Orthologs Set ID: EOG4003GF


Orthology Database
OrthoDB4
Gene Symbol(s)
CEBPZ

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 17252 156, 1661, 1893, 2086, 2175, 2229, 2332, 2401, 2468, 2569, 2627, 2824, 2917, 2979, 3061
Cavia porcellus 7436 156, 322, 1404, 1661, 1893, 2086, 2175, 2229, 2332, 2401, 2468, 2569, 2627, 2830, 2917, 2979, 3061, 3119, 3156
Gorilla gorilla 18458 156, 1661, 1893, 2086, 2175, 2229, 2332, 2401, 2468, 2569, 2627, 2827, 2917, 2979, 3061
Homo sapiens 43227 156, 1661, 1893, 2086, 2175, 2229, 2332, 2401, 2468, 2569, 2627, 2830, 2917, 2979, 3061
Microcebus murinus 3562 156, 1535, 1661, 1893, 2086, 2175, 2229, 2332, 2401, 2468, 2569, 2627, 2830, 2917, 2979, 3061, 3078
Mus musculus 18115 156, 1661, 1893, 2086, 2175, 2229, 2332, 2401, 2468, 2569, 2627, 2830, 2917, 2979, 3061
Ochotona princeps 14378 156, 378, 396, 1661, 1893, 2034, 2086, 2175, 2229, 2332, 2401, 2468, 2569, 2627, 2833, 2917, 2979, 3061
Otolemur garnettii 2665 156, 1661, 1893, 2086, 2175, 2229, 2332, 2401, 2468, 2569, 2627, 2830, 2917, 2979, 3061
Pan troglodytes 23376 156, 1661, 1893, 2086, 2175, 2229, 2332, 2401, 2468, 2569, 2627, 2830, 2917, 2979, 3061
Rattus norvegicus 28991 156, 1661, 1893, 2086, 2175, 2229, 2332, 2401, 2468, 2569, 2627, 2830, 2917, 2979, 3061
Tarsius syrichta 2886 1661, 1893, 2086, 2175, 2229, 2332, 2401, 2468, 2569, 2627, 2830, 2917, 2979, 3061
Tupaia belangeri 12117 156, 1661, 1893, 2086, 2175, 2229, 2332, 2401, 2468, 2569, 2627, 2830, 2917, 2979, 3061

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 17252 ENSCJAT00000007536 100398524 ENSCJAG00000003858 CEBPZ calJac3
Cavia porcellus 7436 ENSCPOT00000020325 100736036 ENSCPOG00000020778 CEBPZ cavPor3
Gorilla gorilla 18458 ENSGGOT00000011393 101152576 ENSGGOG00000011349 CEBPZ gorGor3
Homo sapiens 43227 ENST00000234170 10153 ENSG00000115816 CEBPZ hg19,GRCh37
Microcebus murinus 3562 ENSMICT00000003325 ENSMICG00000003324 CEBPZ micMur1
Mus musculus 18115 ENSMUST00000024885 12607 ENSMUSG00000024081 Cebpz mm9
Ochotona princeps 14378 ENSOPRT00000008192 ENSOPRG00000008189 CEBPZ OchPri2.0
Otolemur garnettii 2665 ENSOGAT00000002568 100952114 ENSOGAG00000002565 CEBPZ otoGar1
Pan troglodytes 23376 ENSPTRT00000022032 459156 ENSPTRG00000011836 CEBPZ panTro2
Rattus norvegicus 28991 ENSRNOT00000006824, NM_001108701 362686 ENSRNOG00000005087 Cebpz rn4
Tarsius syrichta 2886 ENSTSYT00000005692 ENSTSYG00000005691 CEBPZ tarSyr1
Tupaia belangeri 12117 ENSTBET00000012118 ENSTBEG00000012108 CEBPZ tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 9811 ENSCJAP00000007134 100398524 ENSCJAG00000003858 CEBPZ calJac3
Cavia porcellus 5782 ENSCPOP00000020612 100736036 ENSCPOG00000020778 CEBPZ cavPor3
Gorilla gorilla 14702 ENSGGOP00000011066 101152576 ENSGGOG00000011349 CEBPZ gorGor3
Homo sapiens 52188 ENSP00000234170 10153 ENSG00000115816 CEBPZ hg19,GRCh37
Microcebus murinus 3020 ENSMICP00000003022 ENSMICG00000003324 CEBPZ micMur1
Mus musculus 23751 ENSMUSP00000024885 12607 ENSMUSG00000024081 Cebpz mm9
Ochotona princeps 12542 ENSOPRP00000007495 ENSOPRG00000008189 CEBPZ OchPri2.0
Otolemur garnettii 2292 ENSOGAP00000002293 100952114 ENSOGAG00000002565 CEBPZ otoGar1
Pan troglodytes 8365 ENSPTRP00000020326 459156 ENSPTRG00000011836 CEBPZ panTro2
Rattus norvegicus 5273 ENSRNOP00000006824 362686 ENSRNOG00000005087 Cebpz rn4
Tarsius syrichta 2643 ENSTSYP00000005217 ENSTSYG00000005691 CEBPZ tarSyr1
Tupaia belangeri 10487 ENSTBEP00000010493 ENSTBEG00000012108 CEBPZ tupBel1

multiple sequence alignment in CLUSTALW format


Ochotona_princeps|14378  ATGGCGGCCCCCAAAGCGCCTTTAGAGTTTCATGCCAAACGACCCTGGCGCCGGGAAGAG
Otolemur_garnettii|2665  ATGGCGGCTGCCAAGGAACCTTTAGAGTTCCATGCCAAGCGGCCCTGGCGCCCGGAGGAG
Tarsius_syrichta|2886    ------------------------------------------------------------
Cavia_porcellus|7436     ATGGCTGCAGCAAAGGAACCTTTGGAGTTTTATGCCAAGCGACCCCGACCCCAGGAAGAC
Microcebus_murinus|3562  ------------------------------------------------------GAGGAG
Mus_musculus|18115       ATGTCGGCCGACCAGGAACCTGTGGCGTTCCTTGCCAAGCAGCCCTGGCGTCCCAAACAG
Rattus_norvegicus|28991  ATGTCGGCGGACCAGGAACCTTTAGAGTTCCTTGCCAAGAATCCCTGGCGTCCCAAAGAG
Tupaia_belangeri|12117   ATGGCGGCCACCAAGGAACTTTTGGAGTTCCATGCCAAGCAACCCTGGCGCGGAGAAGAG
Callithrix_jacchus|17252 ATGGCGGCAGCCAGGGAGCCTTTGGAGTTCCATGCCAAGAGGCCTTGGCGCCCCGTGGAG
Pan_troglodytes|23376    ATGGCGGCAGCCAAGGAGCTTTTGGAGTTCCATGCCAAGCGGCCTTGGCGCCCCGAGGAG
Gorilla_gorilla|18458    ATGGCGGCAGCCAAGGAGCCTTTGGAGTTCCATGCCAAGCGGCCTTGGCGCCCCGAGGAG
Homo_sapiens|43227       ATGGCCGCAGTCAAGGAGCCTTTGGAGTTCCATGCCAAGCGGCCTTGGCGCCCCGAGGAG
                                                                                     

Ochotona_princeps|14378  GCAGACGGAGATCCGGACGACGAGGACGAAGATGACAGCGGCGACGCCGAGAATGGGTTC
Otolemur_garnettii|2665  ACGGTGGAAGATCCAGACGAGGAAGATGAGGGTGATAGCAGTGAGGCCGAGAATGGGTTC
Tarsius_syrichta|2886    ------------------------------------------------------------
Cavia_porcellus|7436     GTGTTCGAAGATTCGGAT---------GAGGATGATAGCGGCCAAACCAAGGATGGGTTC
Microcebus_murinus|3562  GCGGTAGAGGATCCGGACGAGGATGACGAGGATGATACCTGTGAGGCCGAGAATGGCTTC
Mus_musculus|18115       GTGACAGAAGATCCGGATGAGGAAGACGAGGAGGATGGCGATGAGGGCAAGAATGGCTTC
Rattus_norvegicus|28991  GTGACAGAAGATCCAGACGAGGAAGACGAGGAGGATAGCGATGAGGCCAAGAATGGCTTC
Tupaia_belangeri|12117   ACAGTAGAAGATCCGGATGAGGAGGACGAGGAGGATAACCGTGAAGCCGACAATGGGTTC
Callithrix_jacchus|17252 GCGGTAGAAGATCCGGACGATGAGGTCGAGGATGATACTGGTGAAGCCGAGAATGGGTTC
Pan_troglodytes|23376    GCAGTAGAAGATCCGGACGAGAAGGGTGAGGATAATACTAGTGAAGCCGAGAATGGGTTC
Gorilla_gorilla|18458    GCAGTAGAAGATCCGGACGAGGAGGATGAGGATAATACTAGTGAAGCCGAGAATGGGTTC
Homo_sapiens|43227       GCAGTAGAAGATCCGGACGAGGAGGATGAGGATAATACTAGTGAAGCCGAGAATGGGTTC
                                                                                     

Ochotona_princeps|14378  TCCCTGGAGGAAGTGTTGCGACTCGGAGGCACCAAGCAAGATTACCTTATGCTGGCTGCT
Otolemur_garnettii|2665  TCCTTTGAGGAAGTGTTACGGCTCGGAGGCACCAAGCAAGATTACCTTATGCTGGCTACG
Tarsius_syrichta|2886    ------------------------------------CAAGATTACCTTATGCTGACTACT
Cavia_porcellus|7436     TCCTTGGAGGAAGTGTTGCGGCTCGGAGGCACCAAGCAAGATTACCTTATGCTGGCTACT
Microcebus_murinus|3562  TCCCTGGAGGAAGTGTTACCGCTTGGAGGCACCAAACAAGATTACCTTATGCTGGCTACT
Mus_musculus|18115       TCCCTGGAGGAGGTGTTACGCCTCGGAGGCACAAAGCAAGATTACCTTATGCTGGCTACT
Rattus_norvegicus|28991  TCTCTGGAGGAGGTGTTACGCCTCGGAGGCACGAAGCAAGATTACCTTATGCTGGCTACT
Tupaia_belangeri|12117   TCTCTGGAAGAAGTGTTACGACTCGGAGGCACCAAGCAAGATTACCTTATGCTCGCTACT
Callithrix_jacchus|17252 TCCCTGGAGGAAGTGTTACGGCTCGGAGGCACCAAGCAAGATTACCTTATGCTGGCTACT
Pan_troglodytes|23376    TCCCTGGAGGAAGTGTTACGGCTCGGAGGCACCAAGCAAGATTACCTTATGCTGGCTACT
Gorilla_gorilla|18458    TCCCTGGAGGAAGTGTTACGGCTCGGAGGCACCAAGCAAGATTACCTTATGCTGGCTACT
Homo_sapiens|43227       TCCCTGGAGGAAGTGTTACGGCTCGGAGGCACCAAGCAAGATTACCTTATGCTGGCTACT
                                                             ***************** .**.* 

Ochotona_princeps|14378  TTGGACGAGAATGAGGAAGTGGTGGATGGAGGCAAAAAGGGAGCAATTGACGACCTCCAG
Otolemur_garnettii|2665  TTGGATGAGAATGAGGAAGTAGTGGATGGAGGCAAAAAAGGAACAGTTGATGACCTGCAG
Tarsius_syrichta|2886    TTGGATGAGAATGAAGAAGTGGTAGATGGAGGCAAAAAAGGAGCAATTGATGACCTGGAA
Cavia_porcellus|7436     TTGGATGAGAATGAGGAAGTTGTGGATGGAGGCAAAAAGGGAACAATTGATGACCTTCAA
Microcebus_murinus|3562  TTGGACGAGAGTGAGGAAGTGGTGGATGGAGGCAAAAAAGGAGCAATTGATGACCTTCAG
Mus_musculus|18115       TTGGATGAAAATGAGGAAGTGGTGGATGGGGGCAAAAAGGGAACCATTGACGACCTTCAA
Rattus_norvegicus|28991  TTGGATGAAAATGAAGAAGTAGTAGATGGAGGCAAAAAGGGAACCATCGACGACCTCCAA
Tupaia_belangeri|12117   TTGGATGAGAATGAAGAAGTGGTGGATGGAGGCAAAAAAGGAGCAATTGACGACCTTCAC
Callithrix_jacchus|17252 TTGGATGAGAATGAGGAAGTGATCGATGGAGGCAAAAAAGGAGCAATTGATGATCTTCAA
Pan_troglodytes|23376    TTGGATGAGAATGAGGAAGTGATAGATGGAGGCAAAAAAGGAGCAATTGATGACCTTCAG
Gorilla_gorilla|18458    TTGGATGAGAATGAGGAAGTGATAGATGGAGGCAAAAAAGGAGCAATCGATGACCTTCAG
Homo_sapiens|43227       TTGGATGAGAATGAGGAAGTGATAGATGGAGGCAAAAAAGGAGCAATCGATGACCTTCAG
                         ***** **.*.***.***** .* *****.********.***.*..* ** ** **  * 

Ochotona_princeps|14378  CAGGGTGAACTGGAAGCGTTTATCCAAAGTCTCAGTTTCCCCAAGTATGCACAGACT---
Otolemur_garnettii|2665  CATGGTGAATTGGAAGCATTTATTCAAAATCTTAATTTGGCCAAGTATACAAAAGCA---
Tarsius_syrichta|2886    CAAGGTGAACTGAAAGCATTTATTCACAGTCTTAATCTGGCCAAGTATGCAAAAACATTC
Cavia_porcellus|7436     GAAGGTGAACTGAAAGCATTTATTCAAAACCTTGGTTTGGACAAATATTCAAATTCT---
Microcebus_murinus|3562  CAAGGTGAATTGGAAGCATTTATTCAAAATCTTGGTTTGGCCAAGTATGCAAAAGCT---
Mus_musculus|18115       CAAGGTGAACTGGAGTCATTTATTCAGAATCTGAATTTGGCCAAATACTCAAAGTCT---
Rattus_norvegicus|28991  CAAGGTGAATTGGAGGCATTTATTCAGAATCTGAATTTGGCCAAATACTCGAAGTCT---
Tupaia_belangeri|12117   CAAGGTGAATTGGAAGCATTTATTCAAAATCTTAGTTTGGCCAAGTATGCAAAAACTTTC
Callithrix_jacchus|17252 CAAGGTGAATTGGAAGCATTTATTCAAAATCTTAATTTGGCCAAGTATACAAAAGCTTGC
Pan_troglodytes|23376    CAAGGTGAATTGGAAGCATTTATTCAAAATCTTAATTTGGCGAAGTATACAAAAGCTTCC
Gorilla_gorilla|18458    CAAGGTGAATTGGAAGCATTTATTCAAAATCTTAATTTGGCGAAGTATACAAAAGCTTCC
Homo_sapiens|43227       CAAGGTGAATTGGAAGCATTTATTCAAAATCTTAATTTGGCGAAGTATACAAAAGCTTCC
                          * ****** **.*. *.***** ** *. ** ..* *  . **.**  *..*  *:   

Ochotona_princeps|14378  GTACTTGAAGAAGATACAGAAGCTGAAAAAGAAAGTAGCAGCAAAAAGAAAGCACAAGTC
Otolemur_garnettii|2665  TTCTTAACCGAGGATGAACCGGCTGAAAAAGAAAATTCCAGCAAAAAAGAAGCA------
Tarsius_syrichta|2886    TTAACTGAAGATGATGAACCAGCTAAAAAAGAAAAGTCCAGCAAAAAAGAAGCCAAAGCA
Cavia_porcellus|7436     TTCATTGAGGAAGATGAACCGGAAAAGCAG------------------------------
Microcebus_murinus|3562  TTCTTAATTGAAGATGAACCAGATAAAAAAAATTCCAGCAAAAAAGAAGAA---------
Mus_musculus|18115       TTGATTGAAGAAGATGAACCAGAGAAAAAGGAAAACACCAGCAAAAAAGAAGCAAAACTA
Rattus_norvegicus|28991  CTGATTGAAGAGGATGAACCAGAGAAAAAAGAAAACACCAGCAAAAAAGAAGCAAAACTA
Tupaia_belangeri|12117   TTAATTAAAGAAGATGAACCAACTAAAAAAGAAAATGCCAACAAAAGAGAAACAAAAATA
Callithrix_jacchus|17252 TTAATCGAAGAAGTTGAACCAGCTAAAAAAGAAAATTTCAGCAAAAAAGAAGTAAAAATA
Pan_troglodytes|23376    TTAATTGAAGAAGAAGAACCAGCTGAAAAAGAAAATTCCAGCAAAAAAGAAGTAAAAATA
Gorilla_gorilla|18458    TTAATTGAAGAAGATGAACCAGCTGAAAAAGAAAATTCCAGCAAAAAAGAAGTAAAAATA
Homo_sapiens|43227       TTAGTTGAAGAAGATGAACCAGCTGAAAAAGAAAATTCCAGCAAAAAAGAAGTAAAAATA
                          *    .  ** *::..* .... .*..*.                              

Ochotona_princeps|14378  TCTAAAGTTGATCATAAA------------GCAGAAAGTGAAAAAACAGCCATCAGTAAG
Otolemur_garnettii|2665  ---AAAGTATCTAATAAAAAGCAAAATGCAGTAGAAAGTCAAAAGACATCGATCGAAAAG
Tarsius_syrichta|2886    TCTAAAGTAGATAATAAAAAGCAAAATGCTGAAGAAAGTCAAAGAACATCAGTCAATAAG
Cavia_porcellus|7436     ------------------------AATGAGGCAGAAAATGAGAACGTATCGATGAGTAAG
Microcebus_murinus|3562  ---AAAATGTCTAATAAAAAGCAAAATGCAACAGAAAGTCAAAGGTCATCAGTCAATACG
Mus_musculus|18115       CTGAAGGTGGAGAATAAAAAACAAAAAGCAACAGAAGGAAAAAAGACATCGGAAAAGAAG
Rattus_norvegicus|28991  CCGAAGGTAGAGAATAAGAAACAGAAAGCAGCAGAAGGAAAAAAG---------------
Tupaia_belangeri|12117   CCTAAAGTTGAAAATAAAAGGCAAAATGCAGTGGAAAGCGAAAGGACATCAATCAGTAAA
Callithrix_jacchus|17252 CCTAAAATAAATAATAAA------AATACGGCAGAAAGTCAAAGGACATCAGTTAATAAG
Pan_troglodytes|23376    CCTAAAATAAATAATAAA------AATACAGCAGAAAGTCAAAGGACATCAGTTAATAAG
Gorilla_gorilla|18458    CCTAAAATAAATAATAAA------AATACAGCAGAAAGTCAAAGGACATCAGTTAATAAG
Homo_sapiens|43227       CCTAAAATAAATAATAAA------AATACAGCAGAAAGTCAAAGGACATCAGTTAATAAG
                                                       . .***..  *.*.                

Ochotona_princeps|14378  GTGAAAAGTAATAAGAAGCAGGCAGAAAATTCTGTTGAGAACAAAAGTACCACACCGAAA
Otolemur_garnettii|2665  GAGAAAAATAAGAGTAGGCCAGAACCATGTTCCAATGAAAACAGCAATGCCAAACCAAAA
Tarsius_syrichta|2886    GTAAAAAATAATAATAGGCCAGAACCATGTTCTGAGAAGAATAACAATACTATACCAAAA
Cavia_porcellus|7436     GCGAAAAATAAGGAGATGGCAGGAAAGCATTCTGCCAAGAAGGGCAGTGCCGTACCAAAA
Microcebus_murinus|3562  GTGAAAAATAAGAGCAGACCAGAACCACCTTCTGATGAAAACAACAATGCCAAACCAAAA
Mus_musculus|18115       GTGAAAAATAAGACTGTACCAGAACAGCGTCCTGAG------AGCTGTCCCGTCTCCAAA
Rattus_norvegicus|28991  ---AAAAATAAAAGCGTACCAGAGCAGCATCCCGAG------AGCAGTACCGTCTTCAAA
Tupaia_belangeri|12117   GGGAAAAATAAGAAGAGGCCAGAACAACATTCTAATGAGAATGATAGTGCCATCCCAAAA
Callithrix_jacchus|17252 GTGAAAAATAAGAATACGCCAGAACCACATACTGATGAGAATGGCAGTACCACACCGAAA
Pan_troglodytes|23376    GTGAAAAATAAGAATAGGCCAGAACCACATTCTGATGAGAATGGCAGTACCACACCGAAA
Gorilla_gorilla|18458    GTGAAAAATAAGAATAGGCCAGAACCACATTCTGATGAGAATGGCAGTACCACACCGAAA
Homo_sapiens|43227       GTGAAAAATAAGAATAGGCCAGAACCACATTCTGATGAGAATGGCAGTACCACACCGAAA
                            ****.*** .  . . ..* . ..  * * .        .. :.* * . .   ***

Ochotona_princeps|14378  GTAAAGAAGGATAAACAACAGGACATCTTTGAGTTTTCCGAGAGACAGACACTGCTACTT
Otolemur_garnettii|2665  GTAAAGAAAGATAAG---CAAGATGTCTTTGAATTTTTTGAGAGACAGACATTGTTACTA
Tarsius_syrichta|2886    GTAAAGAAAGAGAAA---CAGGACATCTTTGAATTTTTCGAGAGACAGACTTTATTACTC
Cavia_porcellus|7436     GTACCGAAAGAAGAACAACAGGACATGTTTGAATTTTTTGAGAGGCAGACTTTGTTACTC
Microcebus_murinus|3562  GTAAAGAAAGATAAA---CAGGACATCTTTGAATTTTTTGAGAGACAAACTTTGTTACTA
Mus_musculus|18115       GCAAAGAAAGATAAACAACCCGATGTGTTTGAATTTCTAGAGAGACAAACAATGTTACTC
Rattus_norvegicus|28991  GCGAAGAGGGATAAACAGCCCGATGCATTCGAATTTCTAGAGAGACAGGCGCTGTTACTC
Tupaia_belangeri|12117   GGAAAGAAAGATAAACAACAGGACATCTTTGAATTTCTTGAGAGACAGACGTTGTTACTC
Callithrix_jacchus|17252 GTAAAGAAAGATAAA---CAGAGCATCTTTGAATTTTTTGAGAGACAGACTTTGTTGCTT
Pan_troglodytes|23376    GTAAAGAAAGATAAA---CAGAACATCTTTGAATTTTTTGAGAGACAGACTTTGTTACTT
Gorilla_gorilla|18458    GTAAAGAAAGATAAA---CAGAACATCTTTGAATTTTTTGAGAGACAGACTTTGTTACTT
Homo_sapiens|43227       GTAAAGAAAGATAAA---CAGAACATCTTTGAATTTTTTGAGAGACAGACTTTGTTACTT
                         * ...**..** .*.   *. .. .  ** **.***   *****.**..*  *. *.** 

Ochotona_princeps|14378  AAGCCTGAAGGCAAGTGGTATGACCTGGAGTACAGCAGTGAATACTCTTCAGAACCCCAG
Otolemur_garnettii|2665  AAGCCTGGAGGCAAATGGTATGACCTGGAGTATACTAATGAACATTCTTTGGAACCCCAG
Tarsius_syrichta|2886    AAGCCTGGAGGCAAATGGTATGATATAGAGTACAGCAGTGAGTATTCTTTGGAACCCCAG
Cavia_porcellus|7436     AAGGCTGGTGGCAAATGGTATGATCTGGAGTACACCAGCGAGTATTGTTTTGAACCCCAG
Microcebus_murinus|3562  AAGCCTGGAGGCAAATGGTATGACCTGGAGTATACCAATGAATATTCTTTGGAACCCCAG
Mus_musculus|18115       AGGCCTGGAGGCAAGTGGTACGACATGGAGTACAGCGGTGAGTATTCCTTGGAGCTGCAG
Rattus_norvegicus|28991  AAGCCTGGGGGCAAGTGGTACGACATGGAATACAGCGGTGAGTTTTCCTTGGAACCACAG
Tupaia_belangeri|12117   AAGCCTGGAGGTAAATGGTATGACCTAGAGTATAGCAATGAATACTCTCTGGAACCCCAG
Callithrix_jacchus|17252 AAGCCTGGAGGCAAATGGTATGATCTGGAGTATAGCAATGAATATTCTTTGAAACCCCAG
Pan_troglodytes|23376    AGGCCTGGAGGCAAATGGTATGATCTGGAGTACAGCAATGAATATTCTTTGAAACCCCAG
Gorilla_gorilla|18458    AGGCCTGGAGGCAAATGGTATGATCTGGAGTACAGCAATGAATATTCTTTGAAACCCCAG
Homo_sapiens|43227       AGGCCTGGAGGCAAATGGTATGATCTGGAGTACAGCAATGAATATTCTTTGAAACCCCAG
                         *.* ***. ** **.***** ** .*.**.** *  .. **. : *     .*.*  ***

Ochotona_princeps|14378  CCCCGGGACCTTGTCTCCAAGTACAGAGTGCTGGCTCAGAAGCTCTATGAGCATGAAGTC
Otolemur_garnettii|2665  CCTCAGGACGTTGTGACTAAGTACAAAAGTCTTGCTCAGAAGCTGTATGAACATGAAATA
Tarsius_syrichta|2886    CCTCAGGATGTTGTGTCTAAGTACAAAACCCTGGCTCAGAAGTTGTATGAGCATGAAATC
Cavia_porcellus|7436     CCTCGGGATATTGTGTCTAAGTACAAAACCTTGGCTCAGAAGCTGTATGAATGCGAAGTC
Microcebus_murinus|3562  CCTCAGGATGTTGTGTCCAAGTACAAAACTCTGGCTCAGAAGCTGTATGAGCATGAAATC
Mus_musculus|18115       CCTCCAGATGTCGTGTCCAAGTACAAAGCCCTGGCCCAGAAGCTGTATGAGCACGAAGTC
Rattus_norvegicus|28991  CCTTGGGATGTAGTGTCCAAGTACAAAGCCCTGGCCGAGAAGCTGTACGAGCAGGAAGTC
Tupaia_belangeri|12117   CCTAAGGATGTTGTGCTTAAGTACAAAAACCTGGCTCAGAAGCTGTATGAGCATGAAATC
Callithrix_jacchus|17252 CATCAGGATGTTGTGTCTAAGTACAAAACCCTTGCTCAGAAGCTGTATGAGCATGAAATC
Pan_troglodytes|23376    CCTCAGGATGTTGTATCTAAGTACAGAACCCTTGCTCAGAAGCTGTATGAGCATGAAATC
Gorilla_gorilla|18458    CCTCAGGATGTTGTATCTAAGTACAAAACCCTTGCTCAGAAGCTGTATGAGCATGAAATC
Homo_sapiens|43227       CCTCAGGATGTTGTATCTAAGTACAAAACCCTTGCTCAGAAGCTGTATCAGCATGAAATC
                         *.   .**  * **    *******.*.   * **  ***** * **  *. . ***.*.

Ochotona_princeps|14378  AGCTTATTCAGAAGTAAAAGCAACAGCCAGAAGGGAGGC---TGTTCCACCTGGATGAAG
Otolemur_garnettii|2665  AACTTATTCAAAAGTAAGACAAATAATCAAAAGGGAGCT---TCTTCCACCTGGATGAAG
Tarsius_syrichta|2886    AGCTTATTCAAAAGTAAGACAAATAATCAAAGGGGAGGAGCCTCTTCTACCTGGATGAAG
Cavia_porcellus|7436     AACTTATTCAAAAGTAAAACAAATAATCAAAAGGGAGCC---TCTTCTACCTGGATGAAG
Microcebus_murinus|3562  AACTTATTCAAAAGTAAGACGAATAATCAAAAGGGTGCC---TCTTCTACCTGGATGAAG
Mus_musculus|18115       AGCTTATTCAAGAGTAAGACAAACAATCAAAAGGGAGGC---TCTTCCACCTGGATGAAG
Rattus_norvegicus|28991  GGCTTATTCAAGAATAAGACAAGCAATCAAAAGGGAGGC---TCCTCCACCTGGATGAAG
Tupaia_belangeri|12117   AATTTATTCAAAAGTAAGACAAGTAATCAAAAGGGAGGC---TCTTCTACCTGGATGAAA
Callithrix_jacchus|17252 AATTTATTCAAAAGTAAGACAAATAGTCAAAAGGGAGCC---TCTTCTACCTGGATGAAG
Pan_troglodytes|23376    AACTTATTCAAAAGTAAGACGAATAGTCAAAAGGGAGCC---TCTTCTACCTGGATGAAG
Gorilla_gorilla|18458    AACTTATTCAAAAGTAAGACGAATAGTCAAAAGGGAGCC---TCTTCTACCTGGATGAAG
Homo_sapiens|43227       AACTTATTCAAAAGTAAGACGAATAGTCAAAAGGGAGCC---TCTTCTACCTGGATGAAG
                         .. *******..*.***.*  *. *. **.*.***:*     *  ** ***********.

Ochotona_princeps|14378  GTAATCGTGTCCTCGGGGACCCTGGGGGACAGAATGGCGGCCATGATCCTTCTTATTCAG
Otolemur_garnettii|2665  GCAATTGTGTCCTCAGGGACATTGGGTGATAGGATGGCAGCCATGATTCTTCTTATTCAG
Tarsius_syrichta|2886    GCAATTGTGTCATCAGGGACCCTGGGTGACAGGATGGCAGCCATGATTCTTCTTATTCAG
Cavia_porcellus|7436     GCGATTGTGTCATCTGGGACACTAGGTGACAGGATGGCAGCCATGATTCTTCTTATCCAG
Microcebus_murinus|3562  GCAATTGTGTCATCGGGGACACTGGGTGACAGGATGGCAGCCATGATTCTTCTTATTCAG
Mus_musculus|18115       GCCATCGTGTCATCAGGGACACTAGCTGACAGGATGGCGGCCATGATCCTTCTAATCCAG
Rattus_norvegicus|28991  GCAATCGTGTCATCGGGGACGCTAGCCGACAGGATGGCAGCCATGATCCTTCTGATCCAG
Tupaia_belangeri|12117   GCAATTGTGTCATCGGGGACACTGGGTGACAGGATGGCAGCCATGATTCTTCTTATTCAG
Callithrix_jacchus|17252 GCAATTGTGTCATCAGGGACACTAGGTGACAGAATGGCAGCCATGATTCTTCTTATTCAA
Pan_troglodytes|23376    GCAATTGTGTCATCGGGGACACTAGGTGACAGGATGGCAGCCATGATTCTTCTTATTCAG
Gorilla_gorilla|18458    GCAATTGTGTCATCGGGGACACTAGGTGACAGGATGGCAGCCATGATTCTTCTTATTCAG
Homo_sapiens|43227       GCAATTGTGTCATCGGGGACACTAGGTGACAGGATGGCAGCCATGATTCTTCTTATTCAG
                         *  ** *****.** *****  *.*  ** **.*****.******** ***** ** **.

Ochotona_princeps|14378  GAGGATGCTGTGCATACACTCCAGTTTGTGGAAACTCTAGTGAACCTTGTGAAGAAGAAG
Otolemur_garnettii|2665  GATGATGCTGTTCATACACTCCAGTTTGTAGAAACTCTGCTGAGCCTTGTTAAAAAGAAG
Tarsius_syrichta|2886    GATGATGCTGTTCACACACTGGAGTTCGTAGAAACCCTTGTGAACCTTGTTAAAAAGAAG
Cavia_porcellus|7436     GATGATGCTGTTCACACTCTCCAGTTTGTAGAAACTCTCCTGAGCCTTGTTAAGAAGAAG
Microcebus_murinus|3562  GATGATGCTATTCACACACTCCAGTTTGTAGAAACTCTTGTGAGCCTTGTTAAAAAGAAA
Mus_musculus|18115       GATGATGCTGTCCACACTCTGCAGTTTGTAGAAACCCTGATGAGCCTTGTGAAAAAGAAG
Rattus_norvegicus|28991  GATGACGCTGTTCACACACTCCAGTTTGTAGAAACCCTCTTGAGCCTTGTTAGAAAGAAG
Tupaia_belangeri|12117   GATGATGCTGTTCACACCCTCCAGTTTGTAGAGACTCTTGTGAACCTTGTTAAGAAGAAA
Callithrix_jacchus|17252 GATGATGCCATTCACACACTTCAGTTTGTAGAAACTCTTGTGAACCTTGTTAAAAAGAAG
Pan_troglodytes|23376    GATGATGCCGTTCACACACTTCAGTTTGTAGAAACTCTTGTGAACCTTGTTAAAAAGAAG
Gorilla_gorilla|18458    GATGATGCCGTTCACACACTTCAGTTTGTAGAAACTCTTGTGAACCTTGTTAAAAAGAAG
Homo_sapiens|43227       GATGATGCCGTTCACACACTTCAGTTTGTAGAAACTCTTGTGAACCTTGTTAAAAAGAAG
                         ** ** ** .* ** ** **  **** **.**.** **  ***.****** *..*****.

Ochotona_princeps|14378  GGCAGCAAACAGCAGTGCCTTATGGCTTTGGATACGTTCAAAGAGCTGCTCATTACAGAC
Otolemur_garnettii|2665  GGCAGCAAACAGCAGTGCCTCATGGCTTTGGATACTTTCAAAGAATTACTCATTACAGAC
Tarsius_syrichta|2886    GGCAGCAAACAGCAGTGCCTGGTGGCTTTGGATACTTTCAAAGAGTTGCTCATCACAGAC
Cavia_porcellus|7436     GGCAGCAAGCAGCAGTGCCTCATGGCTTTGGATACATTCAAAGAGTTACTCATTACAGAC
Microcebus_murinus|3562  GGCAGCAAACAGCAATGCCTAATGGCTTTGGATACTTTCAAAGAGTTACTCATTACAGAC
Mus_musculus|18115       GGCAGCAAGCAGCAGTGCCTCATGGCGTTGGACACGTTCAAGGAGTTGCTCATCACAGAC
Rattus_norvegicus|28991  GGCAGCAAGCAGCAGTGCCTCATGGCTTTGGATACGTTCAAGGAGCTGCTCATCACCGAC
Tupaia_belangeri|12117   GGCAGCAAACAGCAGTGCCTCCAGGCTTTGGATACTTTCAAAGAGTTACTCATCACAGAT
Callithrix_jacchus|17252 GGCAGCAAACAGCAGTGCCTCATGGCCTTGGATACTTTCAAAGAGTTGCTCATCACAGAC
Pan_troglodytes|23376    GGCAGCAAACAGCAGTGCCTTATGGCCTTGGATACTTTCAAAGAGTTGCTTATCACAGAC
Gorilla_gorilla|18458    GGCAGCAAACAGCAGTGCCTTATGGCCTTGGATACTTTCAAAGAGTTGCTTATCACAGAC
Homo_sapiens|43227       GGCAGCAAACAGCAGTGCCTTATGGCCTTGGATACTTTCAAAGAGTTGCTTATCACAGAC
                         ********.*****.*****  :*** ***** ** *****.**. *.** ** **.** 

Ochotona_princeps|14378  CTCTTGCCGGATGATCGGAAGCTACGGGTTTTCAGCCAGCATCCTTTCAACCAACTAGAA
Otolemur_garnettii|2665  CTTTTGCCAGATAGTAGGAAGCTACGGATTTTCAGCCAGCATCCTTTCAACAAACTAGAA
Tarsius_syrichta|2886    CTTTTGCCAGACAGTCGGAAGCTCCGGATTTTCAGCCTGCATCCTTTCAACAAACTGGAA
Cavia_porcellus|7436     CTCTTACCAGATAACCGCAAGCTGAGGGTTTTCAGCCAGCATCCTTTCAACAAACTGGAA
Microcebus_murinus|3562  CTTTTGCCAGATAGTAGGAAGCTGCGTATTTTTAGCCAGCATCCTTTCAACAAACTGGAA
Mus_musculus|18115       CTTCTGCCAGACAGTCGGAAGCTCCGGGTTTTCAGCCAGCATCCTTTCCACAAACTGGAA
Rattus_norvegicus|28991  CTTCTTCCGGACAGTCGGAAGCTCCGGCTCTTCAGCCAGCGCCCCCTTCACAAACTGGAA
Tupaia_belangeri|12117   CTTTTGCCAGACAGCCGAAAGCTGAGGACTTTCAGCCAGAGGCCTTTCAACAAACTAGAA
Callithrix_jacchus|17252 CTTTTGCCAGACAATCGGAAGCTGAGAATTTTCAGCCAGCATCCTTTTGACAAACTGGAA
Pan_troglodytes|23376    CTTTTGCCAGACAATCGGAAGCTGAGGATTTTCAGCCAGCGTCCTTTTGACAAACTGGAA
Gorilla_gorilla|18458    CTTTTGCCAGACAATCGGAAGCTGAGGATTTTCAGCCAGCATCCTTTTGACAAACTGGAA
Homo_sapiens|43227       CTTTTGCCAGACAATCGGAAGCTGAGGATTTTCAGCCAGCGTCCTTTTGACAAACTGGAA
                         **  * **.** .. .* ***** .*    ** ****:*.. **  *  **.****.***

Ochotona_princeps|14378  ATGCTCTCCAGCGGCAACAGGGACTCCAGAGATAGGAGACTGATCTTGTGGTATTTTGAG
Otolemur_garnettii|2665  CAGTTGTCCAGTGGCAACAAGGACTCAAGAGATAGAAGACTGATCCTGTGGCATTTTGAA
Tarsius_syrichta|2886    CAGCTGTCCAGTGGCAACAAGGACTCGAGAGACCGCAGACTGATATTATGGTATTTTGAA
Cavia_porcellus|7436     CAGGTGTCCAGTGGCAACAAGGACTCCAGAGACAGAAGGTTAATATTATGGTATTTTGAA
Microcebus_murinus|3562  CAGTTGTCTAGTGGCAACAAGGACTCAAGAGATAGAAGACTGATACTATGGTATTTTGAA
Mus_musculus|18115       GAGTTGTCCAGTGGCAACAAGGACTCGAGAGATAGAAGACTGATACTGTGGTATTATGAA
Rattus_norvegicus|28991  GAGCTGTCCAGTGGCAACAAGGACTCAAGAGATAGAAGACTGATCCTGTGGTATTACGAG
Tupaia_belangeri|12117   CAGTTGGCCAGTGGCAACAAGGACTCAAGAGACAGAAGACTGATACTGTGGTATTTTGAA
Callithrix_jacchus|17252 CAGTTGTCCAGTGGCAACAAGGACTCAAGAGATAGAAGACTGATACTATGGTATTTTGAG
Pan_troglodytes|23376    CAGTTGTCCAGTGGCAACAAGGACTCAAGAGATAGAAGACTGATATTATGGTATTTTGAA
Gorilla_gorilla|18458    CAGTTGTCCAGTGGCAACAAGGACTCAAGAGATAGAAGACTGATATTATGGTATTTTGAA
Homo_sapiens|43227       CAGTTGTCCAGTGGCAACAAGGACTCAAGAGATAGAAGACTGATATTATGGTATTTTGAA
                          :* *  * ** *******.****** ***** .* **. *.**. *.*** ***: **.

Ochotona_princeps|14378  CATCAGCTGAAACACTTAGTAGCTGAATTTGTGCAGGTCTTGGAAACTTTAGGTCATGAT
Otolemur_garnettii|2665  CACCAGCTGAAACACTTAGTGGCTGAATTTGTACATGTCTTAGAAACTTTAAGCCATGAT
Tarsius_syrichta|2886    CACCAGCTGAAACACTTAGTGGCTGAATTTGTGCAGGTCTTAGAAACTTTAAGTCACGAT
Cavia_porcellus|7436     CACCAGCTGAAACACTTAGTAGCTGAGTTTGTGCAGGTCTTAGAAACTTTAAGTCGTGAC
Microcebus_murinus|3562  CACCAGCTGAAACACTTAGTGGCTGAATTTGTGCAGGTCTTAGAAACTTTAAGTCATGAC
Mus_musculus|18115       CACCAATTGAAACACTTGGTAGCAGAATTCGTCCAGGTCCTCGAGACTTTAAGTCATGAT
Rattus_norvegicus|28991  CACCAACTGAAGCACTTGGTAGCAGAATTTGTTCAGGTCCTCGAGACTTTAAGTCACGAT
Tupaia_belangeri|12117   CACCAGCTGAAACACTTGGTGGCTGAATTTGTGCAGGTCTTAGAAACTTTAAGTCACGAT
Callithrix_jacchus|17252 CACCAGCTGAAACACTTAGTGGCTGAATTTGTGCAGGTCTTAGAAACTTTAAGTCATGAT
Pan_troglodytes|23376    CACCAGCTGAAACACTTAGTGGCTGAATTTGTGCAGGTCTTAGAAACTTTAAGTCATGAT
Gorilla_gorilla|18458    CACCAGCTGAAACACTTAGTGGCTGAATTTGTGCAGGTCTTAGAAACTTTAAGTCATGAT
Homo_sapiens|43227       CACCAGCTGAAACACTTAGTGGCTGAATTTGTGCAGGTCTTAGAAACTTTAAGTCATGAT
                         ** **. ****.*****.**.**:**.** ** ** *** * **.******.* *. ** 

Ochotona_princeps|14378  TCCTTAGTAGCCACAAAAACTCGAGCCCTTCTAGCAGCCCAGGAGCTCCTTTGTAACAAG
Otolemur_garnettii|2665  ACCTTAGTAACCACTAAAATCCGAGCCCTAACAGTGGCTCATGAGCTTCTTTGTAATAAG
Tarsius_syrichta|2886    ACATTAGTAACCACTAAGACCAGAGCCCTTACTGTGGCCCATGAGCTTCTTTGTAACAAG
Cavia_porcellus|7436     TCACTGGAAGCCACTAAAACTAGGGCCCTCTTAGCAGCTCATGAGCTACTCTGCAACAAG
Microcebus_murinus|3562  ACATTAGTAACTACTAAAACTCGAGCCCTTCTAGTGGCTCATGAGCTTCTTTGTAACAAG
Mus_musculus|18115       TCCTTGGTAACCACTAAAACGCGGGCCCTGGTAGCTGCCCATGAGCTGCTCTGTGATAAA
Rattus_norvegicus|28991  TCCCTGGTAACCACCAAAACCCGAGCCCTGGTAGCGGCCCATGAGCTTCTCTGTGATAAA
Tupaia_belangeri|12117   TCATTGGTAACCACTAAAACTCGAGCCCTTATAGTGGCTCATGAGCTTCTTTGTAATAAA
Callithrix_jacchus|17252 ACATTAGTAACCACTAAAACTCGAGCCCTTACTGTGGCTCATGAGCTGCTTTGTAACAAG
Pan_troglodytes|23376    ACATTAGTAACCACTAAAACTCGAGCCCTTACCGTGGCTCATGAGCTGCTTTGTAACAAG
Gorilla_gorilla|18458    ACATTAGTAACCACTAAAACTCGAGCCCTTACCGTGGCTCATGAGCTGCTTTGTAACAAG
Homo_sapiens|43227       ACATTAGTAACCACTAAAACTCGAGCCCTTACCGTGGCTCATGAGCTGCTTTGTAACAAG
                         :*. *.*:*.* ** **.*  .*.*****    *  ** ** ***** ** ** .* **.

Ochotona_princeps|14378  CCAGAGGAAGAAAAGGCGCTTCTGGTGCAGGTGGTGAATAAACTGGGAGATCCGCAGAAC
Otolemur_garnettii|2665  CCTGAGGAAGAAAAGGCTCTTCTTGTCCAGCTAGTAAATAAACTAGGAGATCCTCAGAAC
Tarsius_syrichta|2886    CCTGAAGAAGAAAAGGCTCTTCTTGTGCAAGTGGTAAATAAACTGGGAGATCCTCAAAAC
Cavia_porcellus|7436     CCTGAAGAAGAAAAGGCGCTTCTTATGCAGGTGGTGAATAAACTGGGAGACCCTCAGAAC
Microcebus_murinus|3562  CCTGAGGAAGAAAAGGCTCTTCTTGTGCAGTTGGTAAATAAACTGGGAGATCCTCAGAAC
Mus_musculus|18115       CCCGAGGAGGAAAAGGCTCTTCTTGTGCAGGTGATAAATAAGCTGGGAGATCCTCAGAAC
Rattus_norvegicus|28991  CCCGAGGAGGAAAAGGCTCTTCTTGTGCAGGTGATAAATAAGCTGGGAGACCCTCAGAAC
Tupaia_belangeri|12117   CCTGAGGAAGAAAAAGCCCTTCTTGTGCAGGTGGTCAATAAACTGGGAGATCCTCAGAAC
Callithrix_jacchus|17252 CCTGAGGAAGAAAAGGCTCTTCTTGTGCACGTGGTAAATAAACTGGGAGATCCTCAGAAC
Pan_troglodytes|23376    CCTGAGGAAGAAAAGGCTCTTCTTGTGCAAGTGGTAAATAAACTGGGAGATCCTCAGAAC
Gorilla_gorilla|18458    CCTGAGGAAGAAAAGGCTCTTCTTGTGCAAGTGGTAAATAAACTGGGAGATCCTCAGAAC
Homo_sapiens|43227       CCTGAGGAAGAAAAGGCTCTTCTTGTGCAAGTGGTAAATAAACTGGGAGATCCTCAGAAC
                         ** **.**.*****.** ***** .* **  *..* *****.**.***** ** **.***

Ochotona_princeps|14378  AAGATCGCCACAAAAGCATCCCATCTATTGGAGACATTACTGTGTAAACACCCCAACATG
Otolemur_garnettii|2665  AGAATAGCCACAAAAGCCTCCCATCTGTTGGAGACATTACTTAGTAAACATCCCAATATG
Tarsius_syrichta|2886    AGGATAGCTGCAAAAGCCTCCCATCTGCTGGAGACATTGCTTTCTAAACATCCCAATATG
Cavia_porcellus|7436     AGGATAGCCACCAAGGCCTCCCATCTGTTAGAGACGTTACTCTGTAAACATCCAAACATG
Microcebus_murinus|3562  AGAGTAGCCACGAAAGCCTCTCATCTGTTAGAGACATTACTTTGTAAACATCCCAATATG
Mus_musculus|18115       AGAATTGCTACGAAAGCCTCCCATCTGTTAGAAGTGTTACTTCGGAAGCATCCCAATATG
Rattus_norvegicus|28991  AGAATCGCCACCAAAGCTTCCCATCTGCTAGAAGTGTTGCTGCGGAAGCATCCCAATATG
Tupaia_belangeri|12117   AGAATAGCTGCAAAAGCCTCCCACCTGTTAGAGACGTTACTTTCTAAACATCCCAATATG
Callithrix_jacchus|17252 AGAATTGCCACAAAAGCCTCCCATCTGTTAGAGACATTACTTTGTAAACATCCCAATATG
Pan_troglodytes|23376    AGAATTGCCACAAAAGCATCCCATCTGTTAGAGACATTACTTTGTAAACATCCCAATATG
Gorilla_gorilla|18458    AGAATTGCCACAAAAGCATCCCATCTGTTAGAGACATTACTTTGTAAACATCCCAATATG
Homo_sapiens|43227       AGAATTGCCACAAAAGCATCCCATCTGTTAGAGACATTACTTTGTAAACATCCCAATATG
                         *...* ** .* **.** ** ** **. *.**.. .**.**    **.** **.** ***

Ochotona_princeps|14378  AAAGGAGTTGTGTGTGGTGAAGTAGAAAGACTCCTGTTTCGCTCAAACATCAGTTCCAAA
Otolemur_garnettii|2665  AAAGGAGTTGTATGTGGTGAAGTAGAAAGGCTACTCTTTCGCTCAAATATCAGCCCTAAA
Tarsius_syrichta|2886    AAAGGGGTTGTGTGTGGCGAGGTAGAAAGACTCCTCTTTCGCTCAAATATCAGCTCCAAA
Cavia_porcellus|7436     AAAGGAGTTGTGTGTGGTGAAATAGAAAGGCTACTCTTCCGCTCAAATATCAGCCCCAAG
Microcebus_murinus|3562  AAAGGTGTTGTGTGTGGTGAAGTAGAAAGGCTACTCTTTCGCTCAAATATCAGCCCTAAA
Mus_musculus|18115       AAAGGAGTTGTGTGTGCAGAAATAGAAAGGCTACTCTTCCGCTCAAATATCAGCCCCAAA
Rattus_norvegicus|28991  AAGGGAGTCGTGTGTGGAGAACTAGAACGGCTACTCTTTCGCTCAAATATCAGCCCCAAA
Tupaia_belangeri|12117   AAAGGTGTTGTGTGTGGTGAAGTAGAAAGGCTACTTTTTCGCTCAAATATCAGCTCCAAA
Callithrix_jacchus|17252 AAAGGAGTTGTGTGTGGTGAAGTTGAAAGGCTACTCTTCCGCTCAAATATCAGCTCCAAA
Pan_troglodytes|23376    AAAGGAGTTGTGTCTGGTGAAGTAGAAAGGCTACTCTTCCGCTCAAATATCAGCTCCAAA
Gorilla_gorilla|18458    AAAGGAGTTGTGTCTGGTGAAGTAGAAAGGCTACTCTTCCGCTCAAATATCAGCTCCAAA
Homo_sapiens|43227       AAAGGAGTTGTGTCTGGTGAAGTAGAAAGGCTACTCTTCCGCTCAAATATCAGCTCCAAA
                         **.** ** **.* **  **. *:***.*.**.** ** ******** *****  * **.

Ochotona_princeps|14378  GCTCAGTATTACGCAGTTTGTTTTTTAAATCAAATGGCCCTCTCCCATGAAGAATGTAAT
Otolemur_garnettii|2665  GCTCAATATTATGCAATTTGCTTTTTAAATCAAATGGTCCTCTCCCATGAAGAAAGTGAA
Tarsius_syrichta|2886    GCCCAATATTACGCAATTTGCTTTTTAAATCAAATGGCCCTCTCCCATGAAGAAAGTGAA
Cavia_porcellus|7436     GCTCAATATTATGCAATTTGCTTTTTAAATCAAATAGTCCTCTCCCATGAAGAAAGTGAA
Microcebus_murinus|3562  GCTCAATATTATGCAATTTGCTTTTTAAATCAAATGGCCCTGTCCCATGAAGAAAGTGAA
Mus_musculus|18115       GCTCAGTATTATGCAATTTGCTTTCTAAACCAAATGGTCCTCTCCCATGAAGAAAGTGAG
Rattus_norvegicus|28991  GCTCAGTATTATGCAATTTGCTTTTTAAACCAAATGGTCCTCTCCCATGAAGAAAGTGAG
Tupaia_belangeri|12117   GCCCAGTATTATGCAATTTGCTTTTTAAATCAAATGGTCCTCTCCCATGAAGAAAGTGAC
Callithrix_jacchus|17252 GCTCAATATTATGCAATTTGCTTTTTAAATCAGATGGCCCTCTCCCATGAAGAAAGTGAA
Pan_troglodytes|23376    GCTCAATATTATGCAATTTGCTTTTTAAATCAAATGGCTCTGTCCCATGAAGAAAGCGAA
Gorilla_gorilla|18458    GCTCAATATTACGCAATTTGCTTTTTAAATCAAATGGTTCTGTCCCATGAAGAAAGTGAA
Homo_sapiens|43227       GCTCAATATTATGCAATTTGCTTTTTAAATCAAATGGCTCTGTCCCATGAAGAAAGTGAA
                         ** **.***** ***.**** *** **** **.**.*  ** ************:* .* 

Ochotona_princeps|14378  CTGGCTAACAAGTTAATAACTATTTATTTTTGTTTTTTTCGGGCTTGCGTAAAGAAAAAA
Otolemur_garnettii|2665  TTGGCTAACAAATTAATAACTCTTTATTTTTGTTTTTTTCGGACTTGCATCAAGAAAAAA
Tarsius_syrichta|2886    CTGGCAAACAAATTAATAACTCTTTATTTTTGCTTTTTTCGGACTTGTATCAAGAAAAAA
Cavia_porcellus|7436     CTGGCTAACAAATTAATAACTATC---------------CGGACTTGTATCAAGAAAAAA
Microcebus_murinus|3562  TTGGCTAACAAATTAATAACTCTTTATTTTTGTTTCTTTCGGACTTGTATCAAGAAAAAA
Mus_musculus|18115       TTGGCTAACAAATTAATTACTCTTTATTTTTGTTTCTTTCGGACTTGTATCAAGAAAAAA
Rattus_norvegicus|28991  CTGGCTAACAAATTAATAACTCTTTATTTTTGTTTCTTTCGGACTTGTATCAAGAAAAAA
Tupaia_belangeri|12117   CTGGCTAACAAATTAATAACTCTTTATTTTTGTTTTTTTCGGACTTGTATCAAGAAAAAA
Callithrix_jacchus|17252 CTGGCTAACAAATTAATAACTATTTACTTTTGCTTTTTTCAGACTTGTATCAAGAAAAAA
Pan_troglodytes|23376    TTGGCTAACAAATTAATAACTGTTTACTTTTGCTTTTTTCGGACTTGTGTCAAAAAAAAA
Gorilla_gorilla|18458    TTGGCTAACAAATTAATAACTGTTTACTTTTGCTTTTTTCGGACTTGTGTCAAAAAAAAA
Homo_sapiens|43227       TTGGCTAACAAATTAATAACTGTTTACTTTTGCTTTTTTCGGACTTGTGTCAAAAAAAAA
                          ****:*****.*****:*** *                *.*.**** .*.**.******

Ochotona_princeps|14378  GATATTGACTCAAAAATGCTTAGTGCCCTGTTGACAGGAGTGAACAGGGCATACCCTTAT
Otolemur_garnettii|2665  GATATTGAGTCCAAAATGCTTAGTGCCCTTTTAACAGGTGTGAATAGGGCATACCCTTAT
Tarsius_syrichta|2886    GATATTGAGTCAAAAATGCTTAGTGCCCTGTTAACAGGTGTGAACAGGGCATACCCGTAC
Cavia_porcellus|7436     GATATTGAGTCAAAAATGCTCAGTGCCCTTTTATCAGGTGTGAACAGGGCGTACCCTTAC
Microcebus_murinus|3562  GATATTGAATCCAAAATGCTTAGTGCCCTTTTAACAGGTGTGAATAGGGCCTACCCTTAT
Mus_musculus|18115       GACATTGAATCAAAAATGCTCAGTGCGATTTTAACAGGGGTGAACAGAGCATACCCTTAC
Rattus_norvegicus|28991  GACATTGAATCAAAAATGCTCAGTGCCATTTTAACAGGCGTGAACAGAGCGTACCCTTAC
Tupaia_belangeri|12117   GATATTGAGTCAAAAATGCTTAGTGCTCTTTTAACAGGAGTGAACAGGGCATACCCTTAC
Callithrix_jacchus|17252 GATATTGAATCAAAAATGCTTAGTGCCATTTTAACAGGTGTGAATAGGGCATACCCTTAT
Pan_troglodytes|23376    GATGTTGAATCAAAAATGCTTAGCGCCCTTTTAACAGGTGTGAATAGGGCATACCCTTAT
Gorilla_gorilla|18458    GATGTTGAATCAAAAATGCTTAGCGCCCTTTTAACAGGTGTGAATAGGGCATACCCTTAT
Homo_sapiens|43227       GATGTTGAATCAAAAATGCTTAGCGCCCTTTTAACAGGTGTGAATAGGGCATACCCTTAT
                         ** .**** **.******** ** ** .* **.:**** ***** **.** ***** ** 

Ochotona_princeps|14378  GCTGAGGCTGACGATGACAACGTGAGGGAGCAGGTTGACACATTGTTTAAGGTGCTGCAT
Otolemur_garnettii|2665  GCCAAGAGTGGTGATGACAAAGTGAGGGAACAGGTTGACACGCTGTTTAAAGTACTGCAT
Tarsius_syrichta|2886    TCCCAGACTGGTGATGAGAAAGTGAAGGAGCAGGTTGACACTCTTTTTAAAGTGTTGCAT
Cavia_porcellus|7436     TCCCAGAGTGGGGATGAGAAAGTGAGGGAGCAGGTGGACACCTTGTTCAGAGTGCTGCAT
Microcebus_murinus|3562  GCCCAGAGTAGTGACGACAAAGTGAGGGAGCAGGTNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|18115       TCCCAGATAGGTGACGACAAAGTGAGGGAGCAGGTGGACACTTTATTCAAAGTGTTGCAT
Rattus_norvegicus|28991  TCCCAGATAGGTGACGACAGAGTGAGGGAGCAGGTGGACACTTTATTCAAAGTGTTGCAT
Tupaia_belangeri|12117   GCCCAGAGTGGTGATGACAAAGTGAGGGAGCAGGTTGACACACTGTTTAAAGTGTTGCAT
Callithrix_jacchus|17252 TCCCAGAGTGGTGATGACAAAGTGAGGGAGCAGGTGGAGACATTGTTTAAAGTGTTGCAT
Pan_troglodytes|23376    TCCCAGACTGGTGATGACAAAGTAAGGGAGCAGATTGACACACTGTTTAAAGTGTTGCAT
Gorilla_gorilla|18458    TCCCAGACTGGTGATGACAAAGTAAGGGAGCAGATTGACACACTTTTTCAAGTGTTGCAT
Homo_sapiens|43227       TCCCAGACTGGTGATGACAAAGTAAGGGAGCAGATTGACACACTGTTTAAAGTGTTGCAT
                          *  **. :.. ** ** *..**.*.***.***.* .      . ..    ..  ..  .

Ochotona_princeps|14378  GTTGTGAACTTCAGTACCAGTGTGCAGGCCTTAATGCTGCTTTTCCAGGTGATGAATTCG
Otolemur_garnettii|2665  ATGGTGAATTTTAATACCAGTGTGCAGGCTCTAATGTTGCTCTTCCAAGTAATGAATTCT
Tarsius_syrichta|2886    ATTGTGAATTTTAATACCAGTGTGCAGGCTTTGATGTTGCTTTTCCAAGTAATGAATTCT
Cavia_porcellus|7436     GTTGTAAATTTTAACACCAGTGTTCAGGCTTTGATGTTGCTTTTCCAAGTGATGAATTCT
Microcebus_murinus|3562  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|18115       GTTGTAAATTTTAATACGAGTGTGCAGGCTTTAATGCTACTTTTCCAAGTAATGAATTCT
Rattus_norvegicus|28991  GTTGTAAATTTTAATACTAGTGTGCAGGCTTTAATGCTACTTTTCCAGGTAATGAATTCT
Tupaia_belangeri|12117   GCCGTGAATTTCAGTACCAGTGTGCAGGCTTTAATGTTGCTTTTCCAAGTAATGAATTCT
Callithrix_jacchus|17252 GTTGTGAATTTTAATACCAGTGTACAGGCTTTGATGTTGCTTTTCCAAGTAATGAATTCT
Pan_troglodytes|23376    ATTGTGAATTTTAATACCAGTGTCCAGGCTTTAATGTTGCTTTTCCAAGTAATGAATTCT
Gorilla_gorilla|18458    ATTGTGAATTTTAATACCAGTGTCCAGGCTTTAATGTTGCTTTTCCAAGTAATGAATTCT
Homo_sapiens|43227       ATTGTGAATTTTAATACCAGTGTCCAGGCTTTAATGTTGCTTTTCCAAGTAATGAATTCT
                            ..    ..        ....   ..   .  .. .  . ..    ..  ..  ..  

Ochotona_princeps|14378  CAGCAGACAATATCAGATCGATACTACACAGCATTGTACAGGAAGATGTTGGATCCGGGG
Otolemur_garnettii|2665  CAGCAGACGATATCGGATCGGTATTATACAGCATTATACAGNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|2886    CAGCAGACAATCTCAGATCGATATTATACAGCATTATACAGNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|7436     CAGCAGACCATATCAGATCGATACTATACAGCATTATACAGAAAGATCTTGGATCCAGGG
Microcebus_murinus|3562  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAAGATGTTGGATCCAGGG
Mus_musculus|18115       CAACAGACAATATCTGACCGATATTACACAGCTTTATACAGAAAGATGTTGGATCCAGGC
Rattus_norvegicus|28991  CAGCAGACAATATCTGACCGATACTACACAGCTTTATACAAAAAGATGTTAGATCCGGGG
Tupaia_belangeri|12117   CAGCAGACCATATCCGATCGCTATTACATGGCATTATACAGAAAGATGTTGGATCCAGGG
Callithrix_jacchus|17252 CAGCAGACAATATCGGATCGATATTACACAGCATTATACAGGAAGATGTTGGATCCAGGG
Pan_troglodytes|23376    CAGCAGACAATATCGGATCGATATTACACAGCATTATACAGGAAGATGTTGGATCCAGGG
Gorilla_gorilla|18458    CAGCAGACAATATCGGATCGATATTACACAGCATTATACAGGAAGATGTTGGATCCAGGG
Homo_sapiens|43227       CAGCAGACAATATCGGATCGATATTACACAGCATTATACAGGAAGATGTTGGATCCAGGG
                              .    . .  .   . .  .     .  .. .       . . .. . .   .. 

Ochotona_princeps|14378  TTGAGGCTGTGCTCCAAGCAAGCGATGTTTCTTAACCTTGTCTACAAATCTCTAAAAGCT
Otolemur_garnettii|2665  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|2886    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|7436     TTGCTGATGTGTTCCAAGCAAGCTATGTTCCTTAACCTTGTCTACAAATCTCTGAAAGCA
Microcebus_murinus|3562  TTGATGATGTGTTCCAAGCAAGCTATGTTTCTTAACCTTATCTACAAATCTCTGAAAGCT
Mus_musculus|18115       CTGACGACATGTTCCAAGCAAGCGATGTTTCTCAACCTGATCTACAAATCTTTGAAAGCT
Rattus_norvegicus|28991  TTGACGACATGTTCCAAGCAAGCGATGTTTCTTAACCTGATCTACAAATCTTTGAAAGCT
Tupaia_belangeri|12117   CTGATGATGTGTTCCAAGCAAGCTATGTTTCTTAATCTAGTCTACAAGTCTCTGAAAGCG
Callithrix_jacchus|17252 TTGATGATGTGTTCCAAGCAAGCTATGTTTCTTAACCTTGTCTACAAATCTCTGAAAGCT
Pan_troglodytes|23376    TTGATGACGTGTTCCAAGCAAGCTATGTTTCTTAACCTTGTCTACAAATCTCTGAAAGCT
Gorilla_gorilla|18458    TTGATGACGTGTTCCAAGCAAGCTATGTTTCTTAACCTTGTCTACAAATCTCTGAAAGCT
Homo_sapiens|43227       TTGATGACGTGTTCCAAGCAAGCTATGTTTCTTAACCTTGTCTACAAATCTCTGAAAGCT
                          ..  .   .. .    .   .   ....  .     .  . .     . . .    .  

Ochotona_princeps|14378  GACATCATGTTACGCCGGGTGAAAGCTTTTGTAAAGAGATTGCTTCAAATTACATGTACA
Otolemur_garnettii|2665  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|2886    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|7436     GACATAGTCTTGCGCCGGGTGAAAGCTTTTGTGAAGAGGTTGCTTCAAGTGACTTGCACA
Microcebus_murinus|3562  GACATCATATTGCGACGGGTGAAGGCTTTTGTGAAGAGGTTACTTCAAGTTACTTGTGAA
Mus_musculus|18115       GACATCATGCTGCGCCGGGTGAAGGCGTTTGTGAAGAGGTTGCTTCAGGTCACCTGCACA
Rattus_norvegicus|28991  GACATCATGCTACGCCGGGTGAAGGCTTTTGTGAAGAGGTTACTTCAGGTTACCTGCACA
Tupaia_belangeri|12117   GACATTGTGTTGCGCCGTGTGAAGGCGTTTGTGAAGAGGTTACTTCAGGTTACTTGTGGA
Callithrix_jacchus|17252 GACATTGTGTTGCGCCGGGTGAAGGCTTTTGTGAAGAGGTTACTTCAAGTGACTTGTCAG
Pan_troglodytes|23376    GACATTGTGTTGCGCCGGGTGAAGGCTTTTGTGAAGAGGTTACTTCAAGTTACTTGTCAA
Gorilla_gorilla|18458    GACATTGTGTTGCGCCGGGTGAAGGCTTTTGTGAAGAGGTTACTTCAAGTTACTTGTCAA
Homo_sapiens|43227       GACATTGTGTTGCGCCGGGTGAAGGCTTTTGTGAAGAGGTTACTTCAAGTTACTTGTCAA
                         .   .  .  .  .  . ...   .  .....   . . ..  ..    .    ..    

Ochotona_princeps|14378  CAAATGCCACCATTCATATGTGGAGCTTTATATCTTGTGTCTGAAATCCTCAAAGTAAAA
Otolemur_garnettii|2665  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|2886    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|7436     CAGACGCCACCGTTCATATGTGGAGCTCTGTATCTTGTGTCTGAGATCCTTAAAGCAAAA
Microcebus_murinus|3562  CAGATGCCACCATTCATATGTGGAGCTTTGTATCTTGTGTCTGAAATCCTTAAAGCAAAA
Mus_musculus|18115       CAGATGCCGCCATTCATTTGTGGAGCGTTGTATCTTGTGTCTGAGATCCTTAAAGCAAAA
Rattus_norvegicus|28991  CAGATGCCACCATTCATTTGTGGAGCCTTATATCTTGTGTCTGAGATTCTTAAAGCAAAA
Tupaia_belangeri|12117   CAGATGCCACCATTCATATGTGGAGCTCTGTATCTTGTGTCTGAGATCCTTAAAGCAAAA
Callithrix_jacchus|17252 CAGATGCCACCATTTATATGTGGAGCTTTATATCTTGTGTCTGAGATCCTTAAAGCAAAA
Pan_troglodytes|23376    CAGATGCCACCATTTATATGTGGAGCTTTATATCTCGTGTCTGAGATCCTTAAAGCAAAA
Gorilla_gorilla|18458    CAGATGCCACCATTTATATGTGGAGCTTTATATCTTGTGTCTGAGATCCTTAAAGCAAAA
Homo_sapiens|43227       CAGATGCCACCATTTATATGTGGAGCTTTATATCTTGTGTCTGAGATCCTTAAAGCAAAA
                              .      ..  . ..... .   . . . . .... ..   .  .    .     

Ochotona_princeps|14378  CCAGGTTTAAGAAGTCAACTGGATGATCATCTGNNNNNNNNNGATGAAGAAAACTTTGTT
Otolemur_garnettii|2665  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGTCTGATGATGAAGAAAATTTTATT
Tarsius_syrichta|2886    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGTCTGATGGAGAAGAAAATTTTATT
Cavia_porcellus|7436     CCAGATTTAAGAAGTCAACTAAACAATCACGTGGAGTCTGATGATGAAGAAAAATTTGTT
Microcebus_murinus|3562  CCAGGTTTAAGAAGTCAACTAGATGATCATCCGGAGTCTGATGATGAAGAAAATTTTATT
Mus_musculus|18115       CCAGATTTAAGAAGCCAACTAGATGATCATCCGGAGTCT---GACGAAGAAAACTTCGTT
Rattus_norvegicus|28991  CCAGATTTAAGAAGCCAGCTAGATGATCATCCGGAATCT---GATGAAGAAAACTTCGTT
Tupaia_belangeri|12117   CCAGCCTTAAGAAGTCAACTAGATGACCATCCAGAGTCTGATGATGAAGAAAATTTTGTT
Callithrix_jacchus|17252 CCAGGTTTAAGAAGCCAACTAGATGATCATCCGGAGTCAGATGATGAAGAAAATTTTATT
Pan_troglodytes|23376    CCAGGTTTAAGAAGCCAACTAGATGATCATCCGGAGTCTGATGATGAAGAAAATTTTATT
Gorilla_gorilla|18458    CCAGGTTTAAGAAGCCAACTAGATGATCATCCGGAGTCTGATGATGAAGAAAATTTTATT
Homo_sapiens|43227       CCAGGTTTAAGAAGCCAACTAGATGATCATCCGGAGTCTGATGATGAAGAAAATTTTATT
                            .  ..  .  .     .             .  .     *. ******** ** .**

Ochotona_princeps|14378  GACATAGGAGATGAA---GATGACATTGAAAAATTCACTGATGCAGACAGAGAA------
Otolemur_garnettii|2665  GATGCAAAAGATGAT---GACGATGTCGAAAAATTCACTGATGCAGACAAAGAA------
Tarsius_syrichta|2886    GATGCAAGAGATGAT---GAAGACTCAGAAAAATTCACTGATGCAGACAAAAAA------
Cavia_porcellus|7436     GACGCAGCAGATGAT---GATGGCATAGAAAAGTTCACTGATGCAGACAAAGAAACAGAA
Microcebus_murinus|3562  GATGCAAGAGATGATGAAGAAGACATAGAAAAATTCACTGATGCAGATGAAGAA------
Mus_musculus|18115       GACGTGGGAGATGAC---AGTGACGATGAAAAGTTTACCGATGCAGACAAAGAAACAGCA
Rattus_norvegicus|28991  GACGTGGGAGATGAC---AGTGACGATGAAAAGTTTACCGATGCAGACAGAGAAACAGCA
Tupaia_belangeri|12117   GACTTAGGAGATGAT---GAAGACATAGAAAAATTCACTGATGCAGACAAAGAA------
Callithrix_jacchus|17252 GATGCAAACGATGAT---GAAGATATGGAAAAATTCACTGATGCAGACAAAGAA------
Pan_troglodytes|23376    GATGCAAATGATGAT---GAAGACATGGAAAAATTCGCTGATGCAGACAAAGAA------
Gorilla_gorilla|18458    GATGCAAATGATGAT---GAAGACATGGAAAAATTCACTGATGCAGACAAAGAA------
Homo_sapiens|43227       GATGCAAATGATGAT---GAAGACATGGAAAAATTCACTGATGCAGACAAAGAA------
                         **   ..  *****    .. *.    *****.** .* ******** ..*.**      

Ochotona_princeps|14378  ACAGAAACAGTGGGCGAAGGTGAGCCAGAGGAAGCTGCAGATGGACGTGATGCAGCCAGC
Otolemur_garnettii|2665  ACAGATAGAGGGAAAACAGCTGAGACAGGGGAAACTGTATCTGAAAGTGACGTAGAAACC
Tarsius_syrichta|2886    GCAGACACAGTGGAAGCAGCTGAGACAGAGAAAACTGTGTCTGAAAGTGGTAAAGAGGCC
Cavia_porcellus|7436     GTAGATACAGTGAAAAAAGTTGAAACAGAGGAAACTGTG------TCTGATACAGAAACC
Microcebus_murinus|3562  ACAGATACAGTGAAAAAAGCTGAGACAGAGGAAACCGTATCTGAAAGTGACATAGAAACC
Mus_musculus|18115       ACAGATGCAGTAAAGGAAGTAGAGTCAAAGGAGACAGAGCCTGAGAGCAGCGCAGAGGCC
Rattus_norvegicus|28991  ACAGATGCGGTGGAGGAAGTGGAGGCGAAGGAGGCTGAGCCTGAGAGCAGCACAGAAACC
Tupaia_belangeri|12117   ACAGACACAGAGAAAAAAGTTGAGACAGAGGAAACTGTGCCTAAAAGTGGTAAAGAAACC
Callithrix_jacchus|17252 ACAGAGATGGTGAAAAAATTTGAGACAGAAGAAACTATTCCTGAAACTGATACAGAAACC
Pan_troglodytes|23376    ACAGAGATAGTGAAAAAACTTGAGACAGAGGAAACAGTTCCTGAAACTGATGTAGAAACC
Gorilla_gorilla|18458    ACAGAGATGGTGAAAAAACTTGAGACAGAGGAAACAGTTCCTGAAACTGATGTAGAAACC
Homo_sapiens|43227       ACAGAGATAGTGAAAAAACTTGAGACAGAGGAAACAGTTCCTGAAACTGATGTAGAAACC
                         . *** . .* ... ..*   **. *.....*..* .           .. . **. . *

Ochotona_princeps|14378  ---AAACCGGCAGCTGCTTCCTGGGTGCACTTGGATAACTTGAAAGNNNNNNNNNNNNNN
Otolemur_garnettii|2665  AAGAAACCAGGGACTGCTTCCTGGGTGCATGTTGATAATTTGAAAGGTGGCAAGCAGTTA
Tarsius_syrichta|2886    AAAAAGCCAGAAATTGCTTCCTGGGTACACTTCGATAATTTGAAAGGTGGCAAACAGTTT
Cavia_porcellus|7436     AAAAACCCAAAGACTGCTTCCTGGGTACACTTGAATAATTTGAAAGGTGTCAAACACTTG
Microcebus_murinus|3562  AAAAAAACAAAGATTGCTTCCTGGGTGCATGTTGATAATTTGAAAGGTGGCAAGCGGTTA
Mus_musculus|18115       GAGAAGCCGAAGGCCGCTTCCTGGGTGCACTTTGACAACTTGAAAGGTGGCAAGCAAATA
Rattus_norvegicus|28991  GAGAAGCCGAAGGCTGCTTCCTGGGTGCACTTTGACAATTTGAAAGGTGGCAAGCAGATA
Tupaia_belangeri|12117   GAAAAAGCAAAGGTTGCTTCATGGGTACACGTTGATAATCTGAAAGGTGGTAAACACTTA
Callithrix_jacchus|17252 AGAAAACCGGAGATTGCTTCCTGGGTGCACTTTGATAATTTGAAAGGTGGGAAACAGTTG
Pan_troglodytes|23376    AAAAAACCAGAGGTTGCTTCCTGGGTGCACTTTGATAATTTGAAAGGTGGGAAACAGTTA
Gorilla_gorilla|18458    AAAAAACCAGAGGTTGCTTCCTGGGTGCACTTTGATAATTTGAAAGGTGGGAAACAGTTA
Homo_sapiens|43227       AAAAAACCAGAGGTTGCTTCCTGGGTGCACTTTGATAATTTGAAAGGTGGGAAACAGTTA
                            **  *.. ..  *****.*****.**  * .* **  ******...         . 

Ochotona_princeps|14378  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|2665  AATACATACGATCCTTTCAGTAGAAACCCTTTGTTCTGTGGAGCTGAAAATACAAGTCTT
Tarsius_syrichta|2886    AATACATATGATCCATTCAGTAGAAACCCTTTGTTCTGTGGAGCTGAAAATACAAGTCTG
Cavia_porcellus|7436     AATACTTATGATCCATTCAGTAGAAACCCTTTGTTTTGTGGAGCTGAAAATACAAGTTTT
Microcebus_murinus|3562  AATACGTATGATCCATTCAGTAGAAACCCCTTGTTCTGTGGGGCTGAAAATACAAGTCTT
Mus_musculus|18115       AAGACATATGATCCATTCAGTAGAAATCCTTTATTCTGCGGAGCTGAAAATACAACTCTT
Rattus_norvegicus|28991  AAGACATATGATCCCTTCGGTAGAAATCCTTTATTCTGTGGAGCTGAACATACAAATCTT
Tupaia_belangeri|12117   AATAAGTATGATCCATTCAGCAGAAACCCTTTGTTCTGCGGAGCTGAAAATACAAGTCTT
Callithrix_jacchus|17252 AATAAATATGATCCATTCAGTAGAAACCCATTGTTCTGTGGAGCTGAAAATACAAGTCTT
Pan_troglodytes|23376    AATAAATACGATCCATTCAGTAGAAACCCTCTGTTCTGTGGAGCTGAAAATACAAGTCTT
Gorilla_gorilla|18458    AATAAATACGATCCATTCAGTAGAAACCCTCTGTTCTGTGGAGCTGAAAATACAAGTCTT
Homo_sapiens|43227       AATAAATACGATCCATTCAGTAGAAACCCTCTGTTCTGTGGAGCTGAAAATACAAGTCTT
                               .  . .   ..  .  .        . .. .. .. . ..    .     . . 

Ochotona_princeps|14378  NNNNNNNNNNNNNNNCTATCTGAACATTTTCATCCATCTGTATCCCTTTTTGCAAAAACC
Otolemur_garnettii|2665  TGGGAACTCAAAAAGTTATCTGAGCATTTTCATCCATCTGTGGCTCTTTTTGCAAAGACT
Tarsius_syrichta|2886    TGGGAACTCAAAAAGTTATCTGAGCATTTTCATCCTTCTGTGGCCCTTTTTGCAAAGACT
Cavia_porcellus|7436     TGGGAACTCAAAAAGTTATCTGAGCATTTTCATCCCTCCGTAGCGCTTTTTGCGAAGACT
Microcebus_murinus|3562  TGGGAACTCAAAAAGTTATCTGAGCATTTTCATCCCTCGGTGGCTCTTTTTGCAAAGACT
Mus_musculus|18115       TGGGAGCTCAAAAAGCTATCTGAACATTTCCATCCTTCTGTGGCCCTTTTTGCAAAGACT
Rattus_norvegicus|28991  TGGGAGCTCAGAAAGCTATCTCAACATTTCCACCCTTCTGTGGCCCTCTTTGCAAAGACT
Tupaia_belangeri|12117   TGGGAACTCCAAAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Callithrix_jacchus|17252 TGGGAACTCAAAAAGTTATCTGTGCATTTTCATCCCTCTGTGGCCCTTTTTGCAAAGACC
Pan_troglodytes|23376    TGGGAACTCAAAAAGTTATCTGTGCATTTTCATCCCTCCGTGGCCCTTTTTGCAAAGACC
Gorilla_gorilla|18458    TGGGAACTCAAAAAGTTATCTGTGCATTTTCATCCCTCCGTGGCCCTTTTTGCAAAGACC
Homo_sapiens|43227       TGGGAACTCAAAAAGTTATCTGTGCATTTTCATCCCTCCGTGGCCCTTTTTGCAAAGACC
                         ....   .      . . . .     ...       .  ..     . ....        

Ochotona_princeps|14378  ATTCTGCAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|2665  ATCCTTCAGGGAAATTATATTCAGTATTCAGGTGACCCTCTACAGGATTTCACTCTAATG
Tarsius_syrichta|2886    ATCCTTCAGGGAGATTATATTCAATATTCAGGGGATCCACTTCAGGATTTCACTCTGATG
Cavia_porcellus|7436     ATCCTCCAGGGAAATTATATTCAGTATTCAGGGGACCCACTGCAGGATTTCACACTAATG
Microcebus_murinus|3562  ATCCTTCAGGGAAATTGTATTCAGTATTCAGGGGACCCCCTGCAGGATTTTACTCTAATG
Mus_musculus|18115       ATCCTTGAGGGAAATTGTATTCAATACTCAGGGGACCCACTGCAGGATTTCACACTCATG
Rattus_norvegicus|28991  ATCCTTGAGGGAAATCACATTCAGTATTCAGGGGACCCACTGCAGGATTTCACACTCATG
Tupaia_belangeri|12117   NNNNNNNNNGGAAATTATATTCAGTATTCAGGGGACCCACTGCAGGATTTCACTCTAATG
Callithrix_jacchus|17252 ATCCTTCAGGGAAACTATATTCAGTACTCAGGAGACCCATTGCAGGATTTCACCTTAATG
Pan_troglodytes|23376    ATCCTTCAGGGAAACTATATTCAGTATTCAGGGGACCCACTGCAGGATTTCACTCTAATG
Gorilla_gorilla|18458    ATCCTTCAGGGAAACTATATTCAGTATTCAGGGGACCCACTGCAGGATTTCACTCTAATG
Homo_sapiens|43227       ATCCTTCAGGGAAACTATATTCAGTATTCAGGGGACCCACTGCAGGATTTCACTCTAATG
                          .  .   ...        ..   .  .  .. .      .   .. ...     .  ..

Ochotona_princeps|14378  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|2665  AGATTCTTGGATCGATTTGTATACCGAAATCCAAAGCCCCACAAAGGCAAAGTAAACACA
Tarsius_syrichta|2886    AGATTCTTGGATCGATTTGTATACCGAAATCCAAAGCCCCATAAAGGCAAAGAAAACACA
Cavia_porcellus|7436     AGATTCTTAGATCGGTTTGTATACCGAAATCCAAAGCCACATAGAGGCAAAGAAAACACG
Microcebus_murinus|3562  AGATTCTTGGATCGCTTCGTATACCGAAATCCAAAGCCCCACAGAGGGAAAGAAAACACA
Mus_musculus|18115       AGATTCTTGGATCGATTTGTGTACCGAAATCCAAAGCTACATAAAGGCAAAGAAAATACC
Rattus_norvegicus|28991  AGATTCCTGGACCGATTTGTATACCGAAATCCAAAGCTACATAAAGGCAAAGAAAATACC
Tupaia_belangeri|12117   AGATTCTTGGATCGTTTTGTATACCGAAATCCAAAGCCACATAAAGGCAAAGAAAACACA
Callithrix_jacchus|17252 AGATTTTTGGATCGATTTGTATACCGAAATCCAAAGCCCCATAAAGGCAAAGAAAACACA
Pan_troglodytes|23376    AGATTTTTGGATCGATTTGTATACCGAAATCCAAAGCCCCATAAAGGCAAAGAAAACACA
Gorilla_gorilla|18458    AGATTTTTGGATCGATTTGTATACCGAAATCCAAAGCCCCATAAAGGCAAAGAAAACACA
Homo_sapiens|43227       AGATTTTTGGATCGATTTGTATACCGAAATCCAAAGCCCCATAAAGGCAAAGAAAACACA
                          . ..  . .   . .. .. .   .   .     .         ..    .        

Ochotona_princeps|14378  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|2665  GACAGTGTTGTGATGCAGCCCAAAAGGAAACAGTTTATAAAGGATATTCGTAGTCTTACT
Tarsius_syrichta|2886    GACAGTGTTGTGATGCAGCCAAAAAGGAAACATTTTATGAATGATATTCGTAGTCTGGCT
Cavia_porcellus|7436     GACAGTGTTGTGATGCAGCCCAAACGGAAACATTTTATAAAGGATATTCGCAGCCTTGCT
Microcebus_murinus|3562  GACAGTGTTGTGATGCAGCCAAAAAGGAAACATTTTATGAAGGATATTCGTGGTCTTGCT
Mus_musculus|18115       GACAGTGTTGTGATGCAACCCAAAAGGAAGCACTTTATGAAGAATGTCAGAGATCTCGCT
Rattus_norvegicus|28991  GACAGCGTGGTGATGCAACCCAAAAGGAAGCACTTTATGAAGAATGTGCGGGATCTTGCT
Tupaia_belangeri|12117   GACAGCGTTGTGATGCAACCAAAGAGGAAACATTTTATAAAGGATATTCGTAGTCTTGCT
Callithrix_jacchus|17252 GAGAGTGTTGTGATGCAGCCGAAAAGAAAGCATTTTATTAAGGATATTCATCATCTTGCT
Pan_troglodytes|23376    GATAGTGTTGTGATGCAGCCGAAAAGAAAACATTTTATTAAGGATATTCGTCATCTTCCT
Gorilla_gorilla|18458    GATAGTGTTGTGATGCAGCCGAAAAGAAAACATTTTATTAAGGATATTCGTCATCTTCCT
Homo_sapiens|43227       GATAGTGTTGTGATGCAGCCGAAAAGAAAACATTTTATTAAGGATATTCGTCATCTTCCT
                         .   . .. ... ..          .       ... .      . .        .   .

Ochotona_princeps|14378  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|2665  GTGAACAGTAAAGAGTTCCTGGCAAAAGAAGAAAGCCAGATACCTGTGGATGAAGTGTTT
Tarsius_syrichta|2886    GTGAACAGTAAGGAGTTCCTTGCAAAAGAAGAAAGCCAGATACCAGTGGATGAGGTGTTT
Cavia_porcellus|7436     GTGAACAGTAAAGAGTTCCTTGCAAAAGAAGAAAGCCAGATACCAGTGGATGAAGTGTTT
Microcebus_murinus|3562  GTGAACAGTAAGGAGTTCCTTGCAAAAGAAGAAAGCCAAATACCAGTGGATGAAGTGTTT
Mus_musculus|18115       GTGAACAGCAAGGAGTTCCTTGCAAAAGAAGAAAGCCAGATCCCAGTGGATGAAGTGTTC
Rattus_norvegicus|28991  GTGAATAGTAAAGAGTTCCTTGCAAAAGAAGAAAGCCAGATCCCAGTGGATGAAGTGTTC
Tupaia_belangeri|12117   GTGAACAGCAGGGAATTCCTCGCCAAAGAAGAGAGCCAGATACCAGTGGATGAAGTGTTT
Callithrix_jacchus|17252 GTGAACAGTAAGGAGTTCCTTGCAAAAGAAGAAAGCCAAATACCAGTAGATGAAGTGTTT
Pan_troglodytes|23376    GTGAACAGTAAGGAGTTCCTTGCAAAAGAAGAAAGCCAAATACCAGTGGATGAAGTGTTT
Gorilla_gorilla|18458    GTGAACAGTAAGGAGTTCCTTGCAAAAGAAGAAAGCCAAATACCAGTGGATGAAGTGTTT
Homo_sapiens|43227       GTGAACAGTAAGGAGTTCCTTGCAAAAGAAGAAAGCCAAATACCAGTGGATGAAGTGTTT
                         ...    .    .  ..  . .     .  .   .     .    .. . ..  ..... 

Ochotona_princeps|14378  NNNNNNNNGTATTACAAAAAATTTGCTACTGTTAAAGAGAAACAGAAACGAAGTGCAGAT
Otolemur_garnettii|2665  TTCCACAGGTATTATAAAAAAGTTGCT---GTTAAAGTGAAACAAAAACAGAATTCAGAT
Tarsius_syrichta|2886    TTCCACAGGTATTATAAAAAATTTGCTGTTGTTAAAAAGAAACAAAAACAGTATGCAGAT
Cavia_porcellus|7436     TTCCACAGGTATTATAAAAAAGTTGCTGTTGTAAAAGAGAAACAAAAACCGAATACAGAT
Microcebus_murinus|3562  TTCCACAGNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|18115       TTCTATAGGTATTACAAAAAAGTTGCTGTTGTTAAAGACAAACAGAAACGCAGTGCAGAT
Rattus_norvegicus|28991  TTCTACAGGTATTACAAAAAAGTTGCTGTCACTAAAGACAAACAGAAACGGAATGCAGAT
Tupaia_belangeri|12117   TTCCACAGGTATTATAAAAAAGCTGCCACTGTTAAAGAGAAGCAAAAACGGAATGCAGAT
Callithrix_jacchus|17252 TTCCACAGGTATTATAAAAAAGTTGCT---GTTAAAGAGAAACAAAAACGGAATGAAGAT
Pan_troglodytes|23376    TTCCACAGGTATTATAAAAAAGTTGCT---GTTAAAGAGAAACAAAAACGGGATGCAGAT
Gorilla_gorilla|18458    TTCCACAGGTATTATAAAAAAGTTGCT---GTTAAAGAGAAACAAAAACGGGATGCAGAT
Homo_sapiens|43227       TTCCACAGGTATTATAAAAAAGTTGCT---GTTAAAGAGAAACAAAAACGGGATGCAGAT
                         ..     ... ..          ..                            .   . .

Ochotona_princeps|14378  GAAGAAAGTATAGAAGATGTGGATGATGAAGAATTTGAAAAAATGATTGACACATTTGAA
Otolemur_garnettii|2665  GAAGAAAGTATAGAAGATGTGGATGATGATGAATTTGAGAAGCTGATTGACACATTTGAA
Tarsius_syrichta|2886    GAAGACAGTATAGAAGATGTGGATGATGAGGAGTTTGAAAAGCTGATTGACACATTTGAA
Cavia_porcellus|7436     GAAGAGAGTATAGAAGACGTGGATGATGAGGAATTTGAAAAGATGATTGACACATTTGAA
Microcebus_murinus|3562  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACACATTTGAA
Mus_musculus|18115       GAAGAAAGTATAGAAGATATTGATGATGAAGAATTTGAAAATATGATTGACACATTTGAA
Rattus_norvegicus|28991  GAAGACAGTATAGAAGATGTTGATGATGAAGAATTTGAAAATATGATTGACACATTTGAA
Tupaia_belangeri|12117   GAAGAAAGTATAGAAGATGTGGATGATGAGGAATTCGAAAAGATGATTGATACATTTGAA
Callithrix_jacchus|17252 GAAGAAAGTATAGAAGACGTGGATGATGAGGAATTTGAAAAGCTGATTGACACATTTGAA
Pan_troglodytes|23376    GAAGAAAGTATAGAAGACGTGGATGATGAAGAATTTGAAGAGCTGATTGACACATTTGAA
Gorilla_gorilla|18458    GAAGAAAGTATAGAAGACGTGGATGATGAAGAATTTGAAGAGCTGATTGACACATTTGAA
Homo_sapiens|43227       GAAGAAAGTATAGAAGACGTGGATGATGAAGAATTTGAAGAGCTGATTGACACATTTGAA
                         .  .   .. . .  .   . . .. ..  .  .. .      .. ...* *********

Ochotona_princeps|14378  GATGATAATTGTTTTACGCCTGGAAAGGATGACCTTGATTTTGCTAGCAATATGAAAAAA
Otolemur_garnettii|2665  GATGATAACTGTTTCAGCTCTGGAAAGGATGATATGGATTTTGCCAGCAACGTGAAAAAG
Tarsius_syrichta|2886    GATGACAACTGTTTCAGCGCTGCAAAGAATGATATGGATTTTGCTGGCAACGTGAAAAAG
Cavia_porcellus|7436     GATGATAACTGTTACACTCCTGGAAAGGGTGACCTTGATTTTGTAAGCAATATGAAAAAG
Microcebus_murinus|3562  GATGATAACTGTTTTAGCTCTGGAAAGGATGATATGGATTTTGCTGGCAACGTGAAAAAG
Mus_musculus|18115       GACGACAACTGCTTCCCACCTGGGAAGGATGATATTGATTTTGCCAGCAATATGAAAAAA
Rattus_norvegicus|28991  GATGACAACTGCTTCACGCCTGGAAAGGATGATATGGATTTTGCCAGTAATATGAAAAAA
Tupaia_belangeri|12117   GATGATAACTGTTTCATATCTGGAAAGGATGATCTTGATTTTGCTGGCAATGTGAAAAAG
Callithrix_jacchus|17252 GATGATAACTGTTTCAGCTCTGGAAAGGATGATATGGATTTTGCTGGCAATGTAAAAAAG
Pan_troglodytes|23376    GATGATAACTGTTTCAGCTCTGGAAAGGATGATATGGATTTTGCTGGAAATGTGAAAAAG
Gorilla_gorilla|18458    GATGATAACTGTTTCAGCTCTGGAAAGGATGATATGGATTTTGCTGGAAACGTGAAAAAG
Homo_sapiens|43227       GATGATAACTGTTTCAGCTCTGGAAAGGATGATATGGATTTTGCTGGAAACGTGAAAAAG
                         ** ** ** ** *: .   *** .***..*** .* *******  .* ** .*.*****.

Ochotona_princeps|14378  AAATCCAAAAGAGTGAAGGATAATATGGAAGATGAAGATTCAGAGAACAGTGATGATGAA
Otolemur_garnettii|2665  CAAACAGAAAGAACTAAGGGTAGCCCAGAAGATGAAGATTCGGAAGGTAGTGATGATGAA
Tarsius_syrichta|2886    AAAGCAAAAGGAGCCAAGCAAAACCCAGAGGATGAATATTCAGAAGACAGTGATGATGAA
Cavia_porcellus|7436     ACGAAAAAAAGAGCTAAGGACAACTTGGAAGATGAAGATTCAGAGGGAAGTGACGATGAA
Microcebus_murinus|3562  AAAACAAAAGGAGCTAAGCATAACCCAGAAGATGAAGATTCAGAAGGTAGTGATGATGAA
Mus_musculus|18115       ---GCAAAAGGAGCTAAGGCTGACTTG------GAAGACTCAGAGAGTAGTGACGGCGAA
Rattus_norvegicus|28991  ---ATAAAAGGAGCTAAAGATGACTTG------GAAGACTCGGAGAGCAGTGACGATGAG
Tupaia_belangeri|12117   AAAAGAAAAGGAGTTAAGGATAACGCACAAGATGACTATTCAGAGGGCAGTGATGATGAA
Callithrix_jacchus|17252 AGAATAAAAAGAGCTAAGGGTAACACAGCAGATGAAGATTCAGAAGGTGGTGATGATGAA
Pan_troglodytes|23376    AGAACAAAAGGAGCTAAGGATAAAACATTAGATGAAGATTCAGAAGGTAGTGATGATGAA
Gorilla_gorilla|18458    AGAACAAAAGGAGCTAAGGATAACACATTAGATGAAGATTCAGAAGGTAGTGATGATGAA
Homo_sapiens|43227       AGAACAAAAGGAGCTAAGGATAACACATTAGATGAAGATTCAGAAGGTAGTGATGATGAA
                              ..**.**.  **.   ..   .      **. * **.**... .**** *. **.

Ochotona_princeps|14378  TTTGATAACCTGGATGATGATGAAGTTTCTTTAGGAAGTATGGAT---GAAGAATTTGCT
Otolemur_garnettii|2665  CTTGGTAACCTGGATGATGATGAAGTTTCTTTGGGAAGTATGAAT---GAAGAATTTGCT
Tarsius_syrichta|2886    ATTGACAACCTGGATGATGATGAAGTTTCTTTAGGAAGTATGAACAATGAAGAATTTGCT
Cavia_porcellus|7436     TTTGGTAACTTAGACGATGAAGAAGTTTCTTTAGGAAGCATGAAT---GAGGACTTTGAT
Microcebus_murinus|3562  ATTGATAACTTAGATGATGATGAAGTTTCTTTGGGAAGTATGAATGATGAA---TTTGCT
Mus_musculus|18115       CTTGGAGACCTGGATGACGATGAAGTTTCTCTCGGAAGTATGAACGATGAAGACTTT---
Rattus_norvegicus|28991  CTCGGTGACCTGGATGACGACGAGGTCTCCCTAGGAAGTATGAATGATGAAGACTTT---
Tupaia_belangeri|12117   CTGGATAACCTGGATGATGATGAAGTTTCTTTAGGAAGTATGAAT---GAAGAATTTGCT
Callithrix_jacchus|17252 CTTGATAACCTGGACGAAGATGAAGTTTCTTTAGGAAGTATGGATGATGAAGAATTTGCT
Pan_troglodytes|23376    CTTGGTAACCTGGATGACGATGAAGTTTCTTTAGGAAGTATGGATGGTGAAGAATTTGCT
Gorilla_gorilla|18458    CTTGGTAACCTGGATGACGATGAAGTTTCTTTAGGAAGTATGGATGATGAAGAATTTGCT
Homo_sapiens|43227       CTTGGTAACCTGGATGACGATGAAGTTTCTTTAGGAAGTATGGATGATGAAGAATTTGCT
                          * *. .** *.** ** ** **.** **  * ***** ***.*    **.   ***   

Ochotona_princeps|14378  GAGCTTGATGAAGATGGAGGAACATTCATGGATGTGTCAGATGATGAAANNNNNNNNNNN
Otolemur_garnettii|2665  GAAATAGATGAAGATGGAGGAACATTCATGGATCTGTTAGATGATGAAAATGAAGACATT
Tarsius_syrichta|2886    GACATTGACGAAGATGGAGGAACATTCATGGATGTGTTAGATGACGACAGTGAGGCTATC
Cavia_porcellus|7436     GAACTTGATGATGATGGAGGAACGTTCATGGACGTGTCAGATGAGGGCAGTGAGGGCGCT
Microcebus_murinus|3562  GAAATTGATGAAGATGGAGGCACATTCATGGATGTGTTAGATGATGAAAGTGAAGGCATT
Mus_musculus|18115       GAGATTGATGAAGATGGAGGAACGTTCATGGATGTGTCAGATGATGAAAGTGAAGATGCT
Rattus_norvegicus|28991  GAAATTGATGAAGATGGAGGAACATTCATGGATGTGTCAGATGACGAAAGTGACCATGTT
Tupaia_belangeri|12117   GAAATCGATGAAGATGGAGGAACCTTCATGGATTTGTTAGATGATGAAAGTGAAGGCATT
Callithrix_jacchus|17252 GAAGTTGATGGAGATGGAGGAACATTCATGGATGTGTTAGATGATGAAAGTGAGAGCGTT
Pan_troglodytes|23376    GAAGTTGATGAAGATGGAGGAACATTCATGGATGTGTTAGATGATGAAAGTGAGCGCGTT
Gorilla_gorilla|18458    GAAGTTGAAGAAGATGGAGGAACATTCATGGATGTGTTAGATGATGAAAGTGAGAGCGTT
Homo_sapiens|43227       GAAGTTGATGAAGATGGAGGAACATTCATGGATGTGTTAGATGATGAAAGTGAGAGCGTT
                         **  * ** *.:********.** ********  *** ****** *..* ..        

Ochotona_princeps|14378  NNN---------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|2665  CTA------GAACTTGATGAAGGCTGTTCCAAAGTCAGTACCAAGAAAAGTAAGAGAAAA
Tarsius_syrichta|2886    CCA------GAACTT---GAAGTCCACTCCAAAAGCAGTTCTAAGAAAAGCAAGAGAAAA
Cavia_porcellus|7436     CCA------GAACTTGATGACGACAACTCCAAAGACAATACTAAGAAAAATAAAAGAAAG
Microcebus_murinus|3562  GCA------GAACTCGATGAAGGCTGTTCCAAAGTCAATACTAAGAAAAGCAAGAGAAAA
Mus_musculus|18115       CCA------GAATTTGCTGACGCCAACCCCAAAGCCAATACTAAGAAAAGCAAGAGAAAG
Rattus_norvegicus|28991  CCA------GAATTTGGTGAAGCCAGCCCCAAAGCCAGTACTAAGAAAAGCAAGAGGAAG
Tupaia_belangeri|12117   CCA------GAACTTGAGAAAGTCAGCTCCAAAGTCAATACTAAGAAAAGCAAGAGAAAA
Callithrix_jacchus|17252 CCAGTAACAGAACTT---GAAGTCCACTCCAAAGTCAATACTAAGAGAAGCAAGAGAAAA
Pan_troglodytes|23376    CCA------GAACTT---GAAGCCCACTCCAAAGTCAGTACTAAGAAAAGCAAGAGAAAA
Gorilla_gorilla|18458    CCA---GCAGAACTT---GAAGTCCACTCCAAAGTCAGTACTAAGAAAAGCAAGAGAAAA
Homo_sapiens|43227       CCA------GAACTT---GAAGTCCACTCCAAAGTCAGTACTAAGAAAAGCAAGAGAAAA
                                      .       .                .     .          .    

Ochotona_princeps|14378  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGACCAAGAAAAAAAAAGAAGAGA
Otolemur_garnettii|2665  GGT---GATGATTTTCATTTTGCTGGTTCATTTCAAGNNNNNNNN---NNNNNNNNNNNN
Tarsius_syrichta|2886    GGTGCAGATGACTTTGATTTTGCTGGCTCATTTCAAGGACCAAGGAAAAAAAAGAAGAGA
Cavia_porcellus|7436     AGCACAGGTGATGTTGACTTCGCTGGTTCATTTCTAGGACCAAAAAAGAAAAAGAAACGA
Microcebus_murinus|3562  GGTGCAGATGATTTTGACTTTGCAGGCTCATTTCAAGGATCAAGAAAAAAACAGAAAAGA
Mus_musculus|18115       AGTGAAGATGATTTTGACTTTGCTGGGTCATTTCAAGGACAAAAG---AAAAAGAAGAAA
Rattus_norvegicus|28991  AGTGAAGATGATTTTGACTTTGCTGGGTCATTTCAAGGACAAAAG---AAAAAGAAGAAA
Tupaia_belangeri|12117   GGTGCAGCTGATCTTGATTTTGCTGAGTCATTTCAAGGACCAAGGAAAAAAAAGAAAAGA
Callithrix_jacchus|17252 AGTACAGATGATTTTGACTTTGCTGACTCATTTCAAGGGCCTAGA---AAAAAGAAAAGA
Pan_troglodytes|23376    GGTACAGATGATTTTGACTTTGCTGGCTCATTTCAAGGGCCAAGA---AAAAAGAAAAGA
Gorilla_gorilla|18458    GGTACAGATGATTTTGACTTTGCTGGCTCATTTCAAGGGCCAAGA---AAAAAGAAAAGA
Homo_sapiens|43227       GGTACAGATGATTTTGACTTTGCTGGCTCATTTCAAGGGCCAAGA---AAAAAGAAAAGA
                          .    . ..   ..   .. .  .  .  ...   ..               .      

Ochotona_princeps|14378  AATACCAATGACGCCAGCCTATTTGTATCTGCTGAAGAGTTTGGCCACTTGTTGGATGAA
Otolemur_garnettii|2665  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|2886    AACTTGCAGGACTCCAGCCTATTTGTATCTGCTGAAGAGTTCGGCCACCTATTGGATGAA
Cavia_porcellus|7436     AGCCTCCATGACTCCAGCCTGTTTGTATCTGCTGAAGAGTTTGGCCACCTGTTGGACGAA
Microcebus_murinus|3562  AACTTAAATGACTCCAGCCTATTTGTATCTGCTGAAGAGTTTGGCCACCTATTGGATGAA
Mus_musculus|18115       AGTTTCAATGACTCCAGCCTGTTTGTCTCTGCTGAGGAGTTTGGCCATCTGCTGGATGAG
Rattus_norvegicus|28991  AGTTTCAATGACTCCAGCCTGTTTGTCTCTGCTGAAGAGTTTGGTCATCTGTTGGATGAA
Tupaia_belangeri|12117   AACCTCAATGACTCCAGCCTATTTGTGTCTACTGAAGAGTTTGGCCACCTGTTAGATGAA
Callithrix_jacchus|17252 AACTTCAGTGATTCCAGCCTATTTGTATCTGCTGAAGAGTTTGGCCATCTATTGGATGAA
Pan_troglodytes|23376    AACTTAAATGATTCCAGCCTATTTGTATCTGCTGAAGAGTTTGGCCATCTATTGGATGAA
Gorilla_gorilla|18458    AACTTAAATGATTCCAGCCTATTTGTATCTGCTGAAGAGTTTGGCCATCTATTGGATGAA
Homo_sapiens|43227       AACTTAAATGATTCCAGCCTATTTGTATCTGCTGAAGAGTTTGGCCATCTATTGGATGAA
                                  .      .  . ..... . .  ..  . ... ..     .  . .  .  

Ochotona_princeps|14378  AATATGGGATCGAAGTTTGATAACATTGGCTTGAATGCCATGGCTAACAAAGACAATGCA
Otolemur_garnettii|2665  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|2886    AACGTGGGATCCAAGTTTGACAGTACTGGCATGAATGCCATGGCTAACAAAGATAATGCA
Cavia_porcellus|7436     AATATGGGATCCAAATTTGATAACATTGGCATGAATGCCATGGCTAACAAAGACAATGCA
Microcebus_murinus|3562  AATATGGGATCCAAGTTTGATAGCATTGGCATGAATGCCATGGCTAACAAAGACAATGCA
Mus_musculus|18115       AATATGGGCTCCAAGTTTGATACTATTGGCATGAACGCCATGGCTAACAGAGATAATGCA
Rattus_norvegicus|28991  AATATGGGCTCCAAGTTTGATACGACTGGCATGAACGCCATGGCTAACAAAGACAATGCA
Tupaia_belangeri|12117   AATATGGGATCCAAGTTTGATAACATTGGCATGAATGCTATGACTAACAAAGACAATGCA
Callithrix_jacchus|17252 AATATGGGATCCAAGTTTGATAACATTGGCATGAATGCCATGGCTAACAAAGATAATGCA
Pan_troglodytes|23376    AATATGGGATCCAAGTTTGATAACACTGGCATGAATGCCATGGCTAACAAAGATAATGCA
Gorilla_gorilla|18458    AATATGGGATCCAAGTTTGATAACATTGGCATGAATGCCATGGCTAACAAAGATAATGCA
Homo_sapiens|43227       AATATGGGATCCAAGTTTGATAACATTGGCATGAATGCCATGGCTAACAAAGATAATGCA
                             .... .     ....       ...  ..   .   ..  .      .    ..  

Ochotona_princeps|14378  AGTCTCAAGCAGCTGAAATGGGAGGCCGAACGTGACAACTGGCTGCACAACAGAGATGTG
Otolemur_garnettii|2665  NGTCTCAAACAGCTTAGATGGGAGGCTGAACGTGATGACTGGCTACACAACAAAGATGTG
Tarsius_syrichta|2886    AGTTTCAAACAGCTTAGATGGGAGGCTGAACGTGATGACTGGCTACACAACAGAGATGTG
Cavia_porcellus|7436     AGTCTCAAACAACTTAGATGGGAGGCTGAACGGGATGACTGGTTACACAACAGAGATGTT
Microcebus_murinus|3562  AGTCTCAAACAGCTTAAA---GAGGTTGAACGTGATGACTGGCTACACAACAAAGACGTG
Mus_musculus|18115       AGTTTCAAACAGCTCAAGTGGGAAGCTGAGCGAGATGACTGGCTGCACAACAGAGATGTG
Rattus_norvegicus|28991  AGTTTCAAACAGCTCAAGTGGGAAGCTGAGCGTGATGATTGGCTCCACAACAGAGATGTG
Tupaia_belangeri|12117   AGTCTCAAACAGCTTAGATGGGAGGCCGAGCGTGATGACTGGCTACACAACAGAGATGTG
Callithrix_jacchus|17252 AGTCTCAAACAGCTTAGATGGGAGGCCGAACGTGATGACTGGCTTCACAACAGAGATGTA
Pan_troglodytes|23376    AGTCTCAAACAGCTTAGATGGGAGGCTGAACGTGATGACTGGCTACACAACAGAGATGCA
Gorilla_gorilla|18458    AGTCTCAAACAGCTTAGATGGGAGGCTGAACGTGATGACTGGCTACACAACAGAGATGCA
Homo_sapiens|43227       AGTCTCAAACAGCTTAGATGGGAGGCTGAACGTGATGACTGGCTACACAACAGAGATGCA
                          ** ****.**.** *..   **.*  **.** ** .* *** * *******.*** *  

Ochotona_princeps|14378  AAAAGCATCCTCAGGAAAAAG---AAACATTTCAAA---------------AAGAAGAAG
Otolemur_garnettii|2665  AAAAGTATCATCAAGAGAAAG---AAAAATTTCAAG---------------AAGAAGAGG
Tarsius_syrichta|2886    AAAAGTATCATCAAGAAAAAG---AAACACTTCAAA---------------AAGAAGAGG
Cavia_porcellus|7436     TCCCCTTTAGTTATGAAGAAATTACTACAGTTTAAGAAATTAGTTATGATCAAGAAACGC
Microcebus_murinus|3562  AAAAGTATCATCAAGAAAAAG---AAAAATTTCAGG---------------AAGAGGAGG
Mus_musculus|18115       AAAAGTATCATCAAGAAAAAG---AAAAATTTCAGG---------------AAGAAG---
Rattus_norvegicus|28991  AAAAGTATCATCAAGAAAAAG---AAGAATTTCAGG---------------AAAAAG---
Tupaia_belangeri|12117   AAAAGTATCATCAGGAAAAAG---AAAAACTTCAAA---------------AAGAAGAAG
Callithrix_jacchus|17252 AAAAGTATCATCAAGAAAAAG---AAAAATTTTAAA---------------AAGAAGAGG
Pan_troglodytes|23376    AAAAGTATCATCAAGAAAAAG---AAACATTTTAAA---------------AAGAAGAGG
Gorilla_gorilla|18458    AAAAGTATCATCAAGAAAAAG---AAACATTTTAAA---------------AAGAAGAGG
Homo_sapiens|43227       AAAAGTATCATCAAGAAAAAG---AAACATTTTAAA---------------AAGAAGAGG
                         :...  :*. * * **..**.   .:..* ** *..               **.*..   

Ochotona_princeps|14378  CTGAAATTCACTCAAAAAACTAAAAAGCAAAGGAAATGA
Otolemur_garnettii|2665  CTGAAAACCACTCATAAAACTAAAAAGCAAAGAAAATAA
Tarsius_syrichta|2886    ATGAAAACCATTCACAAAACTAAAAAGCAAAGGAAATGA
Cavia_porcellus|7436     TCAGTATCAACACACAAGCCACGATTTCGTGCTTTA---
Microcebus_murinus|3562  CTGAAAACCACTCATAAAAGTAAAAAGCAAAGGAAATGA
Mus_musculus|18115       ATGAAAGCCCCTCAGAAACCCAAACGGCAGAGGAAGTGA
Rattus_norvegicus|28991  ---AAAGCCCCTCAGAAACCCAAAAGACAAAGGAAGTGA
Tupaia_belangeri|12117   CCGAAAACCACCCAAAAAGCTAAAAAGCAAAGGAAATGA
Callithrix_jacchus|17252 ATTAAAACCACTCAAAAAACTAAAAAGCAAAGGAAATGA
Pan_troglodytes|23376    ATTAAAACCACTCAAAAAACTAAAAAGCAAAGGAAATGA
Gorilla_gorilla|18458    ATTAAAACCACTCAAAAAACTAAAAAGCAAAGGAAATGA
Homo_sapiens|43227       ATTAAAACCACTCAAAAAACTAAAAAACAAAGGAAATGA
                            .:*  ..  ** **.   ..*   *. .  ::.   

multiple sequence alignment in CLUSTALW format


Ochotona_princeps|12542 MAAPKAPLEFHAKRPWRREEADGDPDDEDEDDSGDAENGFSLEEVLRLGGTKQDYLMLAA
Otolemur_garnettii|2292 MAAAKEPLEFHAKRPWRPEETVEDPDEEDEGDSSEAENGFSFEEVLRLGGTKQDYLMLAT
Tarsius_syrichta|2643   ----------------------------------------------------QDYLMLTT
Cavia_porcellus|5782    MAAAKEPLEFYAKRPRPQEDVFEDSD---EDDSGQTKDGFSLEEVLRLGGTKQDYLMLAT
Microcebus_murinus|3020 ------------------EEAVEDPDEDDEDDTCEAENGFSLEEVLPLGGTKQDYLMLAT
Mus_musculus|23751      MSADQEPVAFLAKQPWRPKQVTEDPDEEDEEDGDEGKNGFSLEEVLRLGGTKQDYLMLAT
Rattus_norvegicus|5273  MSADQEPLEFLAKNPWRPKEVTEDPDEEDEEDSDEAKNGFSLEEVLRLGGTKQDYLMLAT
Tupaia_belangeri|10487  MAATKELLEFHAKQPWRGEETVEDPDEEDEEDNREADNGFSLEEVLRLGGTKQDYLMLAT
Callithrix_jacchus|9811 MAAAREPLEFHAKRPWRPVEAVEDPDDEVEDDTGEAENGFSLEEVLRLGGTKQDYLMLAT
Pan_troglodytes|8365    MAAAKELLEFHAKRPWRPEEAVEDPDEKGEDNTSEAENGFSLEEVLRLGGTKQDYLMLAT
Gorilla_gorilla|14702   MAAAKEPLEFHAKRPWRPEEAVEDPDEEDEDNTSEAENGFSLEEVLRLGGTKQDYLMLAT
Homo_sapiens|52188      MAAVKEPLEFHAKRPWRPEEAVEDPDEEDEDNTSEAENGFSLEEVLRLGGTKQDYLMLAT
                                                                            ******::

Ochotona_princeps|12542 LDENEEVVDGGKKGAIDDLQQGELEAFIQSLSFPKYAQT-VLEEDTEAEKESSSKKKAQV
Otolemur_garnettii|2292 LDENEEVVDGGKKGTVDDLQHGELEAFIQNLNLAKYTKA-FLTEDEPAEKENSSKKEA--
Tarsius_syrichta|2643   LDENEEVVDGGKKGAIDDLEQGELKAFIHSLNLAKYAKTFLTEDDEPAKKEKSSKKEAKA
Cavia_porcellus|5782    LDENEEVVDGGKKGTIDDLQEGELKAFIQNLGLDKYSNS-FIEEDEPEKQ----------
Microcebus_murinus|3020 LDESEEVVDGGKKGAIDDLQQGELEAFIQNLGLAKYAKA-FLIEDEPDKKNSSKKEE---
Mus_musculus|23751      LDENEEVVDGGKKGTIDDLQQGELESFIQNLNLAKYSKS-LIEEDEPEKKENTSKKEAKL
Rattus_norvegicus|5273  LDENEEVVDGGKKGTIDDLQQGELEAFIQNLNLAKYSKS-LIEEDEPEKKENTSKKEAKL
Tupaia_belangeri|10487  LDENEEVVDGGKKGAIDDLHQGELEAFIQNLSLAKYAKTFLIKEDEPTKKENANKRETKI
Callithrix_jacchus|9811 LDENEEVIDGGKKGAIDDLQQGELEAFIQNLNLAKYTKACLIEEVEPAKKENFSKKEVKI
Pan_troglodytes|8365    LDENEEVIDGGKKGAIDDLQQGELEAFIQNLNLAKYTKASLIEEEEPAEKENSSKKEVKI
Gorilla_gorilla|14702   LDENEEVIDGGKKGAIDDLQQGELEAFIQNLNLAKYTKASLIEEDEPAEKENSSKKEVKI
Homo_sapiens|52188      LDENEEVIDGGKKGAIDDLQQGELEAFIQNLNLAKYTKASLVEEDEPAEKENSSKKEVKI
                        ***.***:******::***..***::**:.*.: **::: .  :    ::          

Ochotona_princeps|12542 SKVDHK----AESEKTAISKVKSNKKQAENSVENKSTTPKVKKDKQQDIFEFSERQTLLL
Otolemur_garnettii|2292 -KVSNKKQNAVESQKTSIEKEKNKSRPEPCSNENSNAKPKVKKDK-QDVFEFFERQTLLL
Tarsius_syrichta|2643   SKVDNKKQNAEESQRTSVNKVKNNNRPEPCSEKNNNTIPKVKKEK-QDIFEFFERQTLLL
Cavia_porcellus|5782    --------NEAENENVSMSKAKNKEMAGKHSAKKGSAVPKVPKEEQQDMFEFFERQTLLL
Microcebus_murinus|3020 -KMSNKKQNATESQRSSVNTVKNKSRPEPPSDENNNAKPKVKKDK-QDIFEFFERQTLLL
Mus_musculus|23751      LKVENKKQKATEGKKTSEKKVKNKTVPEQRPE--SCPVSKAKKDKQPDVFEFLERQTMLL
Rattus_norvegicus|5273  PKVENKKQKAAEGKK------KNKSVPEQHPE--SSTVFKAKRDKQPDAFEFLERQALLL
Tupaia_belangeri|10487  PKVENKRQNAVESERTSISKGKNKKRPEQHSNENDSAIPKGKKDKQQDIFEFLERQTLLL
Callithrix_jacchus|9811 PKINNK--NTAESQRTSVNKVKNKNTPEPHTDENGSTTPKVKKDK-QSIFEFFERQTLLL
Pan_troglodytes|8365    PKINNK--NTAESQRTSVNKVKNKNRPEPHSDENGSTTPKVKKDK-QNIFEFFERQTLLL
Gorilla_gorilla|14702   PKINNK--NTAESQRTSVNKVKNKNRPEPHSDENGSTTPKVKKDK-QNIFEFFERQTLLL
Homo_sapiens|52188      PKINNK--NTAESQRTSVNKVKNKNRPEPHSDENGSTTPKVKKDK-QNIFEFFERQTLLL
                                   *.:.      *.:      .     .  *  :::  . *** ***::**

Ochotona_princeps|12542 KPEGKWYDLEYSSEYSSEPQPRDLVSKYRVLAQKLYEHEVSLFRSKSNSQKGG-CSTWMK
Otolemur_garnettii|2292 KPGGKWYDLEYTNEHSLEPQPQDVVTKYKSLAQKLYEHEINLFKSKTNNQKGA-SSTWMK
Tarsius_syrichta|2643   KPGGKWYDIEYSSEYSLEPQPQDVVSKYKTLAQKLYEHEISLFKSKTNNQRGGASSTWMK
Cavia_porcellus|5782    KAGGKWYDLEYTSEYCFEPQPRDIVSKYKTLAQKLYECEVNLFKSKTNNQKGA-SSTWMK
Microcebus_murinus|3020 KPGGKWYDLEYTNEYSLEPQPQDVVSKYKTLAQKLYEHEINLFKSKTNNQKGA-SSTWMK
Mus_musculus|23751      RPGGKWYDMEYSGEYSLELQPPDVVSKYKALAQKLYEHEVSLFKSKTNNQKGG-SSTWMK
Rattus_norvegicus|5273  KPGGKWYDMEYSGEFSLEPQPWDVVSKYKALAEKLYEQEVGLFKNKTSNQKGG-SSTWMK
Tupaia_belangeri|10487  KPGGKWYDLEYSNEYSLEPQPKDVVLKYKNLAQKLYEHEINLFKSKTSNQKGG-SSTWMK
Callithrix_jacchus|9811 KPGGKWYDLEYSNEYSLKPQHQDVVSKYKTLAQKLYEHEINLFKSKTNSQKGA-SSTWMK
Pan_troglodytes|8365    RPGGKWYDLEYSNEYSLKPQPQDVVSKYRTLAQKLYEHEINLFKSKTNSQKGA-SSTWMK
Gorilla_gorilla|14702   RPGGKWYDLEYSNEYSLKPQPQDVVSKYKTLAQKLYEHEINLFKSKTNSQKGA-SSTWMK
Homo_sapiens|52188      RPGGKWYDLEYSNEYSLKPQPQDVVSKYKTLAQKLYQHEINLFKSKTNSQKGA-SSTWMK
                        :. *****:**:.*.. : *  *:* **: **:***: *:.**:.*:..*:*. .*****

Ochotona_princeps|12542 VIVSSGTLGDRMAAMILLIQEDAVHTLQFVETLVNLVKKKGSKQQCLMALDTFKELLITD
Otolemur_garnettii|2292 AIVSSGTLGDRMAAMILLIQDDAVHTLQFVETLLSLVKKKGSKQQCLMALDTFKELLITD
Tarsius_syrichta|2643   AIVSSGTLGDRMAAMILLIQDDAVHTLEFVETLVNLVKKKGSKQQCLVALDTFKELLITD
Cavia_porcellus|5782    AIVSSGTLGDRMAAMILLIQDDAVHTLQFVETLLSLVKKKGSKQQCLMALDTFKELLITD
Microcebus_murinus|3020 AIVSSGTLGDRMAAMILLIQDDAIHTLQFVETLVSLVKKKGSKQQCLMALDTFKELLITD
Mus_musculus|23751      AIVSSGTLADRMAAMILLIQDDAVHTLQFVETLMSLVKKKGSKQQCLMALDTFKELLITD
Rattus_norvegicus|5273  AIVSSGTLADRMAAMILLIQDDAVHTLQFVETLLSLVRKKGSKQQCLMALDTFKELLITD
Tupaia_belangeri|10487  AIVSSGTLGDRMAAMILLIQDDAVHTLQFVETLVNLVKKKGSKQQCLQALDTFKELLITD
Callithrix_jacchus|9811 AIVSSGTLGDRMAAMILLIQDDAIHTLQFVETLVNLVKKKGSKQQCLMALDTFKELLITD
Pan_troglodytes|8365    AIVSSGTLGDRMAAMILLIQDDAVHTLQFVETLVNLVKKKGSKQQCLMALDTFKELLITD
Gorilla_gorilla|14702   AIVSSGTLGDRMAAMILLIQDDAVHTLQFVETLVNLVKKKGSKQQCLMALDTFKELLITD
Homo_sapiens|52188      AIVSSGTLGDRMAAMILLIQDDAVHTLQFVETLVNLVKKKGSKQQCLMALDTFKELLITD
                        .*******.***********:**:***:*****:.**:********* ************

Ochotona_princeps|12542 LLPDDRKLRVFSQHPFNQLEMLSSGNRDSRDRRLILWYFEHQLKHLVAEFVQVLETLGHD
Otolemur_garnettii|2292 LLPDSRKLRIFSQHPFNKLEQLSSGNKDSRDRRLILWHFEHQLKHLVAEFVHVLETLSHD
Tarsius_syrichta|2643   LLPDSRKLRIFSLHPFNKLEQLSSGNKDSRDRRLILWYFEHQLKHLVAEFVQVLETLSHD
Cavia_porcellus|5782    LLPDNRKLRVFSQHPFNKLEQVSSGNKDSRDRRLILWYFEHQLKHLVAEFVQVLETLSRD
Microcebus_murinus|3020 LLPDSRKLRIFSQHPFNKLEQLSSGNKDSRDRRLILWYFEHQLKHLVAEFVQVLETLSHD
Mus_musculus|23751      LLPDSRKLRVFSQHPFHKLEELSSGNKDSRDRRLILWYYEHQLKHLVAEFVQVLETLSHD
Rattus_norvegicus|5273  LLPDSRKLRLFSQRPLHKLEELSSGNKDSRDRRLILWYYEHQLKHLVAEFVQVLETLSHD
Tupaia_belangeri|10487  LLPDSRKLRTFSQRPFNKLEQLASGNKDSRDRRLILWYFEHQLKHLVAEFVQVLETLSHD
Callithrix_jacchus|9811 LLPDNRKLRIFSQHPFDKLEQLSSGNKDSRDRRLILWYFEHQLKHLVAEFVQVLETLSHD
Pan_troglodytes|8365    LLPDNRKLRIFSQRPFDKLEQLSSGNKDSRDRRLILWYFEHQLKHLVAEFVQVLETLSHD
Gorilla_gorilla|14702   LLPDNRKLRIFSQHPFDKLEQLSSGNKDSRDRRLILWYFEHQLKHLVAEFVQVLETLSHD
Homo_sapiens|52188      LLPDNRKLRIFSQRPFDKLEQLSSGNKDSRDRRLILWYFEHQLKHLVAEFVQVLETLSHD
                        ****.**** ** :*:.:** ::***:**********::************:*****.:*

Ochotona_princeps|12542 SLVATKTRALLAAQELLCNKPEEEKALLVQVVNKLGDPQNKIATKASHLLETLLCKHPNM
Otolemur_garnettii|2292 TLVTTKIRALTVAHELLCNKPEEEKALLVQLVNKLGDPQNRIATKASHLLETLLSKHPNM
Tarsius_syrichta|2643   TLVTTKTRALTVAHELLCNKPEEEKALLVQVVNKLGDPQNRIAAKASHLLETLLSKHPNM
Cavia_porcellus|5782    SLEATKTRALLAAHELLCNKPEEEKALLMQVVNKLGDPQNRIATKASHLLETLLCKHPNM
Microcebus_murinus|3020 TLVTTKTRALLVAHELLCNKPEEEKALLVQLVNKLGDPQNRVATKASHLLETLLCKHPNM
Mus_musculus|23751      SLVTTKTRALVAAHELLCDKPEEEKALLVQVINKLGDPQNRIATKASHLLEVLLRKHPNM
Rattus_norvegicus|5273  SLVTTKTRALVAAHELLCDKPEEEKALLVQVINKLGDPQNRIATKASHLLEVLLRKHPNM
Tupaia_belangeri|10487  SLVTTKTRALIVAHELLCNKPEEEKALLVQVVNKLGDPQNRIAAKASHLLETLLSKHPNM
Callithrix_jacchus|9811 TLVTTKTRALTVAHELLCNKPEEEKALLVHVVNKLGDPQNRIATKASHLLETLLCKHPNM
Pan_troglodytes|8365    TLVTTKTRALTVAHELLCNKPEEEKALLVQVVNKLGDPQNRIATKASHLLETLLCKHPNM
Gorilla_gorilla|14702   TLVTTKTRALTVAHELLCNKPEEEKALLVQVVNKLGDPQNRIATKASHLLETLLCKHPNM
Homo_sapiens|52188      TLVTTKTRALTVAHELLCNKPEEEKALLVQVVNKLGDPQNRIATKASHLLETLLCKHPNM
                        :* :** *** .*:****:*********::::********::*:*******.** *****

Ochotona_princeps|12542 KGVVCGEVERLLFRSNISSKAQYYAVCFLNQMALSHEECNLANKLITIYFCFFRACVKKK
Otolemur_garnettii|2292 KGVVCGEVERLLFRSNISPKAQYYAICFLNQMVLSHEESELANKLITLYFCFFRTCIKKK
Tarsius_syrichta|2643   KGVVCGEVERLLFRSNISSKAQYYAICFLNQMALSHEESELANKLITLYFCFFRTCIKKK
Cavia_porcellus|5782    KGVVCGEIERLLFRSNISPKAQYYAICFLNQIVLSHEESELANKLITI-----RTCIKKK
Microcebus_murinus|3020 KGVVCGEVERLLFRSNISPKAQYYAICFLNQMALSHEESELANKLITLYFCFFRTCIKKK
Mus_musculus|23751      KGVVCAEIERLLFRSNISPKAQYYAICFLNQMVLSHEESELANKLITLYFCFFRTCIKKK
Rattus_norvegicus|5273  KGVVCGELERLLFRSNISPKAQYYAICFLNQMVLSHEESELANKLITLYFCFFRTCIKKK
Tupaia_belangeri|10487  KGVVCGEVERLLFRSNISSKAQYYAICFLNQMVLSHEESDLANKLITLYFCFFRTCIKKK
Callithrix_jacchus|9811 KGVVCGEVERLLFRSNISSKAQYYAICFLNQMALSHEESELANKLITIYFCFFQTCIKKK
Pan_troglodytes|8365    KGVVSGEVERLLFRSNISSKAQYYAICFLNQMALSHEESELANKLITVYFCFFRTCVKKK
Gorilla_gorilla|14702   KGVVSGEVERLLFRSNISSKAQYYAICFLNQMVLSHEESELANKLITVYFCFFRTCVKKK
Homo_sapiens|52188      KGVVSGEVERLLFRSNISSKAQYYAICFLNQMALSHEESELANKLITVYFCFFRTCVKKK
                        ****..*:**********.******:*****:.*****.:*******:     ::*:***

Ochotona_princeps|12542 DIDSKMLSALLTGVNRAYPYAEADDDNVREQVDTLFKVLHVVNFSTSVQALMLLFQVMNS
Otolemur_garnettii|2292 DIESKMLSALLTGVNRAYPYAKSGDDKVREQVDTLFKVLHMVNFNTSVQALMLLFQVMNS
Tarsius_syrichta|2643   DIESKMLSALLTGVNRAYPYSQTGDEKVKEQVDTLFKVLHIVNFNTSVQALMLLFQVMNS
Cavia_porcellus|5782    DIESKMLSALLSGVNRAYPYSQSGDEKVREQVDTLFRVLHVVNFNTSVQALMLLFQVMNS
Microcebus_murinus|3020 DIESKMLSALLTGVNRAYPYAQSSDDKVREQVXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Mus_musculus|23751      DIESKMLSAILTGVNRAYPYSQIGDDKVREQVDTLFKVLHVVNFNTSVQALMLLFQVMNS
Rattus_norvegicus|5273  DIESKMLSAILTGVNRAYPYSQIGDDRVREQVDTLFKVLHVVNFNTSVQALMLLFQVMNS
Tupaia_belangeri|10487  DIESKMLSALLTGVNRAYPYAQSGDDKVREQVDTLFKVLHAVNFSTSVQALMLLFQVMNS
Callithrix_jacchus|9811 DIESKMLSAILTGVNRAYPYSQSGDDKVREQVETLFKVLHVVNFNTSVQALMLLFQVMNS
Pan_troglodytes|8365    DVESKMLSALLTGVNRAYPYSQTGDDKVREQIDTLFKVLHIVNFNTSVQALMLLFQVMNS
Gorilla_gorilla|14702   DVESKMLSALLTGVNRAYPYSQTGDDKVREQIDTLFQVLHIVNFNTSVQALMLLFQVMNS
Homo_sapiens|52188      DVESKMLSALLTGVNRAYPYSQTGDDKVREQIDTLFKVLHIVNFNTSVQALMLLFQVMNS
                        *::******:*:********:: .*:.*:**:                            

Ochotona_princeps|12542 QQTISDRYYTALYRKMLDPGLRLCSKQAMFLNLVYKSLKADIMLRRVKAFVKRLLQITCT
Otolemur_garnettii|2292 QQTISDRYYTALYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tarsius_syrichta|2643   QQTISDRYYTALYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Cavia_porcellus|5782    QQTISDRYYTALYRKILDPGLLMCSKQAMFLNLVYKSLKADIVLRRVKAFVKRLLQVTCT
Microcebus_murinus|3020 XXXXXXXXXXXXXXKMLDPGLMMCSKQAMFLNLIYKSLKADIILRRVKAFVKRLLQVTCE
Mus_musculus|23751      QQTISDRYYTALYRKMLDPGLTTCSKQAMFLNLIYKSLKADIMLRRVKAFVKRLLQVTCT
Rattus_norvegicus|5273  QQTISDRYYTALYKKMLDPGLTTCSKQAMFLNLIYKSLKADIMLRRVKAFVKRLLQVTCT
Tupaia_belangeri|10487  QQTISDRYYMALYRKMLDPGLMMCSKQAMFLNLVYKSLKADIVLRRVKAFVKRLLQVTCG
Callithrix_jacchus|9811 QQTISDRYYTALYRKMLDPGLMMCSKQAMFLNLVYKSLKADIVLRRVKAFVKRLLQVTCQ
Pan_troglodytes|8365    QQTISDRYYTALYRKMLDPGLMTCSKQAMFLNLVYKSLKADIVLRRVKAFVKRLLQVTCQ
Gorilla_gorilla|14702   QQTISDRYYTALYRKMLDPGLMTCSKQAMFLNLVYKSLKADIVLRRVKAFVKRLLQVTCQ
Homo_sapiens|52188      QQTISDRYYTALYRKMLDPGLMTCSKQAMFLNLVYKSLKADIVLRRVKAFVKRLLQVTCQ
                                                                                    

Ochotona_princeps|12542 QMPPFICGALYLVSEILKVKPGLRSQLDDHLXXXDEENFVDIGDE-DDIEKFTDADRE--
Otolemur_garnettii|2292 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESDDEENFIDAKDD-DDVEKFTDADKE--
Tarsius_syrichta|2643   XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESDGEENFIDARDD-EDSEKFTDADKK--
Cavia_porcellus|5782    QTPPFICGALYLVSEILKAKPDLRSQLNNHVESDDEEKFVDAADD-DGIEKFTDADKETE
Microcebus_murinus|3020 QMPPFICGALYLVSEILKAKPGLRSQLDDHPESDDEENFIDARDDEEDIEKFTDADEE--
Mus_musculus|23751      QMPPFICGALYLVSEILKAKPDLRSQLDDHPES-DEENFVDVGDD-SDDEKFTDADKETA
Rattus_norvegicus|5273  QMPPFICGALYLVSEILKAKPDLRSQLDDHPES-DEENFVDVGDD-SDDEKFTDADRETA
Tupaia_belangeri|10487  QMPPFICGALYLVSEILKAKPALRSQLDDHPESDDEENFVDLGDD-EDIEKFTDADKE--
Callithrix_jacchus|9811 QMPPFICGALYLVSEILKAKPGLRSQLDDHPESDDEENFIDANDD-EDMEKFTDADKE--
Pan_troglodytes|8365    QMPPFICGALYLVSEILKAKPGLRSQLDDHPESDDEENFIDANDD-EDMEKFADADKE--
Gorilla_gorilla|14702   QMPPFICGALYLVSEILKAKPGLRSQLDDHPESDDEENFIDANDD-EDMEKFTDADKE--
Homo_sapiens|52188      QMPPFICGALYLVSEILKAKPGLRSQLDDHPESDDEENFIDANDD-EDMEKFTDADKE--
                                                          .**:*:*  *: .. ***:***.:  

Ochotona_princeps|12542 TETVGEGEPEEAADGRDAAS-KPAAASWVHLDNLKXXXXXXXXXXXXXXXXXXXXXXXXX
Otolemur_garnettii|2292 TDRGKTAETGETVSESDVETKKPGTASWVHVDNLKGGKQLNTYDPFSRNPLFCGAENTSL
Tarsius_syrichta|2643   ADTVEAAETEKTVSESGKEAKKPEIASWVHFDNLKGGKQFNTYDPFSRNPLFCGAENTSL
Cavia_porcellus|5782    VDTVKKVETEETV--SDTETKNPKTASWVHLNNLKGVKHLNTYDPFSRNPLFCGAENTSF
Microcebus_murinus|3020 TDTVKKAETEETVSESDIETKKTKIASWVHVDNLKGGKRLNTYDPFSRNPLFCGAENTSL
Mus_musculus|23751      TDAVKEVESKETEPESSAEAEKPKAASWVHFDNLKGGKQIKTYDPFSRNPLFCGAENTTL
Rattus_norvegicus|5273  TDAVEEVEAKEAEPESSTETEKPKAASWVHFDNLKGGKQIKTYDPFGRNPLFCGAEHTNL
Tupaia_belangeri|10487  TDTEKKVETEETVPKSGKETEKAKVASWVHVDNLKGGKHLNKYDPFSRNPLFCGAENTSL
Callithrix_jacchus|9811 TEMVKKFETEETIPETDTETRKPEIASWVHFDNLKGGKQLNKYDPFSRNPLFCGAENTSL
Pan_troglodytes|8365    TEIVKKLETEETVPETDVETKKPEVASWVHFDNLKGGKQLNKYDPFSRNPLFCGAENTSL
Gorilla_gorilla|14702   TEMVKKLETEETVPETDVETKKPEVASWVHFDNLKGGKQLNKYDPFSRNPLFCGAENTSL
Homo_sapiens|52188      TEIVKKLETEETVPETDVETKKPEVASWVHFDNLKGGKQLNKYDPFSRNPLFCGAENTSL
                        .:     *. ::    .  : :.  *****.:***                         

Ochotona_princeps|12542 XXXXXLSEHFHPSVSLFAKTILQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Otolemur_garnettii|2292 WELKKLSEHFHPSVALFAKTILQGNYIQYSGDPLQDFTLMRFLDRFVYRNPKPHKGKVNT
Tarsius_syrichta|2643   WELKKLSEHFHPSVALFAKTILQGDYIQYSGDPLQDFTLMRFLDRFVYRNPKPHKGKENT
Cavia_porcellus|5782    WELKKLSEHFHPSVALFAKTILQGNYIQYSGDPLQDFTLMRFLDRFVYRNPKPHRGKENT
Microcebus_murinus|3020 WELKKLSEHFHPSVALFAKTILQGNCIQYSGDPLQDFTLMRFLDRFVYRNPKPHRGKENT
Mus_musculus|23751      WELKKLSEHFHPSVALFAKTILEGNCIQYSGDPLQDFTLMRFLDRFVYRNPKLHKGKENT
Rattus_norvegicus|5273  WELRKLSQHFHPSVALFAKTILEGNHIQYSGDPLQDFTLMRFLDRFVYRNPKLHKGKENT
Tupaia_belangeri|10487  WELQKXXXXXXXXXXXXXXXXXXGNYIQYSGDPLQDFTLMRFLDRFVYRNPKPHKGKENT
Callithrix_jacchus|9811 WELKKLSVHFHPSVALFAKTILQGNYIQYSGDPLQDFTLMRFLDRFVYRNPKPHKGKENT
Pan_troglodytes|8365    WELKKLSVHFHPSVALFAKTILQGNYIQYSGDPLQDFTLMRFLDRFVYRNPKPHKGKENT
Gorilla_gorilla|14702   WELKKLSVHFHPSVALFAKTILQGNYIQYSGDPLQDFTLMRFLDRFVYRNPKPHKGKENT
Homo_sapiens|52188      WELKKLSVHFHPSVALFAKTILQGNYIQYSGDPLQDFTLMRFLDRFVYRNPKPHKGKENT
                                                                                    

Ochotona_princeps|12542 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYKKFATVKEKQKRSAD
Otolemur_garnettii|2292 DSVVMQPKRKQFIKDIRSLTVNSKEFLAKEESQIPVDEVFFHRYYKKVA-VKVKQKQNSD
Tarsius_syrichta|2643   DSVVMQPKRKHFMNDIRSLAVNSKEFLAKEESQIPVDEVFFHRYYKKFAVVKKKQKQYAD
Cavia_porcellus|5782    DSVVMQPKRKHFIKDIRSLAVNSKEFLAKEESQIPVDEVFFHRYYKKVAVVKEKQKPNTD
Microcebus_murinus|3020 DSVVMQPKRKHFMKDIRGLAVNSKEFLAKEESQIPVDEVFFHXXXXXXX-XXXXXXXXXX
Mus_musculus|23751      DSVVMQPKRKHFMKNVRDLAVNSKEFLAKEESQIPVDEVFFYRYYKKVAVVKDKQKRSAD
Rattus_norvegicus|5273  DSVVMQPKRKHFMKNVRDLAVNSKEFLAKEESQIPVDEVFFYRYYKKVAVTKDKQKRNAD
Tupaia_belangeri|10487  DSVVMQPKRKHFIKDIRSLAVNSREFLAKEESQIPVDEVFFHRYYKKAATVKEKQKRNAD
Callithrix_jacchus|9811 ESVVMQPKRKHFIKDIHHLAVNSKEFLAKEESQIPVDEVFFHRYYKKVA-VKEKQKRNED
Pan_troglodytes|8365    DSVVMQPKRKHFIKDIRHLPVNSKEFLAKEESQIPVDEVFFHRYYKKVA-VKEKQKRDAD
Gorilla_gorilla|14702   DSVVMQPKRKHFIKDIRHLPVNSKEFLAKEESQIPVDEVFFHRYYKKVA-VKEKQKRDAD
Homo_sapiens|52188      DSVVMQPKRKHFIKDIRHLPVNSKEFLAKEESQIPVDEVFFHRYYKKVA-VKEKQKRDAD
                                                                                    

Ochotona_princeps|12542 EESIEDVDDEEFEKMIDTFEDDNCFTPGKDDLDFASNMKKKSKRVKDNMEDEDSENSDDE
Otolemur_garnettii|2292 EESIEDVDDDEFEKLIDTFEDDNCFSSGKDDMDFASNVKKQTERTKGSPEDEDSEGSDDE
Tarsius_syrichta|2643   EDSIEDVDDEEFEKLIDTFEDDNCFSAAKNDMDFAGNVKKKAKGAKQNPEDEYSEDSDDE
Cavia_porcellus|5782    EESIEDVDDEEFEKMIDTFEDDNCYTPGKGDLDFVSNMKKTKKRAKDNLEDEDSEGSDDE
Microcebus_murinus|3020 XXXXXXXXXXXXXXXXXTFEDDNCFSSGKDDMDFAGNVKKKTKGAKHNPEDEDSEGSDDE
Mus_musculus|23751      EESIEDIDDEEFENMIDTFEDDNCFPPGKDDIDFASNMKK-AKGAKADL--EDSESSDGE
Rattus_norvegicus|5273  EDSIEDVDDEEFENMIDTFEDDNCFTPGKDDMDFASNMKK-IKGAKDDL--EDSESSDDE
Tupaia_belangeri|10487  EESIEDVDDEEFEKMIDTFEDDNCFISGKDDLDFAGNVKKKRKGVKDNAQDDYSEGSDDE
Callithrix_jacchus|9811 EESIEDVDDEEFEKLIDTFEDDNCFSSGKDDMDFAGNVKKRIKRAKGNTADEDSEGGDDE
Pan_troglodytes|8365    EESIEDVDDEEFEELIDTFEDDNCFSSGKDDMDFAGNVKKRTKGAKDKTLDEDSEGSDDE
Gorilla_gorilla|14702   EESIEDVDDEEFEELIDTFEDDNCFSSGKDDMDFAGNVKKRTKGAKDNTLDEDSEGSDDE
Homo_sapiens|52188      EESIEDVDDEEFEELIDTFEDDNCFSSGKDDMDFAGNVKKRTKGAKDNTLDEDSEGSDDE
                                         *******: ..*.*:**..*:**  : .* .   : **..*.*

Ochotona_princeps|12542 FDNLDDDEVSLGSMD-EEFAELDEDGGTFMDVSDDEXXXXX---XXXXXXXXXXXXXXXX
Otolemur_garnettii|2292 LGNLDDDEVSLGSMN-EEFAEIDEDGGTFMDLLDDENEDIL--ELDEGCSKVSTKKSKRK
Tarsius_syrichta|2643   IDNLDDDEVSLGSMNNEEFADIDEDGGTFMDVLDDDSEAIP--EL-EVHSKSSSKKSKRK
Cavia_porcellus|5782    FGNLDDEEVSLGSMN-EDFDELDDDGGTFMDVSDEGSEGAP--ELDDDNSKDNTKKNKRK
Microcebus_murinus|3020 IDNLDDDEVSLGSMNDE-FAEIDEDGGTFMDVLDDESEGIA--ELDEGCSKVNTKKSKRK
Mus_musculus|23751      LGDLDDDEVSLGSMNDEDF-EIDEDGGTFMDVSDDESEDAP--EFADANPKANTKKSKRK
Rattus_norvegicus|5273  LGDLDDDEVSLGSMNDEDF-EIDEDGGTFMDVSDDESDHVP--EFGEASPKASTKKSKRK
Tupaia_belangeri|10487  LDNLDDDEVSLGSMN-EEFAEIDEDGGTFMDLLDDESEGIP--ELEKVSSKVNTKKSKRK
Callithrix_jacchus|9811 LDNLDEDEVSLGSMDDEEFAEVDGDGGTFMDVLDDESESVPVTEL-EVHSKVNTKRSKRK
Pan_troglodytes|8365    LGNLDDDEVSLGSMDGEEFAEVDEDGGTFMDVLDDESERVP--EL-EAHSKVSTKKSKRK
Gorilla_gorilla|14702   LGNLDDDEVSLGSMDDEEFAEVEEDGGTFMDVLDDESESVP-AEL-EVHSKVSTKKSKRK
Homo_sapiens|52188      LGNLDDDEVSLGSMDDEEFAEVDEDGGTFMDVLDDESESVP--EL-EVHSKVSTKKSKRK
                        :.:**::*******: * * ::: *******: *:                         

Ochotona_princeps|12542 XXXXXXXXXXXXXPRKKKKRNTNDASLFVSAEEFGHLLDENMGSKFDNIGLNAMANKDNA
Otolemur_garnettii|2292 G-DDFHFAGSFQXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tarsius_syrichta|2643   GADDFDFAGSFQGPRKKKKRNLQDSSLFVSAEEFGHLLDENVGSKFDSTGMNAMANKDNA
Cavia_porcellus|5782    STGDVDFAGSFLGPKKKKKRSLHDSSLFVSAEEFGHLLDENMGSKFDNIGMNAMANKDNA
Microcebus_murinus|3020 GADDFDFAGSFQGSRKKQKRNLNDSSLFVSAEEFGHLLDENMGSKFDSIGMNAMANKDNA
Mus_musculus|23751      SEDDFDFAGSFQGQK-KKKKSFNDSSLFVSAEEFGHLLDENMGSKFDTIGMNAMANRDNA
Rattus_norvegicus|5273  SEDDFDFAGSFQGQK-KKKKSFNDSSLFVSAEEFGHLLDENMGSKFDTTGMNAMANKDNA
Tupaia_belangeri|10487  GAADLDFAESFQGPRKKKKRNLNDSSLFVSTEEFGHLLDENMGSKFDNIGMNAMTNKDNA
Callithrix_jacchus|9811 STDDFDFADSFQGPR-KKKRNFSDSSLFVSAEEFGHLLDENMGSKFDNIGMNAMANKDNA
Pan_troglodytes|8365    GTDDFDFAGSFQGPR-KKKRNLNDSSLFVSAEEFGHLLDENMGSKFDNTGMNAMANKDNA
Gorilla_gorilla|14702   GTDDFDFAGSFQGPR-KKKRNLNDSSLFVSAEEFGHLLDENMGSKFDNIGMNAMANKDNA
Homo_sapiens|52188      GTDDFDFAGSFQGPR-KKKRNLNDSSLFVSAEEFGHLLDENMGSKFDNIGMNAMANKDNA
                                                                                    

Ochotona_princeps|12542 SLKQLKWEAERDNWLHNRDVKSILRKK-KHFK-----KKKLKFTQKTKKQRK
Otolemur_garnettii|2292 XLKQLRWEAERDDWLHNKDVKSIIKRK-KNFK-----KKRLKTTHKTKKQRK
Tarsius_syrichta|2643   SFKQLRWEAERDDWLHNRDVKSIIKKK-KHFK-----KKRMKTIHKTKKQRK
Cavia_porcellus|5782    SLKQLRWEAERDDWLHNRDVSPLVMKKLLQFKKLVMIKKRSVSTHKPRFRAL
Microcebus_murinus|3020 SLKQLK-EVERDDWLHNKDVKSIIKKK-KNFR-----KRRLKTTHKSKKQRK
Mus_musculus|23751      SFKQLKWEAERDDWLHNRDVKSIIKKK-KNFR-----KK-MKAPQKPKRQRK
Rattus_norvegicus|5273  SFKQLKWEAERDDWLHNRDVKSIIKKK-KNFR-----KK--KAPQKPKRQRK
Tupaia_belangeri|10487  SLKQLRWEAERDDWLHNRDVKSIIRKK-KNFK-----KKKPKTTQKAKKQRK
Callithrix_jacchus|9811 SLKQLRWEAERDDWLHNRDVKSIIKKK-KNFK-----KKRIKTTQKTKKQRK
Pan_troglodytes|8365    SLKQLRWEAERDDWLHNRDAKSIIKKK-KHFK-----KKRIKTTQKTKKQRK
Gorilla_gorilla|14702   SLKQLRWEAERDDWLHNRDAKSIIKKK-KHFK-----KKRIKTTQKTKKQRK
Homo_sapiens|52188      SLKQLRWEAERDDWLHNRDAKSIIKKK-KHFK-----KKRIKTTQKTKKQRK
                         :***: *.***:****:*...:: :*  :*:     *:     :*.: :