKTIVRVGPHTPLQELLPIICDKCEFDPLHTLLLKDHQSQEPLDL
Cavia_porcellus|9905               IPEKTVRVVINFKKTQKAIVRVSPHASLQELVPTICSKCEFDPSHTLLLKDYQSQEPLDL
Microcebus_murinus|1349            IPEKTVRVVINFKKTQKTIVRVSPHASLEELIPIICSKCEFDPLHTLLLKEYQSQEPLDL
Tarsius_syrichta|7329              IPEKTVRVVINFKKTQKTIVRVSPHASLQELAPIICSKCEFDPLHTLLLKDYQSQEPLDL
Callithrix_jacchus|16511           IPEKTVRVVVNFKKTQKTIVRVSPHASLQELAPIICSKCEFDPLHTLLLKDYQSQEPLDM
Homo_sapiens|389                   IPEKTVRVVINFKKTQKTIVRVSPHASLQELAPIICSKCEFDPLHTLLLKDYQSQEPLDL
Gorilla_gorilla|14125              IPEKTVRVVINFKKTQKTIVRVSPHASLQELAPIICSKCEFDPLHTLLLKDYQSQEPLDL
Pan_troglodytes|8774               IPEKTVRVVINFKKTQKTIVRVSPHASLQELAPIICSKCEFDPLHTLLLKDYQTQEPLDL
                                                                                               

Spermophilus_tridecemlineatus|2930 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASAPATP
Otolemur_garnettii|2945            TKSLNDLGLRELYAMDVSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Ochotona_princeps|10018            TKSLNDLGLRELYAMDISRESCQIPQNLDFMKEKENKGFFSFFQRSKKKREQTASAPATP
Tupaia_belangeri|10540             TKSLNDLGLRELYAMDANRESCQISQNLDIMKEKENKGFLSFFQRSKKKRDQTASAPATP
Mus_musculus|2394                  TKSLNDLGLRELYAMDISRESCQISHNPDIVKEKENKGIFSFFQRSKKKREQTASAPATP
Rattus_norvegicus|11886            TKSLNDLGLRELYAMDISRESCQISHNPDIVKEKENKGIFSFFQRSKKKREQTASAPATP
Dipodomys_ordii|406                TKSLNDLGLRELYAMDVSRESCQIPQSLDIMKEKENKGFFSFFQRSKKKREQTASAPATP
Cavia_porcellus|9905               TKSLNDLGLRELYAMDVSGESSQVSPNLDIMKEKESKGFFSFFQRSKKKREQTASAPATP
Microcebus_murinus|1349            TKSLNDLGLRELYAMDVSRESCQISPNLDIMKEKENKGFFSFFQRSKKRREQTASAPATP
Tarsius_syrichta|7329              TKSLNDLGLRELYAMDVNRESCQISPNLDIMKEKENKGFFSFFQRSKKKRDQTASAPATP
Callithrix_jacchus|16511           TKSLDDLGLRELYAMDVNRESCPISQNLDIMKEKENKGFFSFFQRSKKKRDQTASAPATP
Homo_sapiens|389                   TKSLNDLGLRELYAMDVNRESCQISQNLDIMKEKENKGFFSFFQRSKKKRDQTASAPATP
Gorilla_gorilla|14125              TKSLNDLGLRELYAMDVNRESCQISQNLDIMKEKENKGFFSFFQRSKKKRDQTASAPATP
Pan_troglodytes|8774               TKSLNDLGLRELYAMDVNRESCQISQNLDIMKEKENKGFFSFFQRSKKKRDQTASAPATP
                                                                                               

Spermophilus_tridecemlineatus|2930 LINKHHPTFLRSNAISKPHVSNILPSDAPKRRCAPLPPMAASQSAPQDLTNVQERPASCV
Otolemur_garnettii|2945            XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAPLPPMPASQSVPQDLAQAQESPASCV
Ochotona_princeps|10018            LINKHRPTFARSNTISKPYISNTLPSEAPKKRRAPLPPMPASQSEPHDLARIQERPASHM
Tupaia_belangeri|10540             LVTKHRPTFVRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQRVPQDPVNIQERPASCV
Mus_musculus|2394                  LVSKHRPSFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPTSQGAAQG----QERRASCV
Rattus_norvegicus|11886            LVSKHRPSFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPTSQGAAQG----QERRASCV
Dipodomys_ordii|406                LINKHRPSFTRSNTISKPYVSNTLPSDAPKKRRAPLPPMPTSQSAPQDLEHTQNRPTSCV
Cavia_porcellus|9905               LINKHRPTFVRSNTLSRPYVSNTLPSDAPKKRRAPLPPMLASQIAPQDLEQPQERAGSSV
Microcebus_murinus|1349            LINKHRPTFVRSNTVSKPYVSNTLPSDAPKKRRAPLPPMPASQSVPQDLAHIQERPASCV
Tarsius_syrichta|7329              LVNKHRPTFMRSNTISKPYTSNTLPSDAPKKRRAPLPPMSASQSAPQDLGRIQERPVSCV
Callithrix_jacchus|16511           LVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQSVPQDLAHIQERPASCI
Homo_sapiens|389                   LVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQSVPQDLAHIQERPASCI
Gorilla_gorilla|14125              LVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQSVPQDLAHIQERPASCI
Pan_troglodytes|8774               LVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQSVPQDLAHIQERPASCI
                                                                    ****** :**  .:.    *:   * :

Spermophilus_tridecemlineatus|2930 LKSTSVEETDKSPCEAGMVRTGLLQLS-SSSIGTSSLRRTKRKAPSPPSKTAQHSSDGNG
Otolemur_garnettii|2945            VKSMSVDETDKSPRGAGMVRTGSLQLK-GTSTANASLRRTKRKAPSPPSKLPLHQTEEGS
Ochotona_princeps|10018            VKSTSVDENDKSPGGADIMRTGSLS---STSTGNSSLKRMKRKAPSPPSKIPSHQSVENS
Tupaia_belangeri|10540             VKSMSVDETEKXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Mus_musculus|2394                  ERSTSVDDTDKSSSEAIMVRTGSLQLS-STSIGTSSLKRTKRKAPAPPSKTPLAQTDERN
Rattus_norvegicus|11886            ERSTSVDDTDKSSSEGFMVRTGSLQLSGSTSVGTSSLKRTKRKAPAPPSKPSLTETDEGS
Dipodomys_ordii|406                MKSTSMDETDKSPHEAVIVRTGSLQLS-HTSTGNSSLKRTKRKAPSPPSKLPLHHSDEDG
Cavia_porcellus|9905               VKSTGVEEADESPREAGRARTGSLPLS-STSEGNLSLKRTKRKAPSPPTKIPLRQSTENG
Microcebus_murinus|1349            VKSMSVEETDKXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tarsius_syrichta|7329              MKSVSVDETDKSPCEAGIVRTGSLP---HSSTGNSSLRRTKRKAPSPPSKIPQHQSDENS
Callithrix_jacchus|16511           VKSMSVDETDKSPCEEGRVRAGSLQLS-STSAGNSSLRRTKRKAPSPPSKISLHQSDENS
Homo_sapiens|389                   VKSMSVDETDKSPCEAGRVRAGSLQLS-SMSAGNSSLRRTKRKAPSPPSKIPPHQSDENS
Gorilla_gorilla|14125              VKSMSVDETDKSPCEAGRVRAGSLQLS-STSAGNSSLRRTKRKAPSPPSKIPPHQSDENS
Pan_troglodytes|8774               VKSMSVDETDKSPCEAGRVRAGSLQLS-STSAGNSSLRRTKRKAPSPPSKIPPHQSDENS
                                    :* .::: ::                                                 

Spermophilus_tridecemlineatus|2930 PVTA--LQLVDGIPPDSALETSSPEGPSSPEAYLGPGLLSHEHSTVPKLTDEASLSEGPG
Otolemur_garnettii|2945            PVTV--MQSVDGISPDSVSEANSAEGLPSPEASLGPGLLSEEECVTRKVTEESSFSEGSG
Ochotona_princeps|10018            PVTV--PQSEDGVPADSASEASSPEALSSPGASLGPASPHQEQCTTPTLLEEPTLSEGPG
Tupaia_belangeri|10540             XXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Mus_musculus|2394                  SAMAHGLPLEDGIAPDSMLELSSPEGMSTPEGSLGPGFLSQEQCAVPKPPDE--ISEGPG
Rattus_norvegicus|11886            SAAAHGLPLEDGIVPDSISEVSSPEGMSSPECSEGPGFLSQEECSVPKPMDE--ISEGPG
Dipodomys_ordii|406                HVTA--PKSVDGVPPHSVFKANSPEPLNSPEASLGSGLLSHEHCTLPKLTDETSLSESPG
Cavia_porcellus|9905               HPTV--LQAVDGVSPDSISEATSPEGLPSPEGCLGPGLFHQERCTTPKLPDESSLSEGPG
Microcebus_murinus|1349            XXXX--XXXXXXXXXXXXXXXXXXXXXXXXXASLGPGLVSHEECTAPNLTEETP--ECPG
Tarsius_syrichta|7329              HVTA--VHSVDGAPPESVSEPKSPEGLSSTESSPNPQLPRQEQYTVSKVTEESSFSESPG
Callithrix_jacchus|16511           HVSA--LQPEGGVPSDSVSEANSPVELSSPETSFGPGLSSQEQCTASNLMEETSVFECPG
Homo_sapiens|389                   RVTA--LQPVDGVPPDSASEANSPEELSSP------------------------------
Gorilla_gorilla|14125              RVTA--LQPVDGVPPDSASEANSPEELSSPE-TFHPGLSSQEQCTAPKLMEETSVFECPG
Pan_troglodytes|8774               RVTA--LQPVDGVPPDSASEANSPEELSSPE-TFHPGHSSQEQCTAPKLMEETSVFECPG
                                                                                               

Spermophilus_tridecemlineatus|2930 TPEAA---IASLTSGISSDYSLEEIEEKEELSEGPKDEVENISLKSPDIPFASTDITNTL
Otolemur_garnettii|2945            TPEAA---VASVTSRINSDYSLEEIDEKEELSEVPKDEAENMSLKSQDISSVSTDIINAL
Ochotona_princeps|10018            TPEAAVPSVASLTSGISSDYSLEEIDEKEELREVPKDEAENISLKSPHSYVVSTDVTNAL
Tupaia_belangeri|10540             XX------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Mus_musculus|2394                  TPEAA---VASLTSGVSSDYSLEEIDEKEELSEASKDPAGSISVKSPDIASASTDMRITV
Rattus_norvegicus|11886            TPEAA---VASMTSGVSSDYSLEEIDEKEELMEASKDQAG--SVKSPTIASASTDMIITA
Dipodomys_ordii|406                TPEGA---VASLTSGISSDYSLEEIDEKEELNEVPEDPSENTSLKSLSVPLSSTTTVNML
Cavia_porcellus|9905               TPEAA---VASLTSGISSDYSLEEIDEKEELSEMPKHEAENISLKSPDIAFVSTDIISTL
Microcebus_murinus|1349            TPEAA---VAS-PSGINSDYSLEEIDEKEELSEVPKDEAENISLKSQDIPFVSTDKINAL
Tarsius_syrichta|7329              TPEAA---VTSWTSGVSSDYGLEEIDERKELSEVPEDEAKNVSLKSQDILFVSPDIINIP
Callithrix_jacchus|16511           TPEAA---ITSLTCRWSGLSRVXXXXXKEELSEVPKVEAENICVKSQDIPFVSTDTINTL
Homo_sapiens|389                   -------------AGISSDYSLEEIDEKEELSEVPKVEAENISPKSQDIPFVSTDIINTL
Gorilla_gorilla|14125              TPEAA---ITSLTSGISSDYSLEEIDEKEELSEVPKVEAENISPKSPDIPFVSTDIINTL
Pan_troglodytes|8774               TPEAA---ITSLTSGISSDYSLEEIDEKEELSEVPKVEAENISPKSQDIPFVSTDIINTL
                                                                                               

Spermophilus_tridecemlineatus|2930 KNDSDSALGINSREASQNSKEENQETRNTDGPXX-XXXXXXXXXXXXXXXXXXXXXXXXX
Otolemur_garnettii|2945            KNDPDSALGNESAKSSQNS-------------GP-PSGVYDTSHKEVVVDNIRSSKSLGQ
Ochotona_princeps|10018            KNDPDSTPGSEREESSQNDKEEKQKTGTTDGQET-HTIVHDTSNGGIAMDTVTNLKSLGP
Tupaia_belangeri|10540             XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Mus_musculus|2394                  EKDPDSALGISDGETSPSSKGKTQEGRSTEGQGPYHPVVGHIGNEDRVSDSIKDMKTLGP
Rattus_norvegicus|11886            ENDPDSALSISDGETSPGSKGNTPEGRNPEGQGPHHPVECLIGNENNVSDSIKDLKTLSP
Dipodomys_ordii|406                KNDLYSALGTGSGQASQNVKNKAQETRNTDGKGQ-HNAAHDNSNEDPVAGH-------SP
Cavia_porcellus|9905               KKDPDSVLGTDSGEASQNSKEENQEAGNTDGQGS-HSVVYDSSNENMLPDGVRNLQSLSP
Microcebus_murinus|1349            KNDPDSALGNESGKSSQNSKEEKHKTRSTNGQGP-HSTIYDTSNEELVVDSIRSSKSLGP
Tarsius_syrichta|7329              KNDPDSAPGIDSGESLQNSKEEKQXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXX----
Callithrix_jacchus|16511           KNDPDSALGNDGGEFSQNSKEEKQESRSTNGQEP-HSVVYDTSNEKKVVDSLRNLKSLGP
Homo_sapiens|389                   KNDPDSALGNGSGEFSQNSMEEKQETKSTDGQEP-HSVVYDTSNGKKVVDSIRNLKSLGP
Gorilla_gorilla|14125              KNDPDSALGNGSGEFSQNSMEEKQETKSTDGQEP-HSVVYDTSNGKKVVDSIRNLKSLGP
Pan_troglodytes|8774               KNDPDSALGNGSGEFSQNSMEEKQETKSTDGEEP-HSVVYDTSNGKKVVDSIRNLKSLGP
                                                                                               

Spermophilus_tridecemlineatus|2930 XXXX-XQNEIIVLTTNTEDTMKDRVRRTEIIVEGEAK--NKDAVMEVDRQSSYQAHKTVN
Otolemur_garnettii|2945            NQEN-VQNEIIVVPKNAEDNMKNGARRTDTNVGGVTK--SNSVAMEVDRLSNSLACETGI
Ochotona_princeps|10018            NKEN-VPNGVAVFTTNMEDNIKNR----ENSVGSVAK--NKDVDMEVNRQPDHPGFKSHS
Tupaia_belangeri|10540             XXXXXXHHEKTVFPMNTEDNMKTRVKKTEVNVGGVAT--NNNVDIKVDTLPNFQVYKTDP
Mus_musculus|2394                  NQESVVQNEIMVCATST-DYVKNRPGKMETTIEGEGEALKKASDMETDRLSGSPACRMDN
Rattus_norvegicus|11886            NQESVIQNEVVVCATST-DYVKNRPREMEATIEGEAQ--KKVGDVEAERLSGSPAGRMDD
Dipodomys_ordii|406                NQKI-XXXXXXXXXXXXXXXXXXXXXXXXVNVEG-SK--NTGVHKGNDAL----------
Cavia_porcellus|9905               NEKN-VQNETNILATKTEDKMKNSVRKTEICVDE-AK--NKDINMRVDKLPQCRACETDS
Microcebus_murinus|1349            NQEN-VQNEI-VLPKNTEDNVKNGVRTTEINVRGVTK--SNNMDREVDRLSNSQACETDT
Tarsius_syrichta|7329              -----XXQNIIIFSENRDDNIKNGVRKTEITVGAVAK--NNDMDTDVVRLSDSRVHKTHT
Callithrix_jacchus|16511           NQEN-VQNEIIVFPKNTEDNMKNEVKKTEINVGGVAK--NNDIDMEVERPSNSQAHETDT
Homo_sapiens|389                   NQENVVQNEIIVYPENTEDNMKNGVKKTEINVEGVAK--NNNIDMEVERPSNSEAHETDT
Gorilla_gorilla|14125              NQEN-VQNEIIVYPENTEDNMKNGVKKTEINVGGVAK--NNNIDMEVERPSNSEAHETDT
Pan_troglodytes|8774               NQEN-VQNEIIVYPENTEDNMKNGVKKTEINVGGVAK--NNNIDMEVERPSNSEAHETDI
                                                                  :       ..                   

Spermophilus_tridecemlineatus|2930 VVTSKENHLAVASVPDHKLNQLGAEKMKMQDAAIQTIPSSNSSEGNHQDHNLPAFKVDES
Otolemur_garnettii|2945            IMSDAENHLSALSGPDQKLNQPSGEKT--QDAAIQTAPSCDGFYRNHQDHNLPDLKVNER
Ochotona_princeps|10018            ALSSRENDLAASTG--QKPSQPTAEKTTMQDAAIQTAPSCSNFTENHQDQNLSTFKVDEI
Tupaia_belangeri|10540             AVSCKENHPSVSSGPDQKLNQLIAEKIKMQDAAIQTTPSSNSFGKNHQANNLSDFKVDES
Mus_musculus|2394                  VKSSRENHLTASPGPDQKLNQPGVEKTKMQDAAIQATPARGTFDGNHEVSNSSDPRADET
Rattus_norvegicus|11886            VQSSRENHLTASPGPDQKSNQPRVEKTKMQDAAIQATPACSTFDGNHEAHNSPDLRVDET
Dipodomys_ordii|406                ----RKEILAATSVPDQALSQLE-EKTKMQDVATQTASSCNSLNESHQDHNLSDFKTDES
Cavia_porcellus|9905               FISSKENHGVVASLPDQKLNQHRTEKTKMQDAAIQTTPSCNSLNGNHQDRNLSDFKVDES
Microcebus_murinus|1349            IINHKEIRVAASSVPDQKLKQPSAEKTKMQDAAIQTTPSYNSFHRNHQDQNLSDLKVDES
Tarsius_syrichta|7329              TVNYKENHLAASSVPDQKMNQPDAEKTKMQDAAIQTTPSSNSFCGNQQDHYLSDFKINES
Callithrix_jacchus|16511           SISYKENRLAASLVPDQKLNQPSAEKTKMQDVAIQTTPSCNSFDWKHQDHNLSDFKVEES
Homo_sapiens|389                   AISYKENHLAASSVPDQKLNQPSAEKT--KDAAIQTTPSCNSFDGKHQDHNLSDSKVEEC
Gorilla_gorilla|14125              AISYKENHLAASSVPDQKLNQPSAEKTKMQDAAIQTTPSCNSFDGKHQDHNLSDSKVEEC
Pan_troglodytes|8774               AISYKENHLAASSVPDQKLNQPSAEKTKMQDAAIQTTPSCNSFDGKHQDHNLSDSKVEEC
                                        :    .     :  .*   **   :*.* *: .: .    .::    .  : :* 

Spermophilus_tridecemlineatus|2930 VQTS-NNKPTQHLSLNLQNSITTSRELRIQSTPVIYSEDRLAIKDPACAQGNDDLLSPVD
Otolemur_garnettii|2945            IQTSHNNKSTQHSFLNPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Ochotona_princeps|10018            VQTS-NSRSTQHLALSPHDSVDISNEFRNQDTLAKPSEGEHAMKVPVSAHNNEDHLLLTN
Tupaia_belangeri|10540             VQTLNNSKSIQHPPFSQRDSVGTSREFRSQGTLNTQSEEQLPRKDPICTH-NDDLLLPID
Mus_musculus|2394                  VQTSDGSISAQHSSASLQDSVNASREFRSQGT-STYVQDRLPEKEPACTYGNNVPLSPVD
Rattus_norvegicus|11886            AQTLGSSTSTQHSSASFQDSVNASREVRSQGT-STYVQDRLPVKEAACTYGNNDALSPID
Dipodomys_ordii|406                VQTS-NDKSTQHSFPSLQDSLDTSKGYRSQ-SILIHSEDRLSMKNPVCVQGRDHILSPTD
Cavia_porcellus|9905               VQTS-NNKSTQHSSLILQDSANTTSKLRSQGTLTVYTEDRLARKDPVYAYGSDDLSSPID
Microcebus_murinus|1349            VQISNNNKSTQHSSLCPQDSLATSRELRSQGTLIIQSGGQPTIKDPICARGNEDLLPPTD
Tarsius_syrichta|7329              VKTS-NNKSTKHLSLSSQDSVETSREFRSQGTLIIHSEERLTMKDPICARSDDDLLPSVD
Callithrix_jacchus|16511           VQTS-NNVSTQHSFLSSQDSVDHSKEFRSQGTLTIHSEDLFTTKDPICAHSNDDLLPSID
Homo_sapiens|389                   VQTSNNNISTQHSCLSSQDSVNTSREFRSQGTLIIHSEDPLTVKDPICAHGNDDLLPPVD
Gorilla_gorilla|14125              VQTSNNNISTQHSCLSSQDSVNTSREFRSQGTLIIHSEDPLTVKDPICAHGNDDLLPPID
Pan_troglodytes|8774               VQTSNNNISTQHSCLSSQDSVNTSREFRSQGTLIIHSEDPLTVKDPICAHGNDDLLPPID
                                    :   .. . :*     :                                          

Spermophilus_tridecemlineatus|2930 GTDKYSSASYLKNLPLYRQDYNPKPKPSNEITREYIPKIGMTTYKIVPPKSLDILKDWES
Otolemur_garnettii|2945            XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Ochotona_princeps|10018            ENVKNSPASSLKNHPLYRQDYNPKPKPSNEITREYIPKIGMTTYKIVPPKSLEISKDWES
Tupaia_belangeri|10540             GIEKNSPASYLKNHPLYRQDYSPKPKPSNEITREYIPKIGMTTYKIVPPKSLDIGKDLES
Mus_musculus|2394                  GSNKNPAASYLKNFPLYRQDSNPKPKPSNEITREYIPKIGMTTYKIVPPKSLEMAKDWES
Rattus_norvegicus|11886            GSGKNPAASSLKNFPLYRQDNHPKPKPSNEITREYIPKIGMTTYKIVPPKSLEVVKDWDS
Dipodomys_ordii|406                GSDKNATASHPKNFPLYRPDYNPKPKPSNEITREYIPKIGMTTYKIVPPKSLDILKDGES
Cavia_porcellus|9905               GIDKNSTVSYLQNSPLYRQDYSAKPKPSNEITRDYIPKVGMTTYKIVPLKSLEILKDGES
Microcebus_murinus|1349            GIDKNSTVSYLKNYPFYRQDYNPKPKPSNEITREYIPKIGMTTYKIVPPKSLEILKDCES
Tarsius_syrichta|7329              RIDKNSNASYLKNYPFYRQDYNSKPKPSNEITREYIPKIGMTTYKIVPPKSLEISKDWES
Callithrix_jacchus|16511           RIDKNSTASYLKNYPLYRQDYNPKPKPSNEITREYIPKIGMTTYKVVPPKSLEILKDWQS
Homo_sapiens|389                   RIDKNSTASYLKNYPLYRQDYNPKPKPSNEITREYIPKIGMTTYKIVPPKSLEISKDWQS
Gorilla_gorilla|14125              RIDKNSTASYLKNYPLYRQDYNPKPKPSNEITREYIPKIGMTTYKIVPPKSLEISKDWQS
Pan_troglodytes|8774               RIDKNSTASYLKNYPLYRQDYNPKPKPSNEITREYIPKIGMTTYKIVPPKSLEISKDWQS
                                                                                               

Spermophilus_tridecemlineatus|2930 ETTGYKDDQKIHASG------NVKEVALQTQDLVTSEGP-GKLQLDPKPKPNLRTEQQLH
Otolemur_garnettii|2945            XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXGPL-NLRTDHQVP
Ochotona_princeps|10018            ETVGHKDDQKLPKLDERHVNKNVKETAIPTEGLVISEGA-KEPPPDLKPKPSLRAEHQVL
Tupaia_belangeri|10540             ETIGYKDSQETHTLEKKHTHENMKETAIQTEDLIISEGP-KEPPPDLKPKPILRTGHQVP
Mus_musculus|2394                  EAMGRKDDQKMLPVGQRHTIENMTETSMQTEVPATSKSS-QQPQPDLKPKPSSGTERHLH
Rattus_norvegicus|11886            EAAGKKDNQKTLAVAQKHAIETMTETAVQAEALVTSKNS-QQPQPDRTPKPSSGTEHPLH
Dipodomys_ordii|406                ETIGYKDDQKLHAFGQKPTYENVKETYMQTEDLIIPEGS-KEPLLDLKPQSSMRTEHQLH
Cavia_porcellus|9905               ESVVFKDDQKLHTLGKKHAYENVKETSIQTENTAASDGPVEEHKQGLTPKPSLRAAQQLH
Microcebus_murinus|1349            ETIGYKNDQEIHTVG-KHTQENVKETAIQTEDPAISEVP-KEPPPDLKPKPNLRTEHQVR
Tarsius_syrichta|7329              ETVGYKDDQEIYTLVKKPTDENVRETAIQTEEPAISAGP-KESPPDLKPKPNLKTENEVH
Callithrix_jacchus|16511           ETIGYKDDQDIHTLGKKHTHENVKETAIQTEDSAISEGP-KGPLPDLKPKPNLRTEHQVH
Homo_sapiens|389                   ETIEYKDDQDMHALGKKHTHENVKETAIQTEDSAISESP-EEPLPNLKPKPNLRTEHQVP
Gorilla_gorilla|14125              ETIEYKDDQDMHALGKKHTHENVKETAIQAEDSAISESP-KEPLPNLKPKPNLRTEHQVP
Pan_troglodytes|8774               ETIEYKDDQDMHALGKKHTHENVKETAIQTEDSAISESP-EEPLPNLKPKPNLRTEHQVP
                                                                                   *     : . : 

Spermophilus_tridecemlineatus|2930 RAVSSPDGAVTNPL----RMTRDTGTAPFAPNLEEINNILESKFKSRISNPQAKPSSFFL
Otolemur_garnettii|2945            SALSSPDGATVNSLKPTSKVMRHTGTAPFAPNLEDINNILESKFKSRGSNPQAKPSSFFL
Ochotona_princeps|10018            RAVNSPVGTTANPPKP-PRMTRDSGLTPFAPNLEDIHNILETKFKPRISNPQAKPSSFFL
Tupaia_belangeri|10540             SSAGSPDSALANPLRTVPRMARDTGTVPFAPNLEDINNILESKFKSRGSNPQAKPSSFFL
Mus_musculus|2394                  RTLSSPTGTETNPPKA-PRVTTDTGTIPFAPNLEDINNILESKFRSRASNPQAKPSSFFL
Rattus_norvegicus|11886            RTVSSPVGTEMNPPKP-PRMTTDTGTIPFAPNLEDINNILESKFRSRASNPQAKPSSFFL
Dipodomys_ordii|406                RAVSSPESATTSPLKP-PRITRDICTAAFAPNLEDINNILESKFKSRVSNPQAKPSSFFL
Cavia_porcellus|9905               RAMSFTDEVVTKPPKP-PRMTGDTGTAPFAPTLEDINNILESKIKPQISNPQAKPNSFFL
Microcebus_murinus|1349            SAVSPTEDATVNPLKPAPKVTRHAATAPFAPNLEDINNILESKFKSRVSNPQAKPSSFFL
Tarsius_syrichta|7329              SAVSSSDGAIVNPLRP-PKVIRDTGTAPFAPNLEDINNILESKFKSRASNSQTKPSSFFL
Callithrix_jacchus|16511           GSVSSPVSAMVSPLKPSPKMTRDTGTAPFAPNLEDINNILESKFKSRASNPQAKPSSFFL
Homo_sapiens|389                   SSVSSPDDAMVSPLKPAPKMTRDTGTAPFAPNLEEINNILESKFKSRASNAQAKPSSFFL
Gorilla_gorilla|14125              SSVSSPDGAMVSPLKPAPKMTRDTGTAPFAPNLEEINNILESKFKSRASNAQAKPSSFFL
Pan_troglodytes|8774               SSVSSPDGAMVSPLKPAPKMTRDTGTAPFAPNLEEINNILESKFKSRASNAQAKPSSFFL
                                    : . .  .  ..     ::  .    .***.**:*:****:*::.: **.*:**.****

Spermophilus_tridecemlineatus|2930 QMQKRVSGQYVTSAAAKNVHTVPNPAPKELMKKEIERDTLPHSEQTLPPLSKTTHPAPQP
Otolemur_garnettii|2945            QMQKRVSGHYVTSAAAKSVHPAPNPTPKELTSKEAERDMPPPPEQTLSSLSKTTHSVPQP
Ochotona_princeps|10018            QMQKRASG-YVTSAAAKSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tupaia_belangeri|10540             QMQKRASGHYVTSAAAKSVHTAPNLIPKEPTHAEVERDLQLPPEQPLSPLSKTTHL-PLP
Mus_musculus|2394                  QMQKRASGHYVTSAAAKSVHTAPGPAPKEPTIKEVQRDPQLSPEQHPSSLSERTHSAPLP
Rattus_norvegicus|11886            QMQKRASGHYVTSAAAKSVHTAPGPTPKEPTIKEVQRDPQLPPEQCLSPLSERTHSAPLP
Dipodomys_ordii|406                QMQKRVSGHYVTSAAAKSVHTVPTPTPKELTSKEMEKDVLPPSEPRLSPLSKTIPSAPGQ
Cavia_porcellus|9905               QMQKRASGHYVTSAAAKSTHTAPNVTPKELPNRDSGKDTLPSPEQTLSPLSKTTHCTPLP
Microcebus_murinus|1349            QMQKRVSGHYVTSAAAKSVHAAPNPTPKELTNKEAERDTLPPSEQTLSPLSKTTHSGPPP
Tarsius_syrichta|7329              QMQKRASGQYVTSAAAKNAHAAPSPTPKELPNKVVGKDMLPPPEQTLSPLSKTARSVSQP
Callithrix_jacchus|16511           QMQKRVLGHYVTSAAAKSVHAAPNPAPRELTNKEAEKNTLPSPEQTLSPLSKTAHSVPQP
Homo_sapiens|389                   QMQKRVSGHYVTSAAAKSVHAAPNPAPKELTNKEAERDMLPSPEQTLSPLSKMPHSVPQP
Gorilla_gorilla|14125              QMQKRVSGHYVTSAAAKSVHAAPNPAPKELTNKEAERDMLPSPEQTLSPLSKMPHSVPQP
Pan_troglodytes|8774               QMQKRVSGHYVTSAAAKSVHAAPNPAPKELTNKEAERDMLPSPEQTLSPLSKMPHSVPQP
                                   *****. * ********..                                         

Spermophilus_tridecemlineatus|2930 Q-IKKMEDDIINQKPAETS-----------------------------------------
Otolemur_garnettii|2945            H-VKKTDANVISQKPAETS-----------------------------------------
Ochotona_princeps|10018            X-XXXXXXXXXXXXXXXXX-----------------------------------------
Tupaia_belangeri|10540             HPIKSTGDDIISQKPVETS-----------------------------------------
Mus_musculus|2394                  N-ISKADDDII-QKPAETSPPPVAPKPMTLRAETSPPPVFPKPMTLPAET-----SPPPV
Rattus_norvegicus|11886            N-ISKADDNRI-QKPAETSPPPVAPKPMALPAETSPPAVAPKPMAFPAETSLPPASPLPV
Dipodomys_ordii|406                H-FTQTDDDIIRQIPVETS-----------------------------------------
Cavia_porcellus|9905               H-VRHTGEAVLTQKPA--------------------------------------------
Microcebus_murinus|1349            H-VKKTDDDIVNQKPAESS-----------------------------------------
Tarsius_syrichta|7329              Q-IQNTDDDIVSQKPTETSP----------------------------------------
Callithrix_jacchus|16511           L-VEKTDDDVIGQKPDEAS-----------------------------------------
Homo_sapiens|389                   L-VEKTDDDVIGQAPAEAS-----------------------------------------
Gorilla_gorilla|14125              L-VEKTDDDVIGQAPAEAS-----------------------------------------
Pan_troglodytes|8774               L-VEKTDDDVIGQAPAEAS-----------------------------------------
                                                                                               

Spermophilus_tridecemlineatus|2930 ----------------------------PPPVAPKPMPLPASQVAAVNLKTLKTFGAPRP
Otolemur_garnettii|2945            ----------------------------PPPTAPKPATLPASQVAALNLKTLKTFGAPRP
Ochotona_princeps|10018            ----------------------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tupaia_belangeri|10540             ----------------------------PPPTAPKPVPLPASQVAALNLKTLKTFGAPRP
Mus_musculus|2394                  FPKPMTLPAETSLPLVFPKPMTLRAETSPPPVAAKPVALPGSQGTSLNLKTLKTFGAPRP
Rattus_norvegicus|11886            APKPMAFPAETSLPPVAPKPMALPTEASPPPVAPKPLALPGSQGASLNLKTLKTFGAPRP
Dipodomys_ordii|406                ----------------------------PPPIAPKPVSLPAGQAASLNLKTLKTFGAPRP
Cavia_porcellus|9905               ----------------------------PPPIAPKPVPLPTPQPAAVNLKTLKTFGAPRP
Microcebus_murinus|1349            ----------------------------PPTIAPKPATLPSSQVAALNLKTLKTFGAPRP
Tarsius_syrichta|7329              ----------------------------PPPVAPKPGTLPTSQAAALNLKTLKTFGAPRP
Callithrix_jacchus|16511           ----------------------------PPPIAPKPVTIPASQVSAQNLKTLKTFGAPRP
Homo_sapiens|389                   ----------------------------PPPIAPKPVTIPASQVSTQNLKTLKTFGAPRP
Gorilla_gorilla|14125              ----------------------------PPPIAPKPVTIPASQVSTQNLKTLKTFGAPRP
Pan_troglodytes|8774               ----------------------------PPPIAPKPVTIPASQVSTQNLKTLKTFGAPRP
                                                                                               

Spermophilus_tridecemlineatus|2930 YSSSAPSPFALAVVKRSQSFSKARPESPSVGASTQPPAHTEDGKTCCVHRCADIPQIDMM
Otolemur_garnettii|2945            YSSSAPSPFALAVVKRSQSFSKARTESPSDSAPACPPANPEEGKAQSVNKSVDSPQFSVT
Ochotona_princeps|10018            XXXXXXXXXXXXXVKKPQSFSKERAESCSDHVSA--PADSREGAFCSANTVEDTPQLDAV
Tupaia_belangeri|10540             FSSSAPSPFALAVVKRSQSFSKTRTETSRDGAPVQPLSDTEKGNTHSVNTSVDIPQLGVT
Mus_musculus|2394                  YSSSGPSPFALAVVKRSQSFSKACPESASEGSSALPPAATQDEKTHTVNKPTVGSQHGDG
Rattus_norvegicus|11886            YNSSAPSPFALAVVKRSQSFSKASPESPSEDSSAQPPAAIQDGKTQTVNQPTVGSQHDGV
Dipodomys_ordii|406                YSSSAPSPFALAVVKRSQSFSKTRPETSRERMCAQSPTDIEDRKIFA-NKSTDIPQPDGS
Cavia_porcellus|9905               FSSSTSSPFALAVVKRSQSFSKVHTEPSSEEEAAQPPASADDRKTGSVNKFPDVPRLDAT
Microcebus_murinus|1349            YSSSAPSPFALAVVKRSQSFSKTRTESPSDGASAQPAANTEEGKTHSLNEFVDIPQFGGI
Tarsius_syrichta|7329              YSNSGPSPFALAVVKRSQSFSKTRTESCSEGASAQPPANTEEEKTHSVNKCVDIPQPEVI
Callithrix_jacchus|16511           YSSSGPSPFALAVVKRSQSFSKERTESSSAGASVQPPANTEEGKTHPVNKFVDIPQLGVM
Homo_sapiens|389                   YSSSGPSPFALAVVKRSQSFSKERTESPSASALVQPPANTEEGKTHSVNKFVDIPQLGVS
Gorilla_gorilla|14125              YSSSGPSPFALAVVKRSQSFSKERTESPSASALVQPPANTEEGETYSVNKFVDIPQLGVS
Pan_troglodytes|8774               YSSSGPSPFALAVVKRSQSFSKERTESPSASALVQPPANTEEGKTHSVNKFVDIPQLGVS
                                                **:.*****  .*.      .   :   .      :     .:    

Spermophilus_tridecemlineatus|2930 DKQNNSAHNEQNSPTPTPVDCP-SFTLKRQSSLTFQSPDPEQIRQSLLTAIRSGEAAAKL
Otolemur_garnettii|2945            DQXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL
Ochotona_princeps|10018            EKENKSAHNEQNSKEPTAADSP-SFTLKRQSSLTLQSSDPEQIRQSLLTAIRTGEAAARL
Tupaia_belangeri|10540             DQGNNSAHNKQNPQIPPPTDCP-SLTLKRQSSLTFQSSDPEQLRQTLLTAIRSGEAAAKL
Mus_musculus|2394                  DKQNNPVQNEHSSQVLTPADGP-SFTLKRQSSLTFQSSDPEHVRQSLLTAIRSGEAAAKL
Rattus_norvegicus|11886            DKQNKPVQNEHSSQRLTPADGPSSFTLQRQSSLNFQSSDPEHIRQSLLTAIRSGEAAAKL
Dipodomys_ordii|406                DKQNNSPYSEPNSQVSTPTDCP-SFTLKRQSSLTFQSSDPEQIRQSLLTAIRSGEAAAKL
Cavia_porcellus|9905               ENQNNSAHNEQNSKMPTPTDCP-SFTLKRQSSLTFQSSDPEQIRQSLLTAIRSGEAAAKL
Microcebus_murinus|1349            DKDNNSAYNEQNSQIPTPTDCP-SFTLKRQSSLTFQSSDPEQIRQSLLTAIRSGEAAAKL
Tarsius_syrichta|7329              DKENNSARNEENSQILTPTVCP-SFTLQRQNSLTFQSSDPEQIRQSLLTAIRSGEAAAKL
Callithrix_jacchus|16511           DKENNSAHNEQNSQITTPTDRS-SFTLMRQSSLPLQSSDPEQMRQSLLTAICSGEAAAKL
Homo_sapiens|389                   DKENNSAHNEQNSQIPTPTDGP-SFTVMRQSSLTFQSSDPEQMRQSLLTAIRSGEAAAKL
Gorilla_gorilla|14125              DKENNSAHNEQNSQIPTPTDCP-SFTVMRQSSLTFQSSDPEQMRQSLLTAIRSGEAAAKL
Pan_troglodytes|8774               DKENNSAHNEQNSQIPTPTDCP-SFTVMRQSSLTFQSSDPEQMRQSLLTAIRSGEAAAKL
                                   ::                                                         *

Spermophilus_tridecemlineatus|2930 KRVTVPPNTISVNGRSGLSH-SMSSDAQDGH
Otolemur_garnettii|2945            KRVTVPSNTVSVNGRSRLGR-SLSSDAQDGP
Ochotona_princeps|10018            KRVTVPSNTISVNGRSGLGQ-PMPPDAQHSC
Tupaia_belangeri|10540             KRVTVPSNTISVNGRSRLSQ-PVSSDVQDGH
Mus_musculus|2394                  KRVTVPSNTISVNGKSGLSQ-SMSIDAQDSR
Rattus_norvegicus|11886            KRVTVPSNRISVNGKSGLSQ-PMSIDAQDSC
Dipodomys_ordii|406                KRVTVPSNTISVNGRSRLSR-SLSSDAQESP
Cavia_porcellus|9905               KRVTVPSNTISVNGRSRLSQ-SLSSDAQEGC
Microcebus_murinus|1349            KRVTVPSNTISVNGRSRLSQ-SISPDAQDGH
Tarsius_syrichta|7329              KRVTIPSNTLSVNGRSRLSH-SVSPDAQDGR
Callithrix_jacchus|16511           KRVTIPSNTISVNGRSRLSHYSMSTDAQDG-
Homo_sapiens|389                   KRVTIPSNTISVNGRSRLSH-SMSPDAQDGH
Gorilla_gorilla|14125              KRVTIPSNTISVNGRSRLSH-SMSPDAQDGR
Pan_troglodytes|8774               KRVTIPSNTISVNGRSRLSH-SMSPDAQDGR
                                   ****:*.* :****:* *.: .:. *.*..