Orthologs Set ID: EOG4003GG


Orthology Database
OrthoDB4
Gene Symbol(s)
XXbac-BPG116M5.17,CFB

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Cavia porcellus 6011 1573, 2392, 2578, 2752, 2854, 2991, 3130, 3262, 3364, 3502, 3600, 3718, 3878, 3955, 4056, 4189, 4239
Dipodomys ordii 14261 1573, 2392, 2578, 2752, 2854, 2991, 3111, 3126, 3130, 3262, 3364, 3502, 3600, 3718, 3878, 3955, 4001, 4056, 4189, 4239
Homo sapiens 72847 46, 256, 433, 532, 673, 763, 904, 999, 1111, 1277, 1354, 1446, 1573, 2392, 2578, 2752, 2854, 2991, 3130, 3262, 3364, 3502, 3600, 3718, 3878, 3955, 4056, 4189, 4239
Homo sapiens 72854 1573, 2392, 2578, 2752, 2854, 2991, 3130, 3262, 3364, 3502, 3600, 3718, 3878, 3955, 4056, 4189, 4239
Homo sapiens 78210 1573, 2392, 2578, 2752, 2854, 2991, 3130, 3262, 3364, 3502, 3600, 3718, 3878, 3955, 4056, 4189, 4239
Homo sapiens 79145 1573, 2392, 2578, 2752, 2854, 2991, 3130, 3262, 3364, 3502, 3600, 3718, 3878, 3955, 4056, 4189, 4239
Homo sapiens 80784 1573, 2392, 2578, 2752, 2854, 2991, 3130, 3262, 3364, 3502, 3600, 3718, 3878, 3955, 4056, 4189, 4239
Homo sapiens 81700 1573, 2392, 2578, 2752, 2854, 2991, 3130, 3262, 3364, 3502, 3600, 3718, 3878, 3955, 4056, 4189, 4239
Homo sapiens 82548 1573, 2392, 2578, 2752, 2854, 2991, 3130, 3262, 3364, 3502, 3600, 3718, 3878, 3955, 4056, 4189, 4239
Mus musculus 83643 1573, 2392, 2578, 2752, 2854, 2991, 3130, 3262, 3364, 3502, 3600, 3718, 3878, 3955, 4056, 4189, 4239
Ochotona princeps 11022 1573, 2392, 2542, 2578, 2752, 2854, 2991, 3130, 3262, 3364, 3502, 3600, 3718, 3878, 3955, 4056, 4189, 4239
Oryctolagus cuniculus 3232 46, 415, 1417, 1633, 1723, 1818, 1930, 2096, 2173, 2265, 2383, 2392, 2578, 2752, 2854, 2991, 3130, 3262, 3364, 3502, 3600, 3718, 3872, 3955, 4056, 4189, 4239
Otolemur garnettii 9950 2491, 2578, 2752, 2854, 2991, 3364, 3502, 3600, 3718, 3878, 3955, 3957, 4005, 4056, 4189, 4239
Pan troglodytes 31487 1573, 2392, 2578, 2752, 2854, 2991, 3130, 3262, 3364, 3502, 3600, 3718, 3878, 3955, 4056, 4189, 4239
Spermophilus tridecemlineatus 14590 1573, 1593, 1612, 1644, 2392, 2459, 2578, 2752, 2854, 2991, 3130, 3262, 3364, 3502, 3600, 3718, 3878, 3955, 4056, 4189, 4225, 4239
Tarsius syrichta 8487 1573, 1638, 2392, 2578, 2752, 2854, 2991, 3130, 3262, 3364, 3502, 3600, 3718, 3878, 3955, 4056, 4189, 4239
Tupaia belangeri 1383 1573, 2392, 2460, 2508, 2529, 2541, 2547, 2562, 2574, 2578, 2595, 2613, 2619, 2752, 2854, 2991, 3130, 3262, 3364, 3468, 3471, 3502, 3600, 3718, 3878, 3899, 3955, 4056, 4189, 4239

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Cavia porcellus 6011 ENSCPOT00000021457 100715616 ENSCPOG00000025340 cavPor3
Dipodomys ordii 14261 ENSDORT00000011703 ENSDORG00000011702 dipOrd1
Homo sapiens 72847 ENST00000456570 ENSG00000244255 XXbac-BPG116M5.17 hg19,GRCh37
Homo sapiens 72854 ENST00000425368 629 ENSG00000243649 CFB hg19,GRCh37
Homo sapiens 78210 ENST00000417261 629 ENSG00000239754 CFB hg19,GRCh37
Homo sapiens 79145 ENST00000455591 629 ENSG00000241534 CFB hg19,GRCh37
Homo sapiens 80784 ENST00000424727 629 ENSG00000243570 CFB hg19,GRCh37
Homo sapiens 81700 ENST00000399981 629 ENSG00000241253 CFB hg19,GRCh37
Homo sapiens 82548 ENST00000426239 629 ENSG00000242335 CFB hg19,GRCh37
Mus musculus 83643 ENSMUST00000128767 14962 ENSMUSG00000090231 mm9
Ochotona princeps 11022 ENSOPRT00000003922 101536636 ENSOPRG00000003908 OchPri2.0
Oryctolagus cuniculus 3232 ENSOCUT00000007008 100355944 ENSOCUG00000029682 oryCun2.0
Otolemur garnettii 9950 ENSOGAT00000009572 ENSOGAG00000009568 otoGar1
Pan troglodytes 31487 ENSPTRT00000033244 494140 ENSPTRG00000017995 CFB panTro2
Spermophilus tridecemlineatus 14590 ENSSTOT00000014591 ENSSTOG00000014577 speTri1
Tarsius syrichta 8487 ENSTSYT00000012130 ENSTSYG00000012131 tarSyr1
Tupaia belangeri 1383 ENSTBET00000001384 ENSTBEG00000001359 tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Cavia porcellus 4694 ENSCPOP00000014382 100715616 ENSCPOG00000025340 cavPor3
Dipodomys ordii 13398 ENSDORP00000011001 ENSDORG00000011702 dipOrd1
Homo sapiens 84191 ENSP00000413351 629 ENSG00000242335 CFB hg19,GRCh37
Homo sapiens 85590 ENSP00000382862 629 ENSG00000241253 CFB hg19,GRCh37
Homo sapiens 87535 ENSP00000414341 629 ENSG00000241534 CFB hg19,GRCh37
Homo sapiens 88746 ENSP00000414889 629 ENSG00000239754 CFB hg19,GRCh37
Homo sapiens 152636 ENSP00000401719 629 ENSG00000243570 CFB hg19,GRCh37
Homo sapiens 1945 ENSP00000416561 629 ENSG00000243649 CFB hg19,GRCh37
Homo sapiens 2278 ENSP00000410815 ENSG00000244255 XXbac-BPG116M5.17 hg19,GRCh37
Mus musculus 15374 ENSMUSP00000119977 14962 ENSMUSG00000090231 mm9
Ochotona princeps 9600 ENSOPRP00000003609 101536636 ENSOPRG00000003908 OchPri2.0
Oryctolagus cuniculus 23506 ENSOCUP00000006061 100355944 ENSOCUG00000029682 oryCun2.0
Otolemur garnettii 8560 ENSOGAP00000008561 ENSOGAG00000009568 otoGar1
Pan troglodytes 17528 ENSPTRP00000030715 494140 ENSPTRG00000017995 CFB panTro2
Spermophilus tridecemlineatus 13063 ENSSTOP00000013073 ENSSTOG00000014577 speTri1
Tarsius syrichta 7763 ENSTSYP00000011129 ENSTSYG00000012131 tarSyr1
Tupaia belangeri 1178 ENSTBEP00000001201 ENSTBEG00000001359 tupBel1

multiple sequence alignment in CLUSTALW format


Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          ATGGACCCACTGAGGGCTCTCCTTTGCCTGCTGCTCCTGTACCCAGGCCTGGCACCTGCC
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  ATGGGCCCACTGATGGTTCTTTTTTGCCTGCTGTTCCTGTACCCAGGTCTGGCAGACTCG
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          ACTCCTTCCTGCAGTCAGAACGTGAATATCTCTGGCGGCACCTTCACCCTCAGCCACGGC
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  GCTCCCTCCTGCCCTCAGAACGTGAATATCTCGGGTGGCACCTTCACCCTCAGCCATGGC
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          TGGGCCCCCGGAAGCCTCCTCACCTACTCCTGCCCCCAGGACCGCTACCCGTCCCCGCCG
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  TGGGCTCCTGGGAGCCTTCTCACCTACTCCTGCCCCCAGGGCCTGTACCCATCCCCAGCA
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          ------------------------------------------------------------
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  TCACGGCTGTGCAAGAGCAGCGGACAGTGGCAGACCCCAGGAGCCACCCGGTCTCTGTCT
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          ------------------------------------------------------------
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  AAGGCGGTCTGCAAACCTGGCCACTGCCCCAACCCAGGCATTTCACTGGGCGCAGTGCGG
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------ATGGGGAGCAACCTT---
Dipodomys_ordii|14261               ------------------------------------------ATGGGGCACAATCCC---
Spermophilus_tridecemlineatus|14590 ------------------------------------------ATGGGGTGCCATCTC---
Tupaia_belangeri|1383               ------------------------------------------ATGGGGAGCCATCTC---
Oryctolagus_cuniculus|3232          ------------------------------------------TGGCGGCTGTGCAAAAGC
Ochotona_princeps|11022             ------------------------------------------ATGAGGAATACTCCT---
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------GCTGCCATGGGGCACAGCGTT---
Mus_musculus|83643                  ------------------------------------------ATGACAATGGAG------
Homo_sapiens|72847                  ACAGGCTTCCGCTTTGGTCATGGGGACAAGGTCCGCTATCGCTGCTCCTCGAATCTTGTG
Pan_troglodytes|31487               ------------------------------------------ATGGGGAGCAATCTC---
Homo_sapiens|81700                  ------------------------------------------ATGGGGAGCAATCTC---
Homo_sapiens|80784                  ------------------------------------------ATGGGGAGCAATCTC---
Homo_sapiens|82548                  ------------------------------------------ATGGGGAGCAATCTC---
Homo_sapiens|72854                  ------------------------------------------ATGGGGAGCAATCTC---
Homo_sapiens|78210                  ------------------------------------------ATGGGGAGCAATCTC---
Homo_sapiens|79145                  ------------------------------------------ATGGGGAGCAATCTC---
                                                                                                

Tarsius_syrichta|8487               ---------------------------------------------------AGCCCCCTA
Dipodomys_ordii|14261               ---------------------------------------------------AGCTCCCAA
Spermophilus_tridecemlineatus|14590 ---------------------------------------------------AGCCCCCAC
Tupaia_belangeri|1383               ---------------------------------------------------AGCCCCCAG
Oryctolagus_cuniculus|3232          AACGGACAGTGGCAGACTCCGGGAGCCAAGCGGCTGACGAGGGCAGTCTGCAAACCTGTT
Ochotona_princeps|11022             ---------------------------------------------------GGCCCCCGA
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ---------------------------------------------------GGCCCCTGG
Mus_musculus|83643                  ---------------------------------------------------AGCCCCCAG
Homo_sapiens|72847                  CTCACGGGGTCTTCGGAGCGGGAGTGCCAGGGCAACGGGGTCTGGAGTGGAACGGAGCCC
Pan_troglodytes|31487               ---------------------------------------------------AGCCCCCAA
Homo_sapiens|81700                  ---------------------------------------------------AGCCCCCAA
Homo_sapiens|80784                  ---------------------------------------------------AGCCCCCAA
Homo_sapiens|82548                  ---------------------------------------------------AGCCCCCAA
Homo_sapiens|72854                  ---------------------------------------------------AGCCCCCAA
Homo_sapiens|78210                  ---------------------------------------------------AGCCCCCAA
Homo_sapiens|79145                  ---------------------------------------------------AGCCCCCAA
                                                                                                

Tarsius_syrichta|8487               CTCTGC---CTGATGCCCTTG---------------------------------------
Dipodomys_ordii|14261               CTCTGG---CTTGTGTCCTTA---------------------------------------
Spermophilus_tridecemlineatus|14590 CTCTGT---CTGGTATCTTTG---------------------------------------
Tupaia_belangeri|1383               CTCTGC---CTGCTGTCCTTG---------------------------------------
Oryctolagus_cuniculus|3232          CGCTGT---CCAGCCCCTGTCTCCTTTGAGAATGGCATGTACACCCCACGGCTGGCAGCC
Ochotona_princeps|11022             CTCTGCCACCTTGTACCCTTG---------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                CTCTGC---CTGGCTCCCTTA---------------------------------------
Mus_musculus|83643                  CTCTGC---CTCGTCCTCTTG---------------------------------------
Homo_sapiens|72847                  ATCTGC---CGCCAACCCTACTCTTATGACTTCCCTGAGGACGTGGCCCCTGCCCTGGGC
Pan_troglodytes|31487               CTCTGC---CTGATGCCCTTC---------------------------------------
Homo_sapiens|81700                  CTCTGC---CTGATGCCCTTT---------------------------------------
Homo_sapiens|80784                  CTCTGC---CTGATGCCCTTT---------------------------------------
Homo_sapiens|82548                  CTCTGC---CTGATGCCCTTT---------------------------------------
Homo_sapiens|72854                  CTCTGC---CTGATGCCCTTT---------------------------------------
Homo_sapiens|78210                  CTCTGC---CTGATGCCCTTT---------------------------------------
Homo_sapiens|79145                  CTCTGC---CTGATGCCCTTT---------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          TACCCGGTGGGCAGCAACCTGAGCTTCGAGTGTGAGGATGGCTTCACGCTGCGGGGCTCG
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  ACTTCCTTCTCCCACATGCTTGGGGCCACCAATCCCACCCAGAAGACAAAGGATCATGAA
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          CCCGTGCGGCACTGTCGC------------------------------------------
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  AATGGAACTGGGACTAACACCTATGCGGCCTTAAACAGTGTCTATCTCATGATGAACAAC
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ---------GTCTTGGGCCTC---------------------------------------
Dipodomys_ordii|14261               ---------TTCTTAGCCTTC---------------------------------------
Spermophilus_tridecemlineatus|14590 ---------GTCTTGGGCCTC---------------------------------------
Tupaia_belangeri|1383               ---------GTCTTGGGCCTC---------------------------------------
Oryctolagus_cuniculus|3232          ---------CTCAACGGCATG---------------------------------------
Ochotona_princeps|11022             ---------TTCCTGAGGCTC---------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ---------GTCTTGGGGCTG---------------------------------------
Mus_musculus|83643                  ---------GTCTTAGGCTTC---------------------------------------
Homo_sapiens|72847                  CAAATGCGACTCCTCGGCATGGAAACGATGGCCTGGCAGGAAATCCGACATGCCATCATC
Pan_troglodytes|31487               ---------ATCTTGGGCCTC---------------------------------------
Homo_sapiens|81700                  ---------ATCTTGGGCCTC---------------------------------------
Homo_sapiens|80784                  ---------ATCTTGGGCCTC---------------------------------------
Homo_sapiens|82548                  ---------ATCTTGGGCCTC---------------------------------------
Homo_sapiens|72854                  ---------ATCTTGGGCCTC---------------------------------------
Homo_sapiens|78210                  ---------ATCTTGGGCCTC---------------------------------------
Homo_sapiens|79145                  ---------ATCTTGGGCCTC---------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          ------------------------------------------------------------
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  CTTCTGACAGATGGAAAGTCCAATATGGGTGGCTCTCCCAAGACAGCTGTTGACCATATC
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          ------------------------------------------------------------
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  AGAGAGATCCTGAACATCAACCAGAAGAGGAATGACTATCTGGACATCTATGCCATCGGG
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          ------------------------------------------------------------
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  GTGGGCAAGCTGGATGTGGACTGGAGAGAACTGAATGAGCTAGGGTCCAAGAAGGATGGT
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          ------------------------------------------------------------
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  GAGAGGCATGCCTTCATTCTGCAGGACACAAAGGCTCTGCACCAGGTCTTTGAACATATG
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          ------------------------------------------------------------
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  CTGGATGTCTCCAAGCTCACAGACACCATCTGCGGGGTGGGGAACATGTCAGCAAACGCC
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          ------------------------------------------------------------
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  TCTGACCAGGAGAGGACACCCTGGCATGTCACTATTAAGCCCAAGAGCCAAGAGACCTGC
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          ------------------------------------------------------------
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  CGGGGGGCCCTCATCTCCGACCAATGGGTCCTGACAGCAGCTCATTGCTTCCGCGATGGC
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          ------------------------------------------------------------
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  AACGACCACTCCCTGTGGAGGGTCAATGTGGGAGACCCCAAATCCCAGTGGGGCAAAGAA
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          ------------------------------------------------------------
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  TTCCTTATTGAGAAGGCGGTGATCTCCCCAGGGTTTGATGTCTTTGCCAAAAAGAACCAG
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          ------------------------------------------------------------
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  GGAATCCTGGAGTTCTATGGTGATGACATAGCTCTGCTGAAGCTGGCCCAGAAAGTAAAG
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          ------------------------------------------------------------
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  ATGTCCACCCATGCCAGGCCCATCTGCCTTCCCTGCACGATGGAGGCCAATCTGGCTCTG
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          ------------------------------------------------------------
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  CGGAGACCTCAAGGCAGCACCTGTAGGGACCATGAGAATGAACTGCTGAACAAACAGAGT
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ---------------------TTGTCTCAA------------------------------
Dipodomys_ordii|14261               ---------------------TCGTGTGGA------------------------------
Spermophilus_tridecemlineatus|14590 ---------------------TTGGCTGGA------------------------------
Tupaia_belangeri|1383               ---------------------CTGTCTGGA------------------------------
Oryctolagus_cuniculus|3232          ---------------------TGGGATGGAGAGACGGATCATGAGAATGGGACTGGGACC
Ochotona_princeps|11022             ---------------------TTGACTGGA------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ---------------------TGGTCTGGA------------------------------
Mus_musculus|83643                  ---------------------TCCTCTGGA------------------------------
Homo_sapiens|72847                  GTTCCTGCTCATTTTGTCGCCTTGAATGGGAGCAAACTGAACATTAACCTTAAGATGGGA
Pan_troglodytes|31487               ---------------------TTGTCTGGA------------------------------
Homo_sapiens|81700                  ---------------------TTGTCTGGA------------------------------
Homo_sapiens|80784                  ---------------------TTGTCTGGA------------------------------
Homo_sapiens|82548                  ---------------------TTGTCTGGA------------------------------
Homo_sapiens|72854                  ---------------------TTGTCTGGA------------------------------
Homo_sapiens|78210                  ---------------------TTGTCTGGA------------------------------
Homo_sapiens|79145                  ---------------------TTGTCTGGA------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          AACATCTACAAGGCGCTAAATGCTGTCAACATCATGATGAACAACCAGATGCAGCGCCTT
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  GTGGAGTGGACAAGCTGTGCCGAGGTTGTCTCCCAAGAAAAAACCATGTTCCCCAACTTG
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          ------------------------------------------------------------
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  ACAGATGTCAGGGAGGTGGTGACAGACCAGTTCCTATGCAGTGGGACCCAGGAGGATGAG
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------GGTGTGAGCACAACTCCA---TTGCCCTTCACCAGGCCCCAAGTCTCC
Dipodomys_ordii|14261               ------------GGTGTGAGTACAACTCCA---TCACCTGTGGATCAGGCCCAAAGTTCC
Spermophilus_tridecemlineatus|14590 ------------AGTGTGAACACAATTCCATTGTGGCCC------CAGCCCCAAGGCTCC
Tupaia_belangeri|1383               ------------GGCGTGAGCGCGACCCCA---GTGCCTGCAGACCAGTCCCAGAGATCC
Oryctolagus_cuniculus|3232          ------------GGCATGGAAACCACGGGC---TGGCAGGAAATCCGACACGCCATCATC
Ochotona_princeps|11022             ------------GGTGTGGGCACAACTCCC---TTGCCTGAGGACCAGCCTCAACGCTCC
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------GGTGTGAGCTCCACCACA---CTGCCCACATCCAGGCCCTGGAGCCCC
Mus_musculus|83643                  ------------GGTGTGAGCGCAACTCCA---GTGCTTGAGGCCCGGCCCCAAGTCTCC
Homo_sapiens|72847                  AGTCCCTGCAAGGGTGTGACCACCACTCCA---TGGTCTTTGGCCCGGCCCCAGGGATCC
Pan_troglodytes|31487               ------------GGTGTGACCACCACTCCA---TGGCCTTTGGCCCAGCCCCAGGAATCC
Homo_sapiens|81700                  ------------GGTGTGACCACCACTCCA---TGGTCTTTGGCCCGGCCCCAGGGATCC
Homo_sapiens|80784                  ------------GGTGTGACCACCACTCCA---TGGTCTTTGGCCCGGCCCCAGGGATCC
Homo_sapiens|82548                  ------------GGTGTGACCACCACTCCA---TGGTCTTTGGCCCGGCCCCAGGGATCC
Homo_sapiens|72854                  ------------GGTGTGACCACCACTCCA---TGGTCTTTGGCCCGGCCCCAGGGATCC
Homo_sapiens|78210                  ------------GGTGTGACCACCACTCCA---TGGTCTTTGGCCCGGCCCCAGGGATCC
Homo_sapiens|79145                  ------------GGTGTGACCACCACTCCA---TGGTCTTTGGCCCGGCCCCAGGGATCC
                                                                                                

Tarsius_syrichta|8487               TGCTCTCTGGAGGGGGTANNNNNNNNNNNNNNNNNNNNNNNN------------------
Dipodomys_ordii|14261               TGTTCTCTGGAGGGGGTAGAGATCAAAGGTGGCTCATTCCAA------------------
Spermophilus_tridecemlineatus|14590 TGCTCTCTGGAGGGGGTAGAGATCAAAGGTGGCTCCTTCCAA------------------
Tupaia_belangeri|1383               TGTTCTCCGGAGGAGGCTGCGATCAAAGGCGGCTCCTTCCGG------------------
Oryctolagus_cuniculus|3232          CTCCTGACAGACGGGAAGTCCAATATGGGTGGCTCTCCCAAGCCGGCTGTTGACAGCATC
Ochotona_princeps|11022             TGCTCTCTGGAAGGGGTGGAGATCAAAGGTGGCTCCTTCCAG------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                TGCTCTCTGGAGGGGATAGAGATCAAAGGTGGCTCCTTCCAA------------------
Mus_musculus|83643                  TGCTCTCTGGAGGGAGTAGAGATCAAAGGCGGCTCCTTTCAA------------------
Homo_sapiens|72847                  TGCTCTCTGGAGGGGGTAGAGATCAAAGGCGGCTCCTTCCGA------------------
Pan_troglodytes|31487               TGCTCTCTGGAGGGGGTAGAGATCAAAGGCGGCTCCTTCCGA------------------
Homo_sapiens|81700                  TGCTCTCTGGAGGGGGTAGAGATCAAAGGCGGCTCCTTCCGA------------------
Homo_sapiens|80784                  TGCTCTCTGGAGGGGGTAGAGATCAAAGGCGGCTCCTTCCGA------------------
Homo_sapiens|82548                  TGCTCTCTGGAGGGGGTAGAGATCAAAGGCGGCTCCTTCCGA------------------
Homo_sapiens|72854                  TGCTCTCTGGAGGGGGTAGAGATCAAAGGCGGCTCCTTCCGA------------------
Homo_sapiens|78210                  TGCTCTCTGGAGGGGGTAGAGATCAAAGGCGGCTCCTTCCGA------------------
Homo_sapiens|79145                  TGCTCTCTGGAGGGGGTAGAGATCAAAGGCGGCTCCTTCCGA------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------NNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|14261               ------------------------------------CTTCTTCAGGAGGGGCAGACCCTT
Spermophilus_tridecemlineatus|14590 ------------------------------------CTTCTCCAAGAGGGCAAGACCGTG
Tupaia_belangeri|1383               ------------------------------------CTCCTGCAGGAGGGCCGCACCCTG
Oryctolagus_cuniculus|3232          AAGGATGTCCTGAACATCAAGGAGAAGAGGAATGACTATCTGGATGTCTCCAAGCTCACC
Ochotona_princeps|11022             ------------------------------------CTTCTGCGGGGGGGCGAGGCCCTG
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------CTTCTAAAGCAGGGCCGGGCCCTG
Mus_musculus|83643                  ------------------------------------CTTCTCCAAGGCGGTCAGGCCCTG
Homo_sapiens|72847                  ------------------------------------CTTCTCCAAGAGGGCCAGGCACTG
Pan_troglodytes|31487               ------------------------------------CTTCTCCAAGAGGGCCAGGCACTG
Homo_sapiens|81700                  ------------------------------------CTTCTCCAAGAGGGCCAGGCACTG
Homo_sapiens|80784                  ------------------------------------CTTCTCCAAGAGGGCCAGGCACTG
Homo_sapiens|82548                  ------------------------------------CTTCTCCAAGAGGGCCAGGCACTG
Homo_sapiens|72854                  ------------------------------------CTTCTCCAAGAGGGCCAGGCACTG
Homo_sapiens|78210                  ------------------------------------CTTCTCCAAGAGGGCCAGGCACTG
Homo_sapiens|79145                  ------------------------------------CTTCTCCAAGAGGGCCAGGCACTG
                                                                                                

Tarsius_syrichta|8487               NNNNNNNNNNNN------------------------------------------------
Dipodomys_ordii|14261               GAATACCTGTGC------------------------------------------------
Spermophilus_tridecemlineatus|14590 GAGTACATATGT------------------------------------------------
Tupaia_belangeri|1383               GAGTACGTGTGT------------------------------------------------
Oryctolagus_cuniculus|3232          GACACCATCTGCGGGGTGGGGAACATGTCAGCCAACGCCTCTGACCAGGAGAGGACACCC
Ochotona_princeps|11022             GAGTACATTTGT------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                GAGTACGTGTGT------------------------------------------------
Mus_musculus|83643                  GAGTACCTATGT------------------------------------------------
Homo_sapiens|72847                  GAGTACGTGTGT------------------------------------------------
Pan_troglodytes|31487               GAGTACGTGTGT------------------------------------------------
Homo_sapiens|81700                  GAGTACGTGTGT------------------------------------------------
Homo_sapiens|80784                  GAGTACGTGTGT------------------------------------------------
Homo_sapiens|82548                  GAGTACGTGTGT------------------------------------------------
Homo_sapiens|72854                  GAGTACGTGTGT------------------------------------------------
Homo_sapiens|78210                  GAGTACGTGTGT------------------------------------------------
Homo_sapiens|79145                  GAGTACGTGTGT------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          TGGCATGTCACTTTTAAGCCCAGGGCCCAGGAGACCTGCCGGGGGGCCCTCATCTCTGAC
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  ------------------------------------------------------------
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          CAGTGGGTCCTGACAGCCGCTCACTGCTTCCACCACGCCGAGGACCGCTCCCTGTGGAGG
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  ------------------------------------------------------------
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          GTCAGCGTGGGGGATCCCAACTCCCAGCATGGCAAAGAATTCCTTATTGAGAAGGTGGAG
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  ------------------------------------------------------------
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------------------
Dipodomys_ordii|14261               ---CCCTCTGGCTTCTACCCGTACCCCGTGCAGACTCGC---------------------
Spermophilus_tridecemlineatus|14590 ---CCCTCTGGCTTCTACCCATACCCTGTCAAGACACGC---------------------
Tupaia_belangeri|1383               ---CCCTCTGGCTTCTACCCGTACCCCGCTCAGACGCGC---------------------
Oryctolagus_cuniculus|3232          GTCCCCTCAGGGTTCAATGTCTATGCAAAGAAGAGCCAGGGCATCCCGGAGTTCTATGGG
Ochotona_princeps|11022             ---CCGTCCGGCTTCTACCCGTACCCAGTACAGACGCGC---------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ---CCCTCGGGGTTCTACCCTTACCCAGTGCAGACGCGG---------------------
Mus_musculus|83643                  ---CCCTCTGGCTTCTACCCATACCCCGTGCAGACTCGA---------------------
Homo_sapiens|72847                  ---CCTTCTGGCTTCTACCCGTACCCTGTGCAGACACGT---------------------
Pan_troglodytes|31487               ---CCTTCTGGCTTCTACCCGTACCCTGTGCAGACACGT---------------------
Homo_sapiens|81700                  ---CCTTCTGGCTTCTACCCGTACCCTGTGCAGACACGT---------------------
Homo_sapiens|80784                  ---CCTTCTGGCTTCTACCCGTACCCTGTGCAGACACGT---------------------
Homo_sapiens|82548                  ---CCTTCTGGCTTCTACCCGTACCCTGTGCAGACACGT---------------------
Homo_sapiens|72854                  ---CCTTCTGGCTTCTACCCGTACCCTGTGCAGACACGT---------------------
Homo_sapiens|78210                  ---CCTTCTGGCTTCTACCCGTACCCTGTGCAGACACGT---------------------
Homo_sapiens|79145                  ---CCTTCTGGCTTCTACCCGTACCCTGTGCAGACACGT---------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          GACGATATCGCCCTGCTGAAGCTGACCCAGAAAGTGAAAATATCCACCCACGCCAGGCCC
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  ------------------------------------------------------------
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ---------------------------------------------------------NNN
Dipodomys_ordii|14261               ---------------------------------------------------------ACA
Spermophilus_tridecemlineatus|14590 ---------------------------------------------------------ACC
Tupaia_belangeri|1383               ---------------------------------------------------------ACC
Oryctolagus_cuniculus|3232          ATCTGCCTTCCCTGCACAGTGGAGGCCAATCTGGCTCTGCGGAAACCCCAAGGCAGCACC
Ochotona_princeps|11022             ---------------------------------------------------------ACT
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ---------------------------------------------------------ATC
Mus_musculus|83643                  ---------------------------------------------------------ACC
Homo_sapiens|72847                  ---------------------------------------------------------ACC
Pan_troglodytes|31487               ---------------------------------------------------------ACC
Homo_sapiens|81700                  ---------------------------------------------------------ACC
Homo_sapiens|80784                  ---------------------------------------------------------ACC
Homo_sapiens|82548                  ---------------------------------------------------------ACC
Homo_sapiens|72854                  ---------------------------------------------------------ACC
Homo_sapiens|78210                  ---------------------------------------------------------ACC
Homo_sapiens|79145                  ---------------------------------------------------------ACC
                                                                                                

Tarsius_syrichta|8487               NNNNNNNNN---------------------------------------------------
Dipodomys_ordii|14261               TGCAAAGCC---------------------------------------------------
Spermophilus_tridecemlineatus|14590 TGCAGATCC---------------------------------------------------
Tupaia_belangeri|1383               TGCAGGTCC---------------------------------------------------
Oryctolagus_cuniculus|3232          TGTCGGGACCACGAGGAGGAGCTTCTGAGCCAACGGAGCATTCCTGCTCATTTTGTCGCC
Ochotona_princeps|11022             TGCAGATCC---------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                TGCAGGTCC---------------------------------------------------
Mus_musculus|83643                  TGCAGATCC---------------------------------------------------
Homo_sapiens|72847                  TGCAGATCT---------------------------------------------------
Pan_troglodytes|31487               TGCAGATCT---------------------------------------------------
Homo_sapiens|81700                  TGCAGATCT---------------------------------------------------
Homo_sapiens|80784                  TGCAGATCT---------------------------------------------------
Homo_sapiens|82548                  TGCAGATCT---------------------------------------------------
Homo_sapiens|72854                  TGCAGATCT---------------------------------------------------
Homo_sapiens|78210                  TGCAGATCT---------------------------------------------------
Homo_sapiens|79145                  TGCAGATCT---------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ------------------------------------------------------------
Dipodomys_ordii|14261               ------------------------------------------------------------
Spermophilus_tridecemlineatus|14590 ------------------------------------------------------------
Tupaia_belangeri|1383               ------------------------------------------------------------
Oryctolagus_cuniculus|3232          TTGGATGGGAACAAACTGAACGTTAAGCTCAAGACAGGCGCAGAGTGGAAAAACTGTATC
Ochotona_princeps|11022             ------------------------------------------------------------
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ------------------------------------------------------------
Mus_musculus|83643                  ------------------------------------------------------------
Homo_sapiens|72847                  ------------------------------------------------------------
Pan_troglodytes|31487               ------------------------------------------------------------
Homo_sapiens|81700                  ------------------------------------------------------------
Homo_sapiens|80784                  ------------------------------------------------------------
Homo_sapiens|82548                  ------------------------------------------------------------
Homo_sapiens|72854                  ------------------------------------------------------------
Homo_sapiens|78210                  ------------------------------------------------------------
Homo_sapiens|79145                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|8487               ---------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|14261               ---------ACAGGCTCCTGGAGTACCCTGAAGACCCGAGACCAAAAGATTGTCAAGAAG
Spermophilus_tridecemlineatus|14590 ---------ACAGGGTCCTGGAGTTCCCTAAAGACTCGAGACCAAAAGATTGTCAAGAAA
Tupaia_belangeri|1383               ---------ACGGGGTCTTGGAACACTCTGAAGACCCAAGACCAGAAGATAGTCAAGAAG
Oryctolagus_cuniculus|3232          CAGGCCGTCTCTGAGAGGTTCCCCAACCTGACAGACGTCAGCGAGGTGGTGACAGATCAG
Ochotona_princeps|11022             ---------ACGGGGTCCTGGAGCCCCCTTAGAACCCAAGACCAAAGGATGATTGCTAAG
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                ---------ACGGGGAACTGGAGCAGCCTCAAGACTCAGGACCACAAGATCGTCAAGAAG
Mus_musculus|83643                  ---------ACAGGCTCCTGGAGCGACCTGCAGACCCGAGACCAAAAGATTGTCCAGAAG
Homo_sapiens|72847                  ---------ACGGGGTCCTGGAGCACCCTGAAGACTCAAGACCAAAAGACTGTCAGGAAG
Pan_troglodytes|31487               ---------ACGGGGTCCTGGAGCACCCTGAAGACTCAAGTCCAAAAGACTGTCAGGAAG
Homo_sapiens|81700                  ---------ACGGGGTCCTGGAGCACCCTGAAGACTCAAGACCAAAAGACTGTCAGGAAG
Homo_sapiens|80784                  ---------ACGGGGTCCTGGAGCACCCTGAAGACTCAAGACCAAAAGACTGTCAGGAAG
Homo_sapiens|82548                  ---------ACGGGGTCCTGGAGCACCCTGAAGACTCAAGACCAAAAGACTGTCAGGAAG
Homo_sapiens|72854                  ---------ACGGGGTCCTGGAGCACCCTGAAGACTCAAGACCAAAAGACTGTCAGGAAG
Homo_sapiens|78210                  ---------ACGGGGTCCTGGAGCACCCTGAAGACTCAAGACCAAAAGACTGTCAGGAAG
Homo_sapiens|79145                  ---------ACGGGGTCCTGGAGCACCCTGAAGACTCAAGACCAAAAGACTGTCAGGAAG
                                                                                                

Tarsius_syrichta|8487               NNNNNNNNN---------------------------------------NNNNCAATTCAC
Dipodomys_ordii|14261               GCAGAGTGC---------------------------------------AGAGNNNNNNNN
Spermophilus_tridecemlineatus|14590 GCAGAGTGC---------------------------------------AGAGCGATTTAT
Tupaia_belangeri|1383               GCCGAGTGC---------------------------------------AGAGCCATCCGC
Oryctolagus_cuniculus|3232          TTTCTGTGCAGTGGTGCTGAGCAGGATGACAATCCCTGCAAGGGTGGGCGTGCAATTCGC
Ochotona_princeps|11022             GCCGAGTGC---------------------------------------AGAGNNNNNNNN
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                GCCGAGTGT---------------------------------------AGAGCGATCCAC
Mus_musculus|83643                  GCGGAATGC---------------------------------------AGAGCAATACGC
Homo_sapiens|72847                  GCAGAGTGC---------------------------------------AGAGCAATCCAC
Pan_troglodytes|31487               GCAGAGTGC---------------------------------------AGAGCAATCCAC
Homo_sapiens|81700                  GCAGAGTGC---------------------------------------AGAGCAATCCAC
Homo_sapiens|80784                  GCAGAGTGC---------------------------------------AGAGCAATCCAC
Homo_sapiens|82548                  GCAGAGTGC---------------------------------------AGAGCAATCCAC
Homo_sapiens|72854                  GCAGAGTGC---------------------------------------AGAGCAATCCAC
Homo_sapiens|78210                  GCAGAGTGC---------------------------------------AGAGCAATCCAC
Homo_sapiens|79145                  GCAGAGTGC---------------------------------------AGAGCAATCCAC
                                                                                                

Tarsius_syrichta|8487               TGCCCAAGACCACAGGACTTCGAGAATGGGGAATACTGGCCCCGGTCTCCCTACTACAAT
Dipodomys_ordii|14261               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|14590 TGCCCAAGACCTCAGGAATTTGAGAATGGGTACTACTGGCCCAGGTCTTCTTATTACAAN
Tupaia_belangeri|1383               TGCCCGCGGCCGCAGGACTTTGAGACGGGA---TACTGGCCCCGGGCGCCCTACTACACC
Oryctolagus_cuniculus|3232          TGCCCAAAACCTCAGGACTTTGAGAATGGGGACTACTGGCCCCGGTCTCCCTACTACAAT
Ochotona_princeps|11022             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTACAAT
Otolemur_garnettii|9950             ------------------------------------------------CCCTACTACAAT
Cavia_porcellus|6011                TGCCCGAGGCCCCAGGAGTTTGAGAATGGGGACTACTGGCCGCGGTCACTACACTACAAC
Mus_musculus|83643                  TGCCCACGACCGCAGGACTTTGAAAATGGGGAATTCTGGCCCCGGTCCCCCTTCTACAAC
Homo_sapiens|72847                  TGTCCAAGACCACACGACTTCGAGAACGGGGAATACTGGCCCCGGTCTCCCTACTACAAT
Pan_troglodytes|31487               TGTCCAAGACCACACGACTTCGAGAACGGGGAATACTGGCCCCGGTCTCCCTACTACAAT
Homo_sapiens|81700                  TGTCCAAGACCACACGACTTCGAGAACGGGGAATACTGGCCCCGGTCTCCCTACTACAAT
Homo_sapiens|80784                  TGTCCAAGACCACACGACTTCGAGAACGGGGAATACTGGCCCCGGTCTCCCTACTACAAT
Homo_sapiens|82548                  TGTCCAAGACCACACGACTTCGAGAACGGGGAATACTGGCCCCGGTCTCCCTACTACAAT
Homo_sapiens|72854                  TGTCCAAGACCACACGACTTCGAGAACGGGGAATACTGGCCCCGGTCTCCCTACTACAAT
Homo_sapiens|78210                  TGTCCAAGACCACACGACTTCGAGAACGGGGAATACTGGCCCCGGTCTCCCTACTACAAT
Homo_sapiens|79145                  TGTCCAAGACCACACGACTTCGAGAACGGGGAATACTGGCCCCGGTCTCCCTACTACAAT
                                                                                          .     

Tarsius_syrichta|8487               GTGAGTGATGAGATCTCTTTTCACTGCTATGATGGTTACACTCTTCGGGGCTCTGCCAAT
Dipodomys_ordii|14261               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|14590 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|1383               ---AGCGACGAGATCTCGTTCAGCTGTTACGACGGTTACAGC---TCCGGCTCTGCCAAC
Oryctolagus_cuniculus|3232          GTGAATGATGAGATCTCTTTCCACTGCTACCATGGTTACACTCTCCGGGGCTCTGCCAAT
Ochotona_princeps|11022             GTGAATGACGAGATCTCTTTCCATTGCTACGACGGTTACACTCTCCGTGGCTCTGCCAAT
Otolemur_garnettii|9950             GTTAGTGACGAGATCTCTTTCCACTGCTATGATGGTTACACTCTCCGGGGCTCTGCCAAT
Cavia_porcellus|6011                GTGAGTGACGAGATCTCTTTCCACTGCTACAATGGCTACACGCTCCGGGGCTCTGCCAAC
Mus_musculus|83643                  CTGAGTGACCAGATTTCTTTTCAATGCTATGATGGTTACGTTCTCCGGGGCTCTGCTAAT
Homo_sapiens|72847                  GTGAGTGATGAGATCTCTTTCCACTGCTATGACGGTTACACTCTCCGGGGCTCTGCCAAT
Pan_troglodytes|31487               GTGAGTGATGAGATCTCTTTCCACTGCTATGACGGTTACACTCTCCGGGGCTCTGCCAAT
Homo_sapiens|81700                  GTGAGTGATGAGATCTCTTTCCACTGCTATGACGGTTACACTCTCCGGGGCTCTGCCAAT
Homo_sapiens|80784                  GTGAGTGATGAGATCTCTTTCCACTGCTATGACGGTTACACTCTCCGGGGCTCTGCCAAT
Homo_sapiens|82548                  GTGAGTGATGAGATCTCTTTCCACTGCTATGACGGTTACACTCTCCGGGGCTCTGCCAAT
Homo_sapiens|72854                  GTGAGTGATGAGATCTCTTTCCACTGCTATGACGGTTACACTCTCCGGGGCTCTGCCAAT
Homo_sapiens|78210                  GTGAGTGATGAGATCTCTTTCCACTGCTATGACGGTTACACTCTCCGGGGCTCTGCCAAT
Homo_sapiens|79145                  GTGAGTGATGAGATCTCTTTCCACTGCTATGACGGTTACACTCTCCGGGGCTCTGCCAAT
                                          .    . . .  ..    .. .     .. .           .. . ..     

Tarsius_syrichta|8487               CGCACCTGCCAAGTGAATGGTCGGTGGAGTGGGCAAACAGCAATCTGTGACAATGGAGCA
Dipodomys_ordii|14261               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|14590 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCG
Tupaia_belangeri|1383               CGCACCTGCGTC------AACCGGTGG------CGGCAGACGATCTGTGATGAT---ACG
Oryctolagus_cuniculus|3232          CGCACCTGCCAGGTGAATGGCCGGTGGGATGGGCAAACCGCCATCTGCGACGATGGAGCG
Ochotona_princeps|11022             CGTACCTGCCAGTCCAATGGCCGGTGGGATGGGCAGACGGTCATCTGCGATGATGGAGCG
Otolemur_garnettii|9950             CGCACTTGCCAAGAGAATGGCCGGTGGGATGGGCAAACAACAATCTGTGACAATGGAGCT
Cavia_porcellus|6011                CGCACCTGCCAAGCCAACGGCCGGTGGGATGGACAAACAGCCATCTGTGATGACGGAGCG
Mus_musculus|83643                  CGCACCTGCCAAGAGAATGGCCGGTGGGATGGGCAAACAGCAATTTGTGATGATGGAGCT
Homo_sapiens|72847                  CGCACCTGCCAAGTGAATGGCCGATGGAGTGGGCAGACAGCGATCTGTGACAACGGAGCG
Pan_troglodytes|31487               CGCACCTGCCAAGTGAATGGCCGGTGGAGTGGGCAGACAGCGATCTGTGACAACGGAGCG
Homo_sapiens|81700                  CGCACCTGCCAAGTGAATGGCCGGTGGAGTGGGCAGACAGCGATCTGTGACAACGGAGCG
Homo_sapiens|80784                  CGCACCTGCCAAGTGAATGGCCGGTGGAGTGGGCAGACAGCGATCTGTGACAACGGAGCG
Homo_sapiens|82548                  CGCACCTGCCAAGTGAATGGCCGGTGGAGTGGGCAGACAGCGATCTGTGACAACGGAGCG
Homo_sapiens|72854                  CGCACCTGCCAAGTGAATGGCCGATGGAGTGGGCAGACAGCGATCTGTGACAACGGAGCG
Homo_sapiens|78210                  CGCACCTGCCAAGTGAATGGCCGGTGGAGTGGGCAGACAGCGATCTGTGACAACGGAGCG
Homo_sapiens|79145                  CGCACCTGCCAAGTGAATGGCCGGTGGAGTGGGCAGACAGCGATCTGTGACAACGGAGCG
                                     .    ..              . ...                . .. .           

Tarsius_syrichta|8487               GGGTACTGCTCCAACCCGGGCACCCCCATAGGCACAAGGAAAGTGGGCAGCCAGTACCGC
Dipodomys_ordii|14261               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|14590 GGGTACTGCCCAAACCCGGGCATTCCCATTGGCACGAGGAAGGTGGGAAGCCAGTACCGC
Tupaia_belangeri|1383               GGGTACTGCCCCACC---------AGCATCCCCCGCACGAAGGTGGGCAGCCAGTACCGC
Oryctolagus_cuniculus|3232          GGGTACTGCCCCAACCCAGGCATTCCGATCGGCACAAGGAAGGCGGGCAGCCGGTACCGT
Ochotona_princeps|11022             GGGTACTGTCCAAACCCAGGCATCCCAATTGGTATGAGGAAGGTGGGCAGCCAGTATCGC
Otolemur_garnettii|9950             GGGTACTGCTCCAACCCGGGCATCCCCATCGGTACAAGGAAGGTGGGCAGCCAGTACCGC
Cavia_porcellus|6011                GCCTACTGCCCCAACCCCGGCATCCCCATCGGCATGAGGAAGGTGGGCAGCCAGTACCGC
Mus_musculus|83643                  GGATACTGTCCCAATCCCGGTATTCCTATTGGGACAAGGAAGGTGGGTAGCCAATACCGC
Homo_sapiens|72847                  GGGTACTGCTCCAACCCGGGCATCCCCATTGGCACAAGGAAGGTGGGCAGCCAGTACCGC
Pan_troglodytes|31487               GGGTACTGCTCCAACCCGGGCATCCCCATTGGCACAAGGAAGGTGGGCAGCCAGTACCGC
Homo_sapiens|81700                  GGGTACTGCTCCAACCCGGGCATCCCCATTGGCACAAGGAAGGTGGGCAGCCAGTACCGC
Homo_sapiens|80784                  GGGTACTGCTCCAACCCGGGCATCCCCATTGGCACAAGGAAGGTGGGCAGCCAGTACCGC
Homo_sapiens|82548                  GGGTACTGCTCCAACCCGGGCATCCCCATTGGCACAAGGAAGGTGGGCAGCCAGTACCGC
Homo_sapiens|72854                  GGGTACTGCTCCAACCCGGGCATCCCCATTGGCACAAGGAAGGTGGGCAGCCAGTACCGC
Homo_sapiens|78210                  GGGTACTGCTCCAACCCGGGCATCCCCATTGGCACAAGGAAGGTGGGCAGCCAGTACCGC
Homo_sapiens|79145                  GGGTACTGCTCCAACCCGGGCATCCCCATTGGCACAAGGAAGGTGGGCAGCCAGTACCGC
                                    .  .  ..                    .         .   . ...  .    .   . 

Tarsius_syrichta|8487               CTTGAGGACAGCGTCACCTACTACTGCAGTCGGGGGCTTACCCTGCGTGGCTCCCAGCGG
Dipodomys_ordii|14261               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|14590 CTTGAAGACACAGTCACTTACCACTGTAGCCGGGGGCTTACCCTGCGTGGCTCCCAACAG
Tupaia_belangeri|1383               CTGGAGGACAGCGTCACTTACTACTGCAGCCGGGGGCTCACCCTGCGCGGGTCCCAGCGG
Oryctolagus_cuniculus|3232          CTTGAAGACACTGTCACCTACCACTGCAGTCAGGGGCTTACCCTGCGCGGCTCCCAGCAA
Ochotona_princeps|11022             CTAGAAGACACTGTCACCTACCACTGCAGCCAGAGCTTCACCCTGCGTGGCTCCCAACAA
Otolemur_garnettii|9950             CTTGAGGACAGTGTTACTTACTACTGCAGCCGAGGGCTTACCCTGCGTGGCTCCCAGCGG
Cavia_porcellus|6011                CTGGAAGATACGGTCACCTACCACTGCAGCAGGGGGCTCATGCTGCGCGGCTCCCAGCAG
Mus_musculus|83643                  CTTGAAGACATTGTTACTTACCACTGCAGCCGGGGACTTGTCCTGCGTGGCTCCCAGAAG
Homo_sapiens|72847                  CTTGAAGACAGCGTCACCTACCACTGCAGCCGGGGGCTTACCCTGCGTGGCTCCCAGCGG
Pan_troglodytes|31487               CTTGAAGACAGCGTCACCTACCACTGCAGCCGGGGGCTTACCCTGCGTGGCTCCCAGCGG
Homo_sapiens|81700                  CTTGAAGACAGCGTCACCTACCACTGCAGCCGGGGGCTTACCCTGCGTGGCTCCCAGCGG
Homo_sapiens|80784                  CTTGAAGACAGCGTCACCTACCACTGCAGCCGGGGGCTTACCCTGCGTGGCTCCCAGCGG
Homo_sapiens|82548                  CTTGAAGACAGCGTCACCTACCACTGCAGCCGGGGGCTTACCCTGCGTGGCTCCCAGCGG
Homo_sapiens|72854                  CTTGAAGACAGCGTCACCTACCACTGCAGCCGGGGGCTTACCCTGCGTGGCTCCCAGCGG
Homo_sapiens|78210                  CTTGAAGACAGCGTCACCTACCACTGCAGCCGGGGGCTTACCCTGCGTGGCTCCCAGCGG
Homo_sapiens|79145                  CTTGAAGACAGCGTCACCTACCACTGCAGCCGGGGGCTTACCCTGCGTGGCTCCCAGCGG
                                     . .  .     ..    .     ..  .     .  .     .. . .. .        

Tarsius_syrichta|8487               CGAACTTGTCAAGAAGGTGGCTCTTGGAGTGGGACAGAGCCTTCCTGCCAAGACTCCTTC
Dipodomys_ordii|14261               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACTCCTTC
Spermophilus_tridecemlineatus|14590 CGAAAATGCCAGGAAGGTGGATCTTGGAGTGGGACAGAGCCTTCCTGCCAAGACACCTTC
Tupaia_belangeri|1383               CGAACGTGCCAGGAAGGTGGCTCTTGGAGCGGGACGGAGCCTTCCTGCCAAGACTCCTTC
Oryctolagus_cuniculus|3232          CGAACATGCCAGGAAGGTGGCTCCTGGAGTGGGACAGAGCCTTCCTGCCAAGGCTCCTTC
Ochotona_princeps|11022             CGAACATGCCAGGAAGGAGGCTCTTGGAGTGGGACAGAGCCTTCCTGCCAAGGCTCCTTC
Otolemur_garnettii|9950             CGAACATGTCAGGAAGGTGGCTCTTGGAGTGGGACAGAGCCTTCCTGCCAAGACTCCTTC
Cavia_porcellus|6011                CGCAAGTGCCAGGAAAGTGGCTCCTGGAGTGGGACGGAACCTTCCTGCCAAGACTCCTTC
Mus_musculus|83643                  CGAAAGTGTCAAGAAGGTGGCTCATGGAGTGGGACAGAGCCTTCCTGCCAAGATTCCTTC
Homo_sapiens|72847                  CGAACGTGTCAGGAAGGTGGCTCTTGGAGCGGGACGGAGCCTTCCTGCCAAGACTCCTTC
Pan_troglodytes|31487               CGAACGTGTCAGGAAGGTGGCTCTTGGAGCGGGACGGAGCCTTCTTGCCAAGACTCCTTC
Homo_sapiens|81700                  CGAACGTGTCAGGAAGGTGGCTCTTGGAGCGGGACGGAGCCTTCCTGCCAAGACTCCTTC
Homo_sapiens|80784                  CGAACGTGTCAGGAAGGTGGCTCTTGGAGCGGGACGGAGCCTTCCTGCCAAGACTCCTTC
Homo_sapiens|82548                  CGAACGTGTCAGGAAGGTGGCTCTTGGAGCGGGACGGAGCCTTCCTGCCAAGACTCCTTC
Homo_sapiens|72854                  CGAACGTGTCAGGAAGGTGGCTCTTGGAGCGGGACGGAGCCTTCCTGCCAAGACTCCTTC
Homo_sapiens|78210                  CGAACGTGTCAGGAAGGTGGCTCTTGGAGCGGGACGGAGCCTTCCTGCCAAGACTCCTTC
Homo_sapiens|79145                  CGAACGTGTCAGGAAGGTGGCTCTTGGAGCGGGACGGAGCCTTCCTGCCAAGACTCCTTC
                                     .    ..    .   . .. .  ... . ...   .    ..  ..    .. :*****

Tarsius_syrichta|8487               ATGTATGACACCCCTCAAGAGGTGGCCGAAGCCTTCCTATCTTCCCTGACAGAGACCATA
Dipodomys_ordii|14261               ATGTATGACACCCCCGAAGAGGTAGCTGAAGCCTTCTTGTCCTCCCTGACAGAGACCATA
Spermophilus_tridecemlineatus|14590 ATGTATGACACCCCTCAAGAGGTGGCCGAAGCCTTCCTGTCTTCCCTGACAGAGACCATA
Tupaia_belangeri|1383               ATGTACGACACCCCTCAAGAGGTGGCCGAAGCCTTCCTGTCTTCCCTGACGGAGACCATA
Oryctolagus_cuniculus|3232          ATGTACGACACCCCTCAAGAGGTGGCGGAAGCCTTCCTGTCTTCCCTAACACAGACTTTA
Ochotona_princeps|11022             ATGTACGACACTCCTCAGGAGGTGGCAGAAGCCTTCCTTTCTTCCCTGACACAGACTCTG
Otolemur_garnettii|9950             ATGTATGACACCCCCCAAGAGGTGGCTGAAGCCTTCCTGTCTTCCCTGACAGAGACTATA
Cavia_porcellus|6011                ATGTATGACACTCCCCAGGAGGTGGCCGAGGCCTTCCTGTCTTCCCTGACCGAGACCATA
Mus_musculus|83643                  ATGTATGACAGCCCTCAAGAAGTGGCCGAAGCATTCCTATCCTCCCTGACAGAGACCATC
Homo_sapiens|72847                  ATGTACGACACCCCTCAAGAGGTGGCCGAAGCTTTCCTGTCTTCCCTGACAGAGACCATA
Pan_troglodytes|31487               ATGTACGACACCCCTCAAGAGGTGGCCGAAGCTTTCCTGTCTTCCCTGACAGAGACCATA
Homo_sapiens|81700                  ATGTACGACACCCCTCAAGAGGTGGCCGAAGCTTTCCTGTCTTCCCTGACAGAGACCATA
Homo_sapiens|80784                  ATGTACGACACCCCTCAAGAGGTGGCCGAAGCTTTCCTGTCTTCCCTGACAGAGACCATA
Homo_sapiens|82548                  ATGTACGACACCCCTCAAGAGGTGGCCGAAGCTTTCCTGTCTTCCCTGACAGAGACCATA
Homo_sapiens|72854                  ATGTACGACACCCCTCAAGAGGTGGCCGAAGCTTTCCTGTCTTCCCTGACAGAGACCATA
Homo_sapiens|78210                  ATGTACGACACCCCTCAAGAGGTGGCCGAAGCTTTCCTGTCTTCCCTGACAGAGACCATA
Homo_sapiens|79145                  ATGTACGACACCCCTCAAGAGGTGGCCGAAGCTTTCCTGTCTTCCCTGACAGAGACCATA
                                    ***** ****  **  *.**.**.** **.** *** * ** *****.**  ****  * 

Tarsius_syrichta|8487               GAAGTAGTTGACGCCGAGGATGGGCACAGTCCAGNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|14261               GAAGGAGTTGATGCCGAGGATGGACATAGACCAGGGGAACAACAGAAGCGGAAGATTGTC
Spermophilus_tridecemlineatus|14590 GAAGGAGTTGATGCTGAAGACGGGCACAGCCCAGGGGAACAACAGAAGCGGAAGATTGTC
Tupaia_belangeri|1383               GAAGGAGTTGATGCCGAGGACGGGCACAGCCCAGGGGAGCAGCACAAGCGGAAGATCATC
Oryctolagus_cuniculus|3232          GAAGGAGTTGATGCTGAGGACGGGCACAGCCCAGGGGAACTGCAGAAGCGCAAGATTGTC
Ochotona_princeps|11022             GAAGGAGTTGATGCTGAGGATGGGCACAGCCCAGGAGAACTGCAAAAGCGCAAGATTGTC
Otolemur_garnettii|9950             GAAGGAGTGGATGCCGAAGATGGGCACAGCCCAGGGGAACAACAGAAGCGGAAAATTGTT
Cavia_porcellus|6011                GAAGGGGTCGATGCTGAGGACGGGCACAGCCCAGGGGAGCAGCAGAAGCGCAGGATCATC
Mus_musculus|83643                  GAAGGAGCCGATGCTGAGGATGGGCACAGCCCAGGAGAACAGCAGAAGAGGAAGATTGTC
Homo_sapiens|72847                  GAAGGAGTCGATGCTGAGGATGGGCACGGCCCAGGGGAACAACAGAAGCGGAAGATCGTC
Pan_troglodytes|31487               GAAGGAGTCGATGCTGAGGATGGGCACGGCCCAGGGGAACAACAGAAGCGGAAGATCGTC
Homo_sapiens|81700                  GAAGGAGTCGATGCTGAGGATGGGCACGGCCCAGGGGAACAACAGAAGCGGAAGATCGTC
Homo_sapiens|80784                  GAAGGAGTCGATGCTGAGGATGGGCACGGCCCAGGGGAACAACAGAAGCGGAAGATCGTC
Homo_sapiens|82548                  GAAGGAGTCGATGCTGAGGATGGGCACGGCCCAGGGGAACAACAGAAGCGGAAGATCGTC
Homo_sapiens|72854                  GAAGGAGTCGATGCTGAGGATGGGCACGGCCCAGGGGAACAACAGAAGCGGAAGATCGTC
Homo_sapiens|78210                  GAAGGAGTCGATGCTGAGGATGGGCACGGCCCAGGGGAACAACAGAAGCGGAAGATCGTC
Homo_sapiens|79145                  GAAGGAGTCGATGCTGAGGATGGGCACGGCCCAGGGGAACAACAGAAGCGGAAGATCGTC
                                    **** .*  ** ** **.** **.** .* ****. .          . .     .  . 

Tarsius_syrichta|8487               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|14261               CTGGACCCCTCAGGCTCCATGAACATCTACCTGGTGCTAGATGGATCAGATAGCATTGGT
Spermophilus_tridecemlineatus|14590 CTGGATCCCTCAGGCTCCATGAACATATACCTGGTGCTGGATGGATCTGACAGCATTGGG
Tupaia_belangeri|1383               ATCGACCCCTCGGGCTCCATGAACATCTACCTGGTGTTGGACGGATCTGACAGCATCGGG
Oryctolagus_cuniculus|3232          CTGGACCCCGCCGGCTCCATGAACATCTACCTGGTGCTGGACGGCTCAGACAGCATCGGG
Ochotona_princeps|11022             CTGGACCCTGCTGGCTCCCTGAATATCTACCTGGTGCTGGACGGCTCAGAGAGCATCGGG
Otolemur_garnettii|9950             CTGGACCCCTCAGGCTCCATGAACATCTACCTGGTGCTGGATGGATCAGACAGCATTGGA
Cavia_porcellus|6011                CTGGACCCTGCGGGCTCCATGAACATCTACCTGGTGCTGGACGGCTCAGACAGCATTGGT
Mus_musculus|83643                  CTAGACCCCTCGGGCTCCATGAATATCTACCTGGTGCTAGATGGATCAGACAGCATCGGA
Homo_sapiens|72847                  CTGGACCCTTCAGGCTCCATGAACATCTACCTGGTGCTAGATGGATCAGACAGCATTGGG
Pan_troglodytes|31487               CTGGACCCTTCAGGCTCCATGAACATCTACCTGGTGCTAGATGGATCAGACAGCATTGGG
Homo_sapiens|81700                  CTGGACCCTTCAGGCTCCATGAACATCTACCTGGTGCTAGATGGATCAGACAGCATTGGG
Homo_sapiens|80784                  CTGGACCCTTCAGGCTCCATGAACATCTACCTGGTGCTAGATGGATCAGACAGCATTGGG
Homo_sapiens|82548                  CTGGACCCTTCAGGCTCCATGAACATCTACCTGGTGCTAGATGGATCAGACAGCATTGGG
Homo_sapiens|72854                  CTGGACCCTTCAGGCTCCATGAACATCTACCTGGTGCTAGATGGATCAGACAGCATTGGG
Homo_sapiens|78210                  CTGGACCCTTCAGGCTCCATGAACATCTACCTGGTGCTAGATGGATCAGACAGCATTGGG
Homo_sapiens|79145                  CTGGACCCTTCAGGCTCCATGAACATCTACCTGGTGCTAGATGGATCAGACAGCATTGGG
                                     . .        .. .   ..    . .   ..... . .  .. .  .   .  . .. 

Tarsius_syrichta|8487               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|14261               GCCAGCAACTTCACAGGGGCCAAGAAGTGTCTCACCAATTTGATAGAGAAGGTGGCAAGT
Spermophilus_tridecemlineatus|14590 ACCGGCAACTTCACAGGGGCTAAGAGGTGTCTCGCCAACTTAATTGAGAAGATAGCAAGT
Tupaia_belangeri|1383               GCCAGGAACTTCACGGGGGCCAAGAGGTGTCTCACCAATCTGATCGAGAAGGTGGCCAGT
Oryctolagus_cuniculus|3232          GCCAGCAACTTCACAGGGGCCAAGAGGTGTCTCGTCAACTTGATTGAGAAGGTGGCGAGT
Ochotona_princeps|11022             AAGAGCAACTTCACGGGGGCCAAGAGATGTCTCGCCAACTTGATTGAGAAGGTGGCAAGT
Otolemur_garnettii|9950             GCCAGCAACTTCACAGGGGCCAAGAGGTGTCTAGCCAACTTAATTGAGAAG---------
Cavia_porcellus|6011                GCCAGCAACTTCACGGGGGCCAAGAGGTGCTTGGCCAGCTTGATCGAGAAGGTGGCGAGT
Mus_musculus|83643                  AGCAGCAACTTCACAGGGGCTAAGCGGTGCCTCACCAACTTGATTGAGAAGGTGGCGAGT
Homo_sapiens|72847                  GCCAGCAACTTCACAGGAGCCAAAAAGTGTCTAGTCAACTTAATTGAGAAGGTGGCAAGT
Pan_troglodytes|31487               GCCAGCAACTTCACAGGAGCCAAAAAGTGTCTAGTCAACTTAATTGAGAAGGTGGCAAGT
Homo_sapiens|81700                  GCCAGCAACTTCACAGGAGCCAAAAAGTGTCTAGTCAACTTAATTGAGAAGGTGGCAAGT
Homo_sapiens|80784                  GCCAGCAACTTCACAGGAGCCAAAAAGTGTCTAGTCAACTTAATTGAGAAGGTGGCAAGT
Homo_sapiens|82548                  GCCAGCAACTTCACAGGAGCCAAAAAGTGTCTAGTCAACTTAATTGAGAAGGTGGCAAGT
Homo_sapiens|72854                  GCCAGCAACTTCACAGGAGCCAAAAAGTGTCTAGTCAACTTAATTGAGAAGGTGGCAAGT
Homo_sapiens|78210                  GCCAGCAACTTCACAGGAGCCAAAAAGTGTCTAGTCAACTTAATTGAGAAGGTGGCAAGT
Homo_sapiens|79145                  GCCAGCAACTTCACAGGAGCCAAAAAGTGTCTAGTCAACTTAATTGAGAAGGTGGCAAGT
                                        .    ..    .. .        ..  .        .  . . .  .         

Tarsius_syrichta|8487               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|14261               TATGGAGTGAGGCCAAGATATGCTCTAGTGACATATGCCACAGCTCCTAAAATCGTGGTC
Spermophilus_tridecemlineatus|14590 TATGGGGTGAGGCCAAGATATGCTCTAGTGACATATGCCACAGAACCCAAAGTTGTGATC
Tupaia_belangeri|1383               TACGGGGTGAAACCAAAATACGGTCTCGTGACATATGCCACAGTCCCCAAAGTTTTGGTC
Oryctolagus_cuniculus|3232          TATGGGGTGAGGCCAAGATATGGCCTAGTGACATATGCCACATACCCCAATGTTCTGGTT
Ochotona_princeps|11022             TATGGGGTGAAGCCAAGATACGGCTTAGTGACATATGCTACAAATGCCAATGTTTTGGTT
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                TACGGGGTGAAACCGCGGTATGCACTTGTGACTTACGCCACAGAACCCAAAGTCCTGGTC
Mus_musculus|83643                  TACGGGGTGAGGCCACGATATGGTCTCCTGACATATGCTACAGTCCCCAAAGTGTTGGTC
Homo_sapiens|72847                  TATGGTGTGAAGCCAAGATATGGTCTAGTGACATATGCCACATACCCCAAAATTTGGGTC
Pan_troglodytes|31487               TATGGTGTGAAGCCAAGATATGGTCTAGTGACATATGCCACACACCCCAAAATTTGGGTC
Homo_sapiens|81700                  TATGGTGTGAAGCCAAGATATGGTCTAGTGACATATGCCACATACCCCAAAATTTGGGTC
Homo_sapiens|80784                  TATGGTGTGAAGCCAAGATATGGTCTAGTGACATATGCCACATACCCCAAAATTTGGGTC
Homo_sapiens|82548                  TATGGTGTGAAGCCAAGATATGGTCTAGTGACATATGCCACATACCCCAAAATTTGGGTC
Homo_sapiens|72854                  TATGGTGTGAAGCCAAGATATGGTCTAGTGACATATGCCACATACCCCAAAATTTGGGTC
Homo_sapiens|78210                  TATGGTGTGAAGCCAAGATATGGTCTAGTGACATATGCCACATACCCCAAAATTTGGGTC
Homo_sapiens|79145                  TATGGTGTGAAGCCAAGATATGGTCTAGTGACATATGCCACATACCCCAAAATTTGGGTC
                                                                                                

Tarsius_syrichta|8487               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|14261               AAAGTGTCTGATGAAAAGAGCAGTGATGCCGATTGGGTAACAGAACAGCTC---AAAATC
Spermophilus_tridecemlineatus|14590 AGAGTGTCTGATCAAAAGAGCAGCGATGCAGACTGGGTCACAGAGAAACTCAACCAAATC
Tupaia_belangeri|1383               AGAGTGTCTGACCCAAGGAGCAGCGATGCAGACTGGGTCACGCAGAAGCTTAACGAGATC
Oryctolagus_cuniculus|3232          AGAGTGTCGGATCCAAAGAGCAGTGATGCAAACTGGGTCACAGAGAAGCTCAATCAAATC
Ochotona_princeps|11022             AGAGTGTCAAACGCAAAGAGTAGCGATGCGGACTGGGTCATACAGCAGCTTGATAAAATC
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                AGTGTGGTGCAGGACAAGAGCAGCGATGCAGACTGGGTTACTGAGAAGCTCAACAAGATC
Mus_musculus|83643                  AGAGTGTCTGATGAGAGGAGTAGCGATGCCGACTGGGTCACAGAGAAGCTCAACCAAATC
Homo_sapiens|72847                  AAAGTGTCTGAAGCAGACAGCAGTAATGCAGACTGGGTCACGAAGCAGCTCAATGAAATC
Pan_troglodytes|31487               AAAGTGTCTGATCCAGACAGCAGTAATGCAGACTGGGTCACGAAGCAGCTCAATGAAATC
Homo_sapiens|81700                  AAAGTGTCTGAAGCAGACAGCAGTAATGCAGACTGGGTCACGAAGCAGCTCAATGAAATC
Homo_sapiens|80784                  AAAGTGTCTGAAGCAGACAGCAGTAATGCAGACTGGGTCACGAAGCAGCTCAATGAAATC
Homo_sapiens|82548                  AAAGTGTCTGAAGCAGACAGCAGTAATGCAGACTGGGTCACGAAGCAGCTCAATGAAATC
Homo_sapiens|72854                  AAAGTGTCTGAAGCAGACAGCAGTAATGCAGACTGGGTCACGAAGCAGCTCAATGAAATC
Homo_sapiens|78210                  AAAGTGTCTGAAGCAGACAGCAGTAATGCAGACTGGGTCACGAAGCAGCTCAATGAAATC
Homo_sapiens|79145                  AAAGTGTCTGAAGCAGACAGCAGTAATGCAGACTGGGTCACGAAGCAGCTCAATGAAATC
                                                                                                

Tarsius_syrichta|8487               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|14261               AGTTAT---GACCACAAGTTGAAGTCAGGAACTAACACCAAGAGGGCTCTTCAGACAGTA
Spermophilus_tridecemlineatus|14590 AGTTACGAAGACCACAAATTGAAGACAGGGACTAATACCAAGAGGGCCCTCCAGGCAGTG
Tupaia_belangeri|1383               AGTTATGAAGACCACAAGCTGAAGTCAGGGACCAACACCAAGAGGGCCCTCCAGGCAGTC
Oryctolagus_cuniculus|3232          AGTTATGAAGACCACAAGCTGAAGACAGGGACTAACACCAAGAGGGCCCTCGTGGAAGTG
Ochotona_princeps|11022             AGCTATGATGACCACAAGCTGAAGGCAGGAACTAACACCAAGAGGGCCCTCATGGAGGTG
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                AGCTACGAAGACCACAAGCTCAAGAGCGGCACGAACACCAAGAGGGCACTCCAGGAGGTG
Mus_musculus|83643                  AGTTATGAAGACCACAAGCTGAAGTCAGGGACCAACACCAAGAGGGCTCTCCAGGCTGTG
Homo_sapiens|72847                  AATTATGAAGACCACAAGTTGAAGTCAGGGACTAACACCAAGAAGGCCCTCCAGGCAGTG
Pan_troglodytes|31487               AATTATGAAGACCACAAGTTGAAGTCAGGGACTAACACCAAGAAGGCCCTCCAGGCAGTG
Homo_sapiens|81700                  AATTATGAAGACCACAAGTTGAAGTCAGGGACTAACACCAAGAAGGCCCTCCAGGCAGTG
Homo_sapiens|80784                  AATTATGAAGACCACAAGTTGAAGTCAGGGACTAACACCAAGAAGGCCCTCCAGGCAGTG
Homo_sapiens|82548                  AATTATGAAGACCACAAGTTGAAGTCAGGGACTAACACCAAGAAGGCCCTCCAGGCAGTG
Homo_sapiens|72854                  AATTATGAAGACCACAAGTTGAAGTCAGGGACTAACACCAAGAAGGCCCTCCAGGCAGTG
Homo_sapiens|78210                  AATTATGAAGACCACAAGTTGAAGTCAGGGACTAACACCAAGAAGGCCCTCCAGGCAGTG
Homo_sapiens|79145                  AATTATGAAGACCACAAGTTGAAGTCAGGGACTAACACCAAGAAGGCCCTCCAGGCAGTG
                                                                                                

Tarsius_syrichta|8487               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|14261               TACAGCATGATGAGCTGGGCAGGGGACGTCCCCCCGGAAGGCTGGAATCGCACCCGCCAT
Spermophilus_tridecemlineatus|14590 TACAACATGATGAACTGGGCAGGAGATGTCCCCCCTGAAGGCTGGAACCGTACCCGCCAC
Tupaia_belangeri|1383               TACAGCATGATGAGCTGGGCAGGGGACCACCCCCCGGAGGGCTGGAACCGCACCCGCCAC
Oryctolagus_cuniculus|3232          TACAACATGATGAGCTGGCCAGGGGACGTGCCCCCTGAAGGCTGGAACCGCACTCGCCAC
Ochotona_princeps|11022             TACAACATGATGAGCTGGCCAGGAGAAACACCCCCTGAAGGCTGGAACCGCACTCGCCAC
Otolemur_garnettii|9950             ------------------------------------------------------------
Cavia_porcellus|6011                TACAACATGATGAACCTGGCGGTGGACAGCCAGCCTGGCAGCTGGAACCGCACCCGCCAC
Mus_musculus|83643                  TATAGCATGATGAGCTGGGCAGGGGATGCCCCGCCTGAAGGCTGGAATAGAACCCGCCAT
Homo_sapiens|72847                  TACAGCATGATGAGCTGGCCAGATGACGTCCCTCCTGAAGGCTGGAACCGCACCCGCCAT
Pan_troglodytes|31487               TACAGCATGATGAGCTGGCCAGATGACATCCCTCCTGAAGGCTGGAACCGCACCCGCCAT
Homo_sapiens|81700                  TACAGCATGATGAGCTGGCCAGATGACGTCCCTCCTGAAGGCTGGAACCGCACCCGCCAT
Homo_sapiens|80784                  TACAGCATGATGAGCTGGCCAGATGACGTCCCTCCTGAAGGCTGGAACCGCACCCGCCAT
Homo_sapiens|82548                  TACAGCATGATGAGCTGGCCAGATGACGTCCCTCCTGAAGGCTGGAACCGCACCCGCCAT
Homo_sapiens|72854                  TACAGCATGATGAGCTGGCCAGATGACGTCCCTCCTGAAGGCTGGAACCGCACCCGCCAT
Homo_sapiens|78210                  TACAGCATGATGAGCTGGCCAGATGACGTCCCTCCTGAAGGCTGGAACCGCACCCGCCAT
Homo_sapiens|79145                  TACAGCATGATGAGCTGGCCAGATGACGTCCCTCCTGAAGGCTGGAACCGCACCCGCCAT
                                                                                                

Tarsius_syrichta|8487               NNNNNNNNNNNNNNNNNNNNNNGCTTGCACAACATGGGTGGAGACCCAGTCCCTGTCATT
Dipodomys_ordii|14261               GTCATCATCCTCATGACTGATGGCTTGCATAACATGGGTGGGGACCCAGTCACTGTCATT
Spermophilus_tridecemlineatus|14590 GTCATCATCCTGATGACTGATGGCTTGTACAACATGGGTGGGGATCCAGTAACTATTATT
Tupaia_belangeri|1383               GTCATCATCCTCATGACCGACGGCTTGCACAACATGGGCGGGGACCCAGTCACTGTCATC
Oryctolagus_cuniculus|3232          GTCATCATCCTCATGACTGACGGCTTGCACAACATGGGGGGCGACCCAGTCACTGTCATT
Ochotona_princeps|11022             GTCATCATTCTCATGACTGACGGCTTGCACAACATGGGTGGGGACCCAGTCCCCGTCATC
Otolemur_garnettii|9950             ------------------------TTGCACAACATGGGTGGGGACCCAGTCACTGTCATT
Cavia_porcellus|6011                GTCATCATCCTCATGACCGACGGCTTGTACAATATGGGCGGCGACCCGGTCACCATCATC
Mus_musculus|83643                  GTCATCATCATTATGACTGATGGCTTGCACAACATGGGTGGAAACCCTGTCACTGTCATT
Homo_sapiens|72847                  GTCATCATCCTCATGACTGATGGATTGCACAACATGGGCGGGGACCCAATTACTGTCATT
Pan_troglodytes|31487               GTCATCATCCTCATGACTGATGGATTGCACAACATGGGCGGGGACCCAATTACTGTCATT
Homo_sapiens|81700                  GTCATCATCCTCATGACTGATGGATTGCACAACATGGGCGGGGACCCAATTACTGTCATT
Homo_sapiens|80784                  GTCATCATCCTCATGACTGATGGATTGCACAACATGGGCGGGGACCCAATTACTGTCATT
Homo_sapiens|82548                  GTCATCATCCTCATGACTGATGGATTGCACAACATGGGCGGGGACCCAATTACTGTCATT
Homo_sapiens|72854                  GTCATCATCCTCATGACTGATGGATTGCACAACATGGGCGGGGACCCAATTACTGTCATT
Homo_sapiens|78210                  GTCATCATCCTCATGACTGATGGATTGCACAACATGGGCGGGGACCCAATTACTGTCATT
Homo_sapiens|79145                  GTCATCATCCTCATGACTGATGGATTGCACAACATGGGCGGGGACCCAATTACTGTCATT
                                                            *** * ** ***** ** .* ** .* .* .* ** 

Tarsius_syrichta|8487               GATGAAATCCGTGACTTGCTGTATATTGGCAAGGATCGCAAAAATCCAAGGGAAGATTAT
Dipodomys_ordii|14261               GATGAGATCCGGAGTTGGTTGGACATTGGCAGGGATCGCAAAAATCCCAGGGAGGATTAT
Spermophilus_tridecemlineatus|14590 GGTGAGATCCGGGACTTGCTGGACATTGGCAGGGATCGCAAAAACCCAAGGGAGGATTAT
Tupaia_belangeri|1383               GATGAGATTCGGAACTTGCTGGACATCGGCAGGGATCGTAAAAACCCGAGGGAGGATTAT
Oryctolagus_cuniculus|3232          AATGAGATTCGGGATTTGCTAAACATTGGCAAGGATCGCAAAAACCCGAGAGAGGATTAC
Ochotona_princeps|11022             GACCAGATCCGTGATTTGCTGAACATTGGCAGGAACCGCAAAAACCCAAGAGAGGACTAC
Otolemur_garnettii|9950             GATGAGATCCGGGACTTGTTGAACATTGGCAGGGATCGCAAAAACCCAAGGGAGGATTAT
Cavia_porcellus|6011                CATGACATCCGGTACTTGCTGGACATTGGCAGGGACCGCAAGAACCCACGGGAGGATTAT
Mus_musculus|83643                  CAGGACATCCGAGCCTTGCTGGACATCGGCAGGGATCCCAAAAATCCCAGGGAGGATTAC
Homo_sapiens|72847                  GATGAGATCCGGGACTTGCTATACATTGGCAAGGATCGCAAAAACCCAAGGGAGGATTAT
Pan_troglodytes|31487               GATGAGATCCGGGACTTGCTATACATTGGCAAGGATCGCAAAAACCCAAGGGAGGATTAT
Homo_sapiens|81700                  GATGAGATCCGGGACTTGCTATACATTGGCAAGGATCGCAAAAACCCAAGGGAGGATTAT
Homo_sapiens|80784                  GATGAGATCCGGGACTTGCTATACATTGGCAAGGATCGCAAAAACCCAAGGGAGGATTAT
Homo_sapiens|82548                  GATGAGATCCGGGACTTGCTATACATTGGCAAGGATCGCAAAAACCCAAGGGAGGATTAT
Homo_sapiens|72854                  GATGAGATCCGGGACTTGCTATACATTGGCAAGGATCGCAAAAACCCAAGGGAGGATTAT
Homo_sapiens|78210                  GATGAGATCCGGGACTTGCTATACATTGGCAAGGATCGCAAAAACCCAAGGGAGGATTAT
Homo_sapiens|79145                  GATGAGATCCGGGACTTGCTATACATTGGCAAGGATCGCAAAAACCCAAGGGAGGATTAT
                                     .  * ** **    * * *. * ** ****.*.* *  **.** ** .*.**.** ** 

Tarsius_syrichta|8487               CTGGATGTTTATGTGTTTGGAGTTGGGCCTCTGGTAGACCAAGAAAACATCAATGCTTTG
Dipodomys_ordii|14261               TTGGATGTATATGTGTTTGGAGTCGGGCCTCTGGTGGACCAAGACAACATCAATGCTTTG
Spermophilus_tridecemlineatus|14590 TTGGATGTATATGTGTTTGGGGTCGGGCCTCTGGTGGACGAAGTGAACATCAATGCTTTG
Tupaia_belangeri|1383               CTGGACGTCTACGTGTTTGGGGTCGGGCCTCTGGTGGATCAAGTGAATATCAACGCTTTG
Oryctolagus_cuniculus|3232          CTGGACGTCTATGTGTTTGGGGTTGGGCCTCTGGTGGAGCCAGCGAACATCAATGCCCTG
Ochotona_princeps|11022             TTGGATGTCTACGTGTTCGGGGTGGGGCCTCTGGTGGAAGCAGCGAACATCAATGCTTTG
Otolemur_garnettii|9950             CTGGATATCTATGTATTTGGGGTCGGCCCTCTGGTGGACCAAGTGAACATCAATGCTTTG
Cavia_porcellus|6011                CTGGATGTGTACGTGTTTGGCGTGGGGCCCCTGGTGGACCAGGTGAACATCAATGCCCTG
Mus_musculus|83643                  CTGGATGTGTATGTGTTTGGGGTCGGGCCTCTGGTGGACTCCGTGAACATCAATGCCTTA
Homo_sapiens|72847                  CTGGATGTCTATGTGTTTGGGGTCGGGCCTTTGGTGAACCAAGTGAACATCAATGCTTTG
Pan_troglodytes|31487               CTGGATGTCTATGTGTTTGGGGTCGGGCCTTTGGTGAACCAAGTGAACATCAATGCTTTG
Homo_sapiens|81700                  CTGGATGTCTATGTGTTTGGGGTCGGGCCTTTGGTGAACCAAGTGAACATCAATGCTTTG
Homo_sapiens|80784                  CTGGATGTCTATGTGTTTGGGGTCGGGCCTTTGGTGAACCAAGTGAACATCAATGCTTTG
Homo_sapiens|82548                  CTGGATGTCTATGTGTTTGGGGTCGGGCCTTTGGTGAACCAAGTGAACATCAATGCTTTG
Homo_sapiens|72854                  CTGGATGTCTATGTGTTTGGGGTCGGGCCTTTGGTGAACCAAGTGAACATCAATGCTTTG
Homo_sapiens|78210                  CTGGATGTCTATGTGTTTGGGGTCGGGCCTTTGGTGAACCAAGTGAACATCAATGCTTTG
Homo_sapiens|79145                  CTGGATGTCTATGTGTTTGGGGTCGGGCCTTTGGTGAACCAAGTGAACATCAATGCTTTG
                                     **** .* ** **.** ** ** ** **  ****..*  . *  ** ***** **  *.

Tarsius_syrichta|8487               GCTTCCAAGAAAAACAACGAGCAACATGTGTTCAAAGTAAAGGATATGGAAAACCTGGAA
Dipodomys_ordii|14261               GCTTCCAAGAAAGAGAATGAACAACATGTGTTCAGAGTCAAGGATATGGAAAACCTGGAA
Spermophilus_tridecemlineatus|14590 GCTTCCAAGAAGGACAATGAGCGGCATGTGTTCAAAGTCAAGGACATGGAAAATCTGGAG
Tupaia_belangeri|1383               GCTTCCAAGAAGGAGAAAGAGCAGCACGTGTTCAAAGTCAGGGACATGAAC------GAG
Oryctolagus_cuniculus|3232          GCTTCCAAGAAGGAGAACGAGCAACATGTGTTCAGAGTCAAGGACATGGAGCACTTGGAG
Ochotona_princeps|11022             GCTTCCAAGAAGGACAATGAGCAACACGTGTTCAGAGTAAAGGACATGGAAAACTTGGAG
Otolemur_garnettii|9950             GCTTCCAAGAAAGACAACGAGCAACATGTGTTCAAAGTCAAGGATATGGAAAACTTGGAA
Cavia_porcellus|6011                GCTTCCAAGAAGGATGGTGAGCAGCACGTGTTCAAAGTCAGGGACATGGAGCACCTGGAG
Mus_musculus|83643                  GCTTCCAAAAAGGACAATGAGCATCATGTGTTTAAAGTCAAGGATATGGAAGACCTGGAG
Homo_sapiens|72847                  GCTTCCAAGAAAGACAATGAGCAACATGTGTTCAAAGTCAAGGATATGGAAAACCTGGAA
Pan_troglodytes|31487               GCTTCCAAGAAAGACAATGAGCAACATGTGTTCAAAGTCAAGGATATGGAAAACCTGGAA
Homo_sapiens|81700                  GCTTCCAAGAAAGACAATGAGCAACATGTGTTCAAAGTCAAGGATATGGAAAACCTGGAA
Homo_sapiens|80784                  GCTTCCAAGAAAGACAATGAGCAACATGTGTTCAAAGTCAAGGATATGGAAAACCTGGAA
Homo_sapiens|82548                  GCTTCCAAGAAAGACAATGAGCAACATGTGTTCAAAGTCAAGGATATGGAAAACCTGGAA
Homo_sapiens|72854                  GCTTCCAAGAAAGACAATGAGCAACATGTGTTCAAAGTCAAGGATATGGAAAACCTGGAA
Homo_sapiens|78210                  GCTTCCAAGAAAGACAATGAGCAACATGTGTTCAAAGTCAAGGATATGGAAAACCTGGAA
Homo_sapiens|79145                  GCTTCCAAGAAAGACAATGAGCAACATGTGTTCAAAGTCAAGGATATGGAAAACCTGGAA
                                    ********.**..* .. **.*. ** ***** *.***.*.*** ***.*       **.

Tarsius_syrichta|8487               GACATTTTCTTCCAAATGATTGATGAAACCAAGACTCTGAGTCTCTGTGGCATGGTTTGG
Dipodomys_ordii|14261               GATGTTTTCTACCAAATGATTGATGAAACCAAGTCACTGGGTCTCTGTGGCATGGTTTGG
Spermophilus_tridecemlineatus|14590 GATGTTTTCTACCAAATGATTGATGAAACCCAGACTCTGGGGCTCTGCGGCATGGTTTGG
Tupaia_belangeri|1383               GACGTTTTCTACCAAATGATCGATGAAACCAAGTCTCTGGGTCTCTGCGGCATGGTCTGG
Oryctolagus_cuniculus|3232          GACGTTTTCTTCCAGATGATTGATGAAAGCCAGTCCCTGGGGCTCTGTGGCATGGTGTGG
Ochotona_princeps|11022             GATGTTTTCTATCAAATGATTGATGAAACCAAGTCCCTGGGGCTCTGTGGCATGGTCTGG
Otolemur_garnettii|9950             GATGTTTTCTTCCAAATGATTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|6011                GATGTCTTCTTCCAGATGATCGATGAGAGCCAGGCTCTGGGGCTCTGCGGCATGGTGTGG
Mus_musculus|83643                  AATGTTTTCTACCAAATGATTGATGAAACCAAATCTCTGAGTCTCTGTGGCATGGTGTGG
Homo_sapiens|72847                  GATGTTTTCTACCAAATGATCGATGAAAGCCAGTCTCTGAGTCTCTGTGGCATGGTTTGG
Pan_troglodytes|31487               GATGTTTTCTACCAAATGATTGATGAAAGCCAGTCTCTGAGTCTCTGTGGCATGGTTTGG
Homo_sapiens|81700                  GATGTTTTCTACCAAATGATCGATGAAAGCCAGTCTCTGAGTCTCTGTGGCATGGTTTGG
Homo_sapiens|80784                  GATGTTTTCTACCAAATGATCGATGAAAGCCAGTCTCTGAGTCTCTGTGGCATGGTTTGG
Homo_sapiens|82548                  GATGTTTTCTACCAAATGATCGATGAAAGCCAGTCTCTGAGTCTCTGTGGCATGGTTTGG
Homo_sapiens|72854                  GATGTTTTCTACCAAATGATCGATGAAAGCCAGTCTCTGAGTCTCTGTGGCATGGTTTGG
Homo_sapiens|78210                  GATGTTTTCTACCAAATGATCGATGAAAGCCAGTCTCTGAGTCTCTGTGGCATGGTTTGG
Homo_sapiens|79145                  GATGTTTTCTACCAAATGATCGATGAAAGCCAGTCTCTGAGTCTCTGTGGCATGGTTTGG
                                    .* .* ****: **.***** * ..            .. .  . .. ..  .... ...

Tarsius_syrichta|8487               GAACACAGGGAAGGTACTGATTACCACAAGCAACCATGGCAGGCCAAGATCTCAGTCACT
Dipodomys_ordii|14261               GAGCATAGGAAGGGTACCGATTACCACAAACAGCCATGGCAGGCCAAGATCTCAGTCACC
Spermophilus_tridecemlineatus|14590 GAACACAGGAAAGGTACTGATTACCACAAGCAACCATGGCATGCCAAGATCTCAGTCACT
Tupaia_belangeri|1383               GAGCACAAGCAAGGCACCGACTACCACAAGCAGCCGTGGCAGGCCAAGATCTCCGTCACC
Oryctolagus_cuniculus|3232          GAGCACAGGGAAGGCACCGACTACCACAAGCAACCATGGCATGCCAAGATCTCAGTCACT
Ochotona_princeps|11022             GAGCACAGGGAGGGCACTGACTACCACAAGCAGCCTTGGCATGCCAAGATCTCCATCACT
Otolemur_garnettii|9950             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|6011                GAGCACAGGAAGGGCACGGACTACCACAAGCACCCGTGGCAGGCCAAGATCTCGGTCACT
Mus_musculus|83643                  GAGCATAAAAAAGGCAACGATTATCATAAGCAACCATGGCAAGCCAAGATCTCAGTCACT
Homo_sapiens|72847                  GAACACAGGAAGGGTACCGATTACCACAAGCAACCATGGCAGGCCAAGATCTCAGTCATT
Pan_troglodytes|31487               GAACACAGGAAGGGTACCGATTACCACAAGCAACCATGGCAAGCCAAGATCTCAGTCATT
Homo_sapiens|81700                  GAACACAGGAAGGGTACCGATTACCACAAGCAACCATGGCAGGCCAAGATCTCAGTCATT
Homo_sapiens|80784                  GAACACAGGAAGGGTACCGATTACCACAAGCAACCATGGCAGGCCAAGATCTCAGTCATT
Homo_sapiens|82548                  GAACACAGGAAGGGTACCGATTACCACAAGCAACCATGGCAGGCCAAGATCTCAGTCATT
Homo_sapiens|72854                  GAACACAGGAAGGGTACCGATTACCACAAGCAACCATGGCAGGCCAAGATCTCAGTCATT
Homo_sapiens|78210                  GAACACAGGAAGGGTACCGATTACCACAAGCAACCATGGCAGGCCAAGATCTCAGTCATT
Homo_sapiens|79145                  GAACACAGGAAGGGTACCGATTACCACAAGCAACCATGGCAGGCCAAGATCTCAGTCATT
                                    .           ..    .  .              ...   .    . . .   .    

Tarsius_syrichta|8487               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|14261               CGTCCTCTCAAGGGACATGAAAACTGTATGGGGGCTGTGGTGTCTGAGTACTTTGTGTTG
Spermophilus_tridecemlineatus|14590 CGCCCTTTGAAGGGACATGAGAACTGTATGGGGGCTGTGGTGTCTGAGTACTTTGTGCTG
Tupaia_belangeri|1383               CGCCCTCTGAAGGGACACGAGAACTGCATGGGGGCCGTGGTGTCCGAGTACTTTGTGCTG
Oryctolagus_cuniculus|3232          CGCCCTCAGAAGGGACATGAGAACTGCATGGGGGCTGTGGTGTCTGAGTACTTCGTGCTA
Ochotona_princeps|11022             CGCCCTCAGAAGGGACATGAGACCTGCATGGGGGCTGTGGTATCAGAGTACTTTGTGCTG
Otolemur_garnettii|9950             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|6011                CGGCCACAGAAGGGCCACGAGAACTGCATGGGGGCCGTGGTGTCCGAGTACTTTGTGCTG
Mus_musculus|83643                  CGCCCTCTGAAAGGACATGAGACCTGTATGGGGGCCGTGGTGTCTGAGTACTTCGTGCTG
Homo_sapiens|72847                  CGCCCTTCAAAGGGACACGAGAGCTGTATGGGGGCTGTGGTGTCTGAGTACTTTGTGCTG
Pan_troglodytes|31487               CGCCCTTCAAAGGGACACGAGAGCTGTATGGGGGCTGTGGTGTCTGAGTACTTTGTGCTG
Homo_sapiens|81700                  CGCCCTTCAAAGGGACACGAGAGCTGTATGGGGGCTGTGGTGTCTGAGTACTTTGTGCTG
Homo_sapiens|80784                  CGCCCTTCAAAGGGACACGAGAGCTGTATGGGGGCTGTGGTGTCTGAGTACTTTGTGCTG
Homo_sapiens|82548                  CGCCCTTCAAAGGGACACGAGAGCTGTATGGGGGCTGTGGTGTCTGAGTACTTTGTGCTG
Homo_sapiens|72854                  CGCCCTTCAAAGGGACACGAGAGCTGTATGGGGGCTGTGGTGTCTGAGTACTTTGTGCTG
Homo_sapiens|78210                  CGCCCTTCAAAGGGACACGAGAGCTGTATGGGGGCTGTGGTGTCTGAGTACTTTGTGCTG
Homo_sapiens|79145                  CGCCCTTCAAAGGGACACGAGAGCTGTATGGGGGCTGTGGTGTCTGAGTACTTTGTGCTG
                                     .          ..    .     ..  ......  ..... .  . ..  .. ... . 

Tarsius_syrichta|8487               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|14261               ACTGCAGCACACTGTTTCACCGTGGATGATGAGAAACATTCAATCAAGGTCAGCGTAGGA
Spermophilus_tridecemlineatus|14590 ACAGCGGCACACTGTTTCACTGTGGATGACCAAAAACACTCAATCAAGGTCAGCGTGGNN
Tupaia_belangeri|1383               ACAGCGGCCCACTGCTTCACTGTGGAAGACCAGAAACACTCCATCAAGGTCAGCGTGGGA
Oryctolagus_cuniculus|3232          ACAGCAGCACACTGTTTCACAGTGGACGACCAGAAGCACTCAATCAAAGTCAGCGTGGGA
Ochotona_princeps|11022             ACGGCTGCACACTGTTTCACGGTGGACGACCAGGCACATTCTATCAAAATCAGTATTGGA
Otolemur_garnettii|9950             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGA
Cavia_porcellus|6011                ACGGCGGCCCACTGCTTCACTGTGGAGGACCAGAAGCACTCCATCAAGGTCAACGTGGGA
Mus_musculus|83643                  ACAGCAGCGCACTGCTTCATGGTGGATGATCAGAAACATTCCATCAAGGTCAGCGTGGGG
Homo_sapiens|72847                  ACAGCAGCACATTGTTTCACTGTGGATGACAAGGAACACTCAATCAAGGTCAGCGTAGGA
Pan_troglodytes|31487               ACAGCAGCACATTGTTTCACTGTGGATGACAAGGAACACTCGATCAAGGTCAGCGTAGGA
Homo_sapiens|81700                  ACAGCAGCACATTGTTTCACTGTGGATGACAAGGAACACTCAATCAAGGTCAGCGTAGGA
Homo_sapiens|80784                  ACAGCAGCACATTGTTTCACTGTGGATGACAAGGAACACTCAATCAAGGTCAGCGTAGGA
Homo_sapiens|82548                  ACAGCAGCACATTGTTTCACTGTGGATGACAAGGAACACTCAATCAAGGTCAGCGTAGGA
Homo_sapiens|72854                  ACAGCAGCACATTGTTTCACTGTGGATGACAAGGAACACTCAATCAAGGTCAGCGTAGGA
Homo_sapiens|78210                  ACAGCAGCACATTGTTTCACTGTGGATGACAAGGAACACTCAATCAAGGTCAGCGTAGGA
Homo_sapiens|79145                  ACAGCAGCACATTGTTTCACTGTGGATGACAAGGAACACTCAATCAAGGTCAGCGTAGGA
                                       .  .     .. ..    ....  .           .   .     .     . .. 

Tarsius_syrichta|8487               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|14261               GGAAGGAAGCGAGATCTAGAGGTAGAAGAAGTCCTATTTCATCCCAACTACAACATCAAT
Spermophilus_tridecemlineatus|14590 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|1383               GGGAAGAGGAAGGACCTGGAGGTAGAAGAAGTCCTATTCCACCCTAACTACAACATCAAC
Oryctolagus_cuniculus|3232          GGGAAGAGGCGGGACCTGGAGGTAGAAGAAGTTCTATTTCACGCCAACTACAACATCAAT
Ochotona_princeps|11022             GGGAAGAGGCGGGACCTGGAGGTAGAAGAAGTTCTAGTTCACCCCAAGTACAACATCAAT
Otolemur_garnettii|9950             GGGCAGAGGCGGGAGCTGGAGGTAGAAGAAGTCCTATTTCACCCCAACTACAACATCAAT
Cavia_porcellus|6011                GGGAAGAGGCAGGACCTGGAGATAGAAGAAGTCCTATTTCACCCTAAGTACAACATCAAT
Mus_musculus|83643                  GGTCAGAGGCGGGACCTGGAGATTGAAGAGGTCCTGTTCCACCCCAAATACAATATTAAT
Homo_sapiens|72847                  GGGGAGAAGCGGGACCTGGAGATAGAAGTAGTCCTATTTCACCCCAACTACAACATTAAT
Pan_troglodytes|31487               GGGGAGAAGCGGGACCTGGAGATAGAAGTAGTCCTATTTCACCCCAACTACAACATTAAT
Homo_sapiens|81700                  GGGGAGAAGCGGGACCTGGAGATAGAAGTAGTCCTATTTCACCCCAACTACAACATTAAT
Homo_sapiens|80784                  GGGGAGAAGCGGGACCTGGAGATAGAAGTAGTCCTATTTCACCCCAACTACAACATTAAT
Homo_sapiens|82548                  GGGGAGAAGCGGGACCTGGAGATAGAAGTAGTCCTATTTCACCCCAACTACAACATTAAT
Homo_sapiens|72854                  GGGGAGAAGCGGGACCTGGAGATAGAAGTAGTCCTATTTCACCCCAACTACAACATTAAT
Homo_sapiens|78210                  GGGGAGAAGCGGGACCTGGAGATAGAAGTAGTCCTATTTCACCCCAACTACAACATTAAT
Homo_sapiens|79145                  GGGGAGAAGCGGGACCTGGAGATAGAAGTAGTCCTATTTCACCCCAACTACAACATTAAT
                                    ..   .  .   .   . . . . .  .  ..  .  .          .      .    

Tarsius_syrichta|8487               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|14261               GGGAAGACGGCACAAGGAATTCCTGAGTTTTATGACTATGATGTGGCCCTGATTAAGCTC
Spermophilus_tridecemlineatus|14590 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|1383               GGGAAAAAGGCAGCCGGCATTCCCGAGTTTTACGACTACGACGTGGCCCTGATCAAACTC
Oryctolagus_cuniculus|3232          GGGAAAAAGGCAGAAGGAATCCCCGAGTTTTATGACTACGATGTAGCCCTGGTGAAGCTC
Ochotona_princeps|11022             GGGAAAAATGCAGAAGGAATCCCCGAGTTTTATGACTATGATGTGGCCCTGGTGAAGCTC
Otolemur_garnettii|9950             GGTAAAAAGGCAGAAGGAATTCCTGAATTTTATGACTATGATGTGGCCCTGGTCAAGCTC
Cavia_porcellus|6011                GCGAAAAAGGAGCAGGGGATTCTGGAGTTTTATGACTACGATGTGGCTTTGGTTAAGCTC
Mus_musculus|83643                  GGGAAAAAGGCAGAAGGGATCCCTGAGTTCTATGATTATGATGTGGCCCTAGTCAAGCTC
Homo_sapiens|72847                  GGGAAAAAAGAAGCAGGAATTCCTGAATTTTATGACTATGACGTTGCCCTGATCAAGCTC
Pan_troglodytes|31487               GGGAAAAAAGCAGCAGGAATTCCTGAATTTTATGACTATGACGTTGCCCTGATCAAGCTC
Homo_sapiens|81700                  GGGAAAGAAGAAGCAGGAATTCCTGAATTTTATGACTATGACGTTGCCCTGATCAAGCTC
Homo_sapiens|80784                  GGGAAAAAAGAAGCAGGAATTCCTGAATTTTATGACTATGACGTTGCCCTGATCAAGCTC
Homo_sapiens|82548                  GGGAAAAAAGAAGCAGGAATTCCTGAATTTTATGACTATGACGTTGCCCTGATCAAGCTC
Homo_sapiens|72854                  GGGAAAAAAGAAGCAGGAATTCCTGAATTTTATGACTATGACGTTGCCCTGATCAAGCTC
Homo_sapiens|78210                  GGGAAAAAAGAAGCAGGAATTCCTGAATTTTATGACTATGACGTTGCCCTGATCAAGCTC
Homo_sapiens|79145                  GGGAAAAAAGAAGCAGGAATTCCTGAATTTTATGACTATGACGTTGCCCTGATCAAGCTC
                                    .        .     ..  .    .  .. .  .  .  .  .. .   .  .     . 

Tarsius_syrichta|8487               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|14261               AAGAAAAGGTTGACATATGACCAGACTGTC------AGGCCCATCTGCCTCCCCTGCACG
Spermophilus_tridecemlineatus|14590 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|1383               AAGAACAAGCTGCACTACGACCAGACCCTG------AGGCCCATCTGTCTCCCCTGTACG
Oryctolagus_cuniculus|3232          AAGAGTAAGCTGACATACAGCCAGACTCTCAGGAACAGGCCCATCTGCCTGCCCTGCACG
Ochotona_princeps|11022             AAGACCAAGCTGATGTACAGCCAGACTCTG------AGGCCCATTTGCCTCCCTTGCACA
Otolemur_garnettii|9950             AAGAATAAGCTGAAGTATGGCCAGACTCTC------AGGCCCATTTGTCTCCCCTGCACT
Cavia_porcellus|6011                AAGAATAAGGTGACATTCAGCCAGACTCTC------CGGCCCGTGTGCCTCCCCTGCACC
Mus_musculus|83643                  AAGAACAAGCTCAAGTATGGCCAGACTCTC------AGGCCCATCTGTCTCCCCTGCACG
Homo_sapiens|72847                  AAGAATAAGCTGAAATATGGCCAGACTATC------AGGCCCATTTGTCTCCCCTGCACC
Pan_troglodytes|31487               AAGAATAAGCTGAAATATGGCCAGACTATC------AGGCCCATTTGTCTCCCCTGCACC
Homo_sapiens|81700                  AAGAATAAGCTGAAATATGGCCAGACTATC------AGGCCCATTTGTCTCCCCTGCACC
Homo_sapiens|80784                  AAGAATAAGCTGAAATATGGCCAGACTATC------AGGCCCATTTGTCTCCCCTGCACC
Homo_sapiens|82548                  AAGAATAAGCTGAAATATGGCCAGACTATC------AGGCCCATTTGTCTCCCCTGCACC
Homo_sapiens|72854                  AAGAATAAGCTGAAATATGGCCAGACTATC------AGGCCCATTTGTCTCCCCTGCACC
Homo_sapiens|78210                  AAGAATAAGCTGAAATATGGCCAGACTATC------AGGCCCATTTGTCTCCCCTGCACC
Homo_sapiens|79145                  AAGAATAAGCTGAAATATGGCCAGACTATC------AGGCCCATTTGTCTCCCCTGCACC
                                      .     . .    .       .    .        ..    . ..  .    ..    

Tarsius_syrichta|8487               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGAA
Dipodomys_ordii|14261               GAAGGAACAACTCGAGCTTTGCGGCTTCCTCAGACAGCCACCTGCCAGCAACACAAGGAA
Spermophilus_tridecemlineatus|14590 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|1383               GAGGGGACAACTCGAGCTCTGAGGCTCCCTCCGACGACCACTTNNNNNNNNNNNNNNNNN
Oryctolagus_cuniculus|3232          GAGGGGACCACTCGAGCCTTGCGGCTTCCTCAGTCAACCACCTGCCAACAACACAAGGAA
Ochotona_princeps|11022             GAGGGAGCCACTCGAGCCTTGCGGCTTCCTCAGTCAGCCACTTGTCAACAACACAGGCAA
Otolemur_garnettii|9950             GAGGGAACAACTCGAGCTTTGAGGCTTCCTCAGACAACCACTTGCCAGCAACACAACGAG
Cavia_porcellus|6011                CTCGGAACAACTCGAGCCCTGCGGCTTCCACCCACAGCCACCTGCAGGCAGCACAAGGAG
Mus_musculus|83643                  GAGGGAACCACACGAGCCTTGAGGCTTCCTCAGACAGCCACCTGCAAGCAGCACAAGGAA
Homo_sapiens|72847                  GAGGGAACAACTCGAGCTTTGAGGCTTCCTCCAACTACCACTTGCCAGCAACAAAAGGAA
Pan_troglodytes|31487               GAGGGAACAACTCGAGCTTTGAGGCTTCCTCCAACTACCACTTGCCAGCAACAAAAGGAA
Homo_sapiens|81700                  GAGGGAACAACTCGAGCTTTGAGGCTTCCTCCAACTACCACTTGCCAGCAACAAAAGGAA
Homo_sapiens|80784                  GAGGGAACAACTCGAGCTTTGAGGCTTCCTCCAACTACCACTTGCCAGCAACAAAAGGAA
Homo_sapiens|82548                  GAGGGAACAACTCGAGCTTTGAGGCTTCCTCCAACTACCACTTGCCAGCAACAAAAGGAA
Homo_sapiens|72854                  GAGGGAACAACTCGAGCTTTGAGGCTTCCTCCAACTACCACTTGCCAGCAACAAAAGGAA
Homo_sapiens|78210                  GAGGGAACAACTCGAGCTTTGAGGCTTCCTCCAACTACCACTTGCCAGCAACAAAAGGAA
Homo_sapiens|79145                  GAGGGAACAACTCGAGCTTTGAGGCTTCCTCCAACTACCACTTGCCAGCAACAAAAGGAA
                                       ..        . .   .. .. .                ..                

Tarsius_syrichta|8487               GTACTTCTCCCTGCAAAGAATATCAAAGCTCTGTTTGTGTCTGAGGAAAAAAAGAAGCTG
Dipodomys_ordii|14261               GAGCTGCTCCCTGCAAAGGATATCAAAGCTCTGTTTGTGTCTGAAGAAGAGAAGAAACTG
Spermophilus_tridecemlineatus|14590 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|1383               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Oryctolagus_cuniculus|3232          GAGCTGCTCCCTGCGAAGAACGTCAAGGCTCTGTTTGTGTCTGAGGAGGAGAAGAAGCTG
Ochotona_princeps|11022             GAGCTGCTCCCAGCCAAAGATGTCAAAGCTTTCTTTGTGTCTGAGGAAGAGAGGAAGCTG
Otolemur_garnettii|9950             ---CTGCTACCTGCAATGGATGTCAAAGCTCTGTTTGTGTCAGAGGAG---AAGAAGCTG
Cavia_porcellus|6011                GAGCTGCTCCCTGCCAAGGATGTCAAAGCCCTGTTCATCTCTGAGGAGCAGAAGAAACTG
Mus_musculus|83643                  CAGTTGCTCCCTGTGAAGGATGTCAAAGCTCTGTTTGTATCTGAGCAAGGGAAGAGCCTG
Homo_sapiens|72847                  GAGCTGCTCCCTGCACAGGATATCAAAGCTCTGTTTGTGTCTGAGGAGGAGAAAAAGCTG
Pan_troglodytes|31487               GAGCTGCTCCCTGCACAGGATATCAAAGCTCTGTTTGTGTCTGAGGAGGAGAAAAAGCTG
Homo_sapiens|81700                  GAGCTGCTCCCTGCACAGGATATCAAAGCTCTGTTTGTGTCTGAGGAGGAGAAAAAGCTG
Homo_sapiens|80784                  GAGCTGCTCCCTGCACAGGATATCAAAGCTCTGTTTGTGTCTGAGGAGGAGAAAAAGCTG
Homo_sapiens|82548                  GAGCTGCTCCCTGCACAGGATATCAAAGCTCTGTTTGTGTCTGAGGAGGAGAAAAAGCTG
Homo_sapiens|72854                  GAGCTGCTCCCTGCACAGGATATCAAAGCTCTGTTTGTGTCTGAGGAGGAGAAAAAGCTG
Homo_sapiens|78210                  GAGCTGCTCCCTGCACAGGATATCAAAGCTCTGTTTGTGTCTGAGGAGGAGAAAAAGCTG
Homo_sapiens|79145                  GAGCTGCTCCCTGCACAGGATATCAAAGCTCTGTTTGTGTCTGAGGAGGAGAAAAAGCTG
                                        .  .    .         .    .   . ..  . .  .               ..

Tarsius_syrichta|8487               ACTCGGAAGGAGGTCTACATCAAGAACGGGGATAAGAAAGCCAGCTGTGAGAAAGATGCT
Dipodomys_ordii|14261               ACTCGGAAGCATGTTTTTATCAAGAATGGAGATAAGAAAGCCAGCTGTGAGAGAGATGCC
Spermophilus_tridecemlineatus|14590 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|1383               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Oryctolagus_cuniculus|3232          ACTCGCAAGGAAGTTTACATCAAGAATGGGGATAAGAAAGCCAGCTGCGAGAGGGATGCT
Ochotona_princeps|11022             ACTCGGAGGGAAGTTTACATCAAGAATGGAGACAAGAAAGCCAGCTGTGAGAGAGATGCT
Otolemur_garnettii|9950             ACCCGGAAGGAGGTCTATATCAAAAATGGGGATAAGAAAGCCAGTTGTGAGAGAGATGCT
Cavia_porcellus|6011                ACCCGGAAGGAGGTCTACATCAAGAACGGAGAGAAGAAAGCTGGCTGTGAGCAGGATGCC
Mus_musculus|83643                  ACTCGGAAGGAGGTGTACATCAAGAATGGGGACAAGAAAGCCAGTTGTGAGAGAGATGCT
Homo_sapiens|72847                  ACTCGGAAGGAGGTCTACATCAAGAATGGGGATAAGAAAGGCAGCTGTGAGAGAGATGCT
Pan_troglodytes|31487               ACTCGGAAGGAGGTCTACATCAAGAATGGGGATAAGAAAGGCAGCTGTGAGAGAGATGCT
Homo_sapiens|81700                  ACTCGGAAGGAGGTCTACATCAAGAATGGGGATAAGAAAGGCAGCTGTGAGAGAGATGCT
Homo_sapiens|80784                  ACTCGGAAGGAGGTCTACATCAAGAATGGGGATAAGAAAGGCAGCTGTGAGAGAGATGCT
Homo_sapiens|82548                  ACTCGGAAGGAGGTCTACATCAAGAATGGGGATAAGAAAGGCAGCTGTGAGAGAGATGCT
Homo_sapiens|72854                  ACTCGGAAGGAGGTCTACATCAAGAATGGGGATAAGAAAGGCAGCTGTGAGAGAGATGCT
Homo_sapiens|78210                  ACTCGGAAGGAGGTCTACATCAAGAATGGGGATAAGAAAGGCAGCTGTGAGAGAGATGCT
Homo_sapiens|79145                  ACTCGGAAGGAGGTCTACATCAAGAATGGGGATAAGAAAGGCAGCTGTGAGAGAGATGCT
                                        .   .   .. .   .       .. .    .   .   . .. . .   . ..  

Tarsius_syrichta|8487               CTACGTGCCCCAGGCTATGACAAAGTCAAGGATGTATCTGAGGTGGTCACTCCCCAGTTC
Dipodomys_ordii|14261               CAAAATGCTCCAGGCTATGACAAAGTCAAGGACATTTCTGAGGTGGTCACTCCCAGGTTC
Spermophilus_tridecemlineatus|14590 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|1383               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Oryctolagus_cuniculus|3232          CAATACGCTCCTGGCTATGACAAAGTCAAGGACATCTCGGCGGTAGTCACCCCCAGGTTC
Ochotona_princeps|11022             CAGTATGCTCCCGGTTACAGCAAAGTCAAGGACATCTCGGAGGTGGTCACCCCCAGGTTC
Otolemur_garnettii|9950             CAATATGCACCAGGGTATGACAAAGTCAAGGACATCTCTGAGGTAGTCACACCCAGGTTC
Cavia_porcellus|6011                AAGCATGCCACAGGCTACGACAAAATCAAGGACATCTCTGAGGTTGTCACCCCCAGGTTC
Mus_musculus|83643                  ACAAAGGCCCAAGGCTATGAGAAGGTCAAAGATGCCTCTGAGGTGGTCACTCCACGGTTC
Homo_sapiens|72847                  CAATATGCCCCAGGCTATGACAAAGTCAAGGACATCTCAGAGGTGGTCACCCCTCGGTTC
Pan_troglodytes|31487               CAATATGCCCCAGGCTATGACAAAGTCAAGGACATCTCAGAGGTGGTCACCCCTCGGTTC
Homo_sapiens|81700                  CAATATGCCCCAGGCTATGACAAAGTCAAGGACATCTCAGAGGTGGTCACCCCTCGGTTC
Homo_sapiens|80784                  CAATATGCCCCAGGCTATGACAAAGTCAAGGACATCTCAGAGGTGGTCACCCCTCGGTTC
Homo_sapiens|82548                  CAATATGCCCCAGGCTATGACAAAGTCAAGGACATCTCAGAGGTGGTCACCCCTCGGTTC
Homo_sapiens|72854                  CAATATGCCCCAGGCTATGACAAAGTCAAGGACATCTCAGAGGTGGTCACCCCTCGGTTC
Homo_sapiens|78210                  CAATATGCCCCAGGCTATGACAAAGTCAAGGACATCTCAGAGGTGGTCACCCCTCGGTTC
Homo_sapiens|79145                  CAATATGCCCCAGGCTATGACAAAGTCAAGGACATCTCAGAGGTGGTCACCCCTCGGTTC
                                          .     .. .         .    .     .  . ... ..         ... 

Tarsius_syrichta|8487               CTTTGCACTGGAGGGGTGGATCCCTATGCTGACCACAATACTTGCAGAGGTGATTCGGGT
Dipodomys_ordii|14261               CTCTGTACTGGAGGGGTGGACCCCTATGCGGACCCCAATACTTGCAGAGGTGACTCTGGT
Spermophilus_tridecemlineatus|14590 NNNNNNNNNNNNNNNNNNNNNCCCTATGCTGATCCCAATACTTGCAAAGGTGACTCTGGT
Tupaia_belangeri|1383               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Oryctolagus_cuniculus|3232          CTCTGCACTGGAGGAGTGGATCCCTACGCTGACCCCAATACTTGCAGAGGTGACTCTGGT
Ochotona_princeps|11022             CTCTGCACTGGAGGGTCGGATCCCTATGCTGACCCCAACACCTGCAGAGGTGACTCTGGC
Otolemur_garnettii|9950             CTTTGCACCGGAGGGGCGAATCCCTATGCTGACCCAAATACTTGCAGAGGTGATTCTGGA
Cavia_porcellus|6011                CTATGCACCGGTGGAGTGGACCCATACGATGATCCCAACACCTGCAAAGGAGACTCCGGC
Mus_musculus|83643                  CTCTGCACAGGAGGGGTGGATCCCTATGCTGACCCCAACACATGCAAAGGAGATTCCGGG
Homo_sapiens|72847                  CTTTGTACTGGAGGAGTGAGTCCCTATGCTGACCCCAATACTTGCAGAGGTGATTCTGGC
Pan_troglodytes|31487               CTTTGTACTGGAGGAGTGAGTCCCTATGCTGACCCCAATACTTGCAGAGGTGATTCCGGC
Homo_sapiens|81700                  CTTTGTACTGGAGGAGTGAGTCCCTATGCTGACCCCAATACTTGCAGAGGTGATTCTGGC
Homo_sapiens|80784                  CTTTGTACTGGAGGAGTGAGTCCCTATGCTGACCCCAATACTTGCAGAGGTGATTCTGGC
Homo_sapiens|82548                  CTTTGTACTGGAGGAGTGAGTCCCTATGCTGACCCCAATACTTGCAGAGGTGATTCTGGC
Homo_sapiens|72854                  CTTTGTACTGGAGGAGTGAGTCCCTATGCTGACCCCAATACTTGCAGAGGTGATTCTGGC
Homo_sapiens|78210                  CTTTGTACTGGAGGAGTGAGTCCCTATGCTGACCCCAATACTTGCAGAGGTGATTCTGGC
Homo_sapiens|79145                  CTTTGTACTGGAGGAGTGAGTCCCTATGCTGACCCCAATACTTGCAGAGGTGATTCTGGC
                                     . ..    .. ..   .      .  .  .           ..    .. .  .  .. 

Tarsius_syrichta|8487               GGTCCCCTGATTATTCACAAGAGAAGTCGCTTCATTCAAGTTGGTGTAATCAGCTGGGGA
Dipodomys_ordii|14261               GGCCCTCTGATTATTCATAAGAGGAGTCGTTTCATTCAAGTTGGTGTGATCAGCTGGGGA
Spermophilus_tridecemlineatus|14590 GGTCCTCTGATTATTCACAAGAAAAGTCGCTTCATTCAAGTTGGTGTGATCAGCTGGGGA
Tupaia_belangeri|1383               GGCCCCCTGATCATTCACAAGAGGAGTCGCTTCATTCAGGTCGGCGTCATCAGCTGGGGA
Oryctolagus_cuniculus|3232          GGGCCTCTGATCATTCACAAGAGGAGTCGCTTCATTCAAGTTGGTGTCATCAGCTGGGGA
Ochotona_princeps|11022             GGGCCCCTGATTATTCACAAGAGGAGTCGCTTCATTCAGGTTGGTGTCATCAGCTGGGGA
Otolemur_garnettii|9950             GGCCCCCTGATTATTCACAAGAGGAGTCGCTTCATTCAAATTGGTATAATCAGTTGGGGG
Cavia_porcellus|6011                GGCCCCCTGATCATTCACAAGAGGAGTCGCTTCATCCAGGTGGGAGTTATCAGCTGGGGA
Mus_musculus|83643                  GGCCCTCTCATTGTTCACAAGAGAAGCCGCTTCATTCAAGTTGGTGTGATTAGCTGGGGA
Homo_sapiens|72847                  GGCCCCTTGATAGTTCACAAGAGAAGTCGTTTCATTCAAGTTGGTGTAATCAGCTGGGGA
Pan_troglodytes|31487               GGCCCCTTGATAGTTCACAAAAGAAGTCGTTTCATTCAAGTTGGTGTAATCAGCTGGGGA
Homo_sapiens|81700                  GGCCCCTTGATAGTTCACAAGAGAAGTCGTTTCATTCAAGTTGGTGTAATCAGCTGGGGA
Homo_sapiens|80784                  GGCCCCTTGATAGTTCACAAGAGAAGTCGTTTCATTCAAGTTGGTGTAATCAGCTGGGGA
Homo_sapiens|82548                  GGCCCCTTGATAGTTCACAAGAGAAGTCGTTTCATTCAAGTTGGTGTAATCAGCTGGGGA
Homo_sapiens|72854                  GGCCCCTTGATAGTTCACAAGAGAAGTCGTTTCATTCAAGTTGGTGTAATCAGCTGGGGA
Homo_sapiens|78210                  GGCCCCTTGATAGTTCACAAGAGAAGTCGTTTCATTCAAGTTGGTGTAATCAGCTGGGGA
Homo_sapiens|79145                  GGCCCCTTGATAGTTCACAAGAGAAGTCGTTTCATTCAAGTTGGTGTAATCAGCTGGGGA
                                    ** **  * ** .**** **.*..** ** ***** **..* ** .* ** ** *****.

Tarsius_syrichta|8487               GTAGTGGATGTCTGCAAAAACCAGAAGCGGCAAAAGCAGGTACCTGCTCATGCCCGAGAC
Dipodomys_ordii|14261               GTGGTGGATGTCTGCAAACACCAGAAA------AAGCAGGTACCTGCTCATGCCCGAGAC
Spermophilus_tridecemlineatus|14590 GTAGTGGATGTCTGCAAAGACCACAGACTGCAACAGCAGGTACCTGCTCACGCCCGGGAC
Tupaia_belangeri|1383               GTGGTGGATGTCTGTAAGAACCAGAGGCGGGAACAGCAGGTACCTGCTCACGCGCGCGAC
Oryctolagus_cuniculus|3232          GTAGTAGATGTCTGCAAAGACCACAAGCGGCGCCTGCAGGCACCTGCTTATGCCCGGGAC
Ochotona_princeps|11022             GTTGTGGACGTCTGCAAAGGCCAGAAACGGTACAAGCAGGTGCCTGCTCATGCTCGGGAC
Otolemur_garnettii|9950             GTAGTGGATGTCTGCAAAAACCAGAGACGGCAACGACAGGCACCTGCTCATGCCCGAGAC
Cavia_porcellus|6011                GTGGTAGACGTCTGCTATCACCGGAAACGGCAACAGCGGGTACCTGCTTATGCCCGGGAC
Mus_musculus|83643                  GTAGTAGATGTCTGCAGAGACCAGAGGCGGCAACAGCTGGTACCCTCTTATGCCCGGGAC
Homo_sapiens|72847                  GTAGTGGATGTCTGCAAAAACCAGAAGCGGCAAAAGCAGGTACCTGCTCACGCCCGAGAC
Pan_troglodytes|31487               GTAGTGGATGTCTGCAAAAACCAGAAGCGGCAAAAGCAGGTACCTGCTCACGCCCGAGAC
Homo_sapiens|81700                  GTAGTGGATGTCTGCAAAAACCAGAAGCGGCAAAAGCAGGTACCTGCTCACGCCCGAGAC
Homo_sapiens|80784                  GTAGTGGATGTCTGCAAAAACCAGAAGCGGCAAAAGCAGGTACCTGCTCACGCCCGAGAC
Homo_sapiens|82548                  GTAGTGGATGTCTGCAAAAACCAGAAGCGGCAAAAGCAGGTACCTGCTCACGCCCGAGAC
Homo_sapiens|72854                  GTAGTGGATGTCTGCAAAAACCAGAAGCGGCAAAAGCAGGTACCTGCTCACGCCCGAGAC
Homo_sapiens|78210                  GTAGTGGATGTCTGCAAAAACCAGAAGCGGCAAAAGCAGGTACCTGCTCACGCCCGAGAC
Homo_sapiens|79145                  GTAGTGGATGTCTGCAAAAACCAGAAGCGGCAAAAGCAGGTACCTGCTCACGCCCGAGAC
                                    ** **.** ***** :.  .**. *..      . .* ** .**  ** * ** ** ***

Tarsius_syrichta|8487               TTTCACATCAACCTTTTCCAAGTGCTGCCCTGGCTGAAGGAGAAACTCAAAGATGAAGAT
Dipodomys_ordii|14261               TTTCACGTCAACCTCTTCCAAGTGCTTCCCTGGCTCAAGGAGAAACTCAAAGATGAAGAT
Spermophilus_tridecemlineatus|14590 TTTCACGTCAATCTCTTCCAAGTGCTGCCCTGGCTCAAGGAGAAACTCAAAGATGAGGAT
Tupaia_belangeri|1383               TTTCACATCAACCTCTTCCACGTGCTGCCCTGGCTCAAAGAGAAACTCAAAGATGAAGAC
Oryctolagus_cuniculus|3232          TTTCATATCAACCTCTTCCAAGTGCTGCCCTGGCTCAAGGACAAACTCAAAGATGAGGAT
Ochotona_princeps|11022             TTTCACATCAACCTCTTCCAAGTGCTGCCATGGCTCAAGGACAAACTCAAAGACGAGGAT
Otolemur_garnettii|9950             TTTCACATCAACCTCTTCCAAGTGCTGCCATGGCTGAAAGAGAAACTCAAAGATGAGGAT
Cavia_porcellus|6011                TTTCATGTCAATCTCTTCCAAGTGCTGCCCTGGCTCAAGGAGAAACTCAAGGATGAGAAT
Mus_musculus|83643                  TTCCACATCAACCTCTTCCAGGTGCTGCCCTGGCTAAAGGACAAGCTCAAAGATGAGGAT
Homo_sapiens|72847                  TTTCACATCAACCTCTTTCAAGTGCTGCCCTGGCTGAAGGAGAAACTCCAAGATGAGGAT
Pan_troglodytes|31487               TTTCACATCAACCTCTTTCAAGTGCTGCCCTGGCTGAAGGAGAAACTCCAAGATGAGGAT
Homo_sapiens|81700                  TTTCACATCAACCTCTTTCAAGTGCTGCCCTGGCTGAAGGAGAAACTCCAAGATGAGGAT
Homo_sapiens|80784                  TTTCACATCAACCTCTTTCAAGTGCTGCCCTGGCTGAAGGAGAAACTCCAAGATGAGGAT
Homo_sapiens|82548                  TTTCACATCAACCTCTTTCAAGTGCTGCCCTGGCTGAAGGAGAAACTCCAAGATGAGGAT
Homo_sapiens|72854                  TTTCACATCAACCTCTTTCAAGTGCTGCCCTGGCTGAAGGAGAAACTCCAAGATGAGGAT
Homo_sapiens|78210                  TTTCACATCAACCTCTTTCAAGTGCTGCCCTGGCTGAAGGAGAAACTCCAAGATGAGGAT
Homo_sapiens|79145                  TTTCACATCAACCTCTTTCAAGTGCTGCCCTGGCTGAAGGAGAAACTCCAAGATGAGGAT
                                    ** ** .**** ** ** ** ***** **.***** **.** **.***.*.** **..* 

Tarsius_syrichta|8487               CTGGGTTTTCTATAA
Dipodomys_ordii|14261               TTGGGTTTCTTATAA
Spermophilus_tridecemlineatus|14590 CTGGGTTTTCTATGA
Tupaia_belangeri|1383               CTGGAATTTCTATGA
Oryctolagus_cuniculus|3232          CTGGGTTTTCTGTAA
Ochotona_princeps|11022             CTGGGTTTTCTATAA
Otolemur_garnettii|9950             CTGGATTTTCTTTAA
Cavia_porcellus|6011                CTGGATTTCTTATAA
Mus_musculus|83643                  TTGGGTTTTCTATAA
Homo_sapiens|72847                  TTGGGTTTTCTATAA
Pan_troglodytes|31487               TTGGGTTTTCTATAA
Homo_sapiens|81700                  TTGGGTTTTCTATAA
Homo_sapiens|80784                  TTGGGTTTTCTATAA
Homo_sapiens|82548                  TTGGGTTTTCTATAA
Homo_sapiens|72854                  TTGGGTTTTCTATAA
Homo_sapiens|78210                  TTGGGTTTTCTATAA
Homo_sapiens|79145                  TTGGGTTTTCTATAA
                                     ***.:**  * *.*

multiple sequence alignment in CLUSTALW format


Tarsius_syrichta|7763               ------------------------------------------------------------
Dipodomys_ordii|13398               ------------------------------------------------------------
Spermophilus_tridecemlineatus|13063 ------------------------------------------------------------
Tupaia_belangeri|1178               ------------------------------------------------------------
Oryctolagus_cuniculus|23506         MDPLRALLCLLLLYPGLAPATPSCSQNVNISGGTFTLSHGWAPGSLLTYSCPQDRYPSPP
Ochotona_princeps|9600              ------------------------------------------------------------
Otolemur_garnettii|8560             ------------------------------------------------------------
Cavia_porcellus|4694                ------------------------------------------------------------
Mus_musculus|15374                  ------------------------------------------------------------
Homo_sapiens|2278                   MGPLMVLFCLLFLYPGLADSAPSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPA
Pan_troglodytes|17528               ------------------------------------------------------------
Homo_sapiens|85590                  ------------------------------------------------------------
Homo_sapiens|152636                 ------------------------------------------------------------
Homo_sapiens|84191                  ------------------------------------------------------------
Homo_sapiens|1945                   ------------------------------------------------------------
Homo_sapiens|88746                  ------------------------------------------------------------
Homo_sapiens|87535                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|7763               ------------------------------------------------------MGSNL-
Dipodomys_ordii|13398               ------------------------------------------------------MGHNP-
Spermophilus_tridecemlineatus|13063 ------------------------------------------------------MGCHL-
Tupaia_belangeri|1178               ------------------------------------------------------MGSHL-
Oryctolagus_cuniculus|23506         ------------------------------------------------------WRLCKS
Ochotona_princeps|9600              ------------------------------------------------------MRNTP-
Otolemur_garnettii|8560             ------------------------------------------------------------
Cavia_porcellus|4694                ----------------------------------------------------AAMGHSV-
Mus_musculus|15374                  ------------------------------------------------------MTME--
Homo_sapiens|2278                   SRLCKSSGQWQTPGATRSLSKAVCKPGHCPNPGISLGAVRTGFRFGHGDKVRYRCSSNLV
Pan_troglodytes|17528               ------------------------------------------------------MGSNL-
Homo_sapiens|85590                  ------------------------------------------------------MGSNL-
Homo_sapiens|152636                 ------------------------------------------------------MGSNL-
Homo_sapiens|84191                  ------------------------------------------------------MGSNL-
Homo_sapiens|1945                   ------------------------------------------------------MGSNL-
Homo_sapiens|88746                  ------------------------------------------------------MGSNL-
Homo_sapiens|87535                  ------------------------------------------------------MGSNL-
                                                                                                

Tarsius_syrichta|7763               -----------------SPLLC-LMPL---------------------------------
Dipodomys_ordii|13398               -----------------SSQLW-LVSL---------------------------------
Spermophilus_tridecemlineatus|13063 -----------------SPHLC-LVSL---------------------------------
Tupaia_belangeri|1178               -----------------SPQLC-LLSL---------------------------------
Oryctolagus_cuniculus|23506         NGQWQTPGAKRLTRAVCKPVRC-PAPVSFENGMYTPRLAAYPVGSNLSFECEDGFTLRGS
Ochotona_princeps|9600              -----------------GPRLCHLVPL---------------------------------
Otolemur_garnettii|8560             ------------------------------------------------------------
Cavia_porcellus|4694                -----------------GPWLC-LAPL---------------------------------
Mus_musculus|15374                  -----------------SPQLC-LVLL---------------------------------
Homo_sapiens|2278                   LTGSSERECQGNGVWSGTEPIC-RQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKDHE
Pan_troglodytes|17528               -----------------SPQLC-LMPF---------------------------------
Homo_sapiens|85590                  -----------------SPQLC-LMPF---------------------------------
Homo_sapiens|152636                 -----------------SPQLC-LMPF---------------------------------
Homo_sapiens|84191                  -----------------SPQLC-LMPF---------------------------------
Homo_sapiens|1945                   -----------------SPQLC-LMPF---------------------------------
Homo_sapiens|88746                  -----------------SPQLC-LMPF---------------------------------
Homo_sapiens|87535                  -----------------SPQLC-LMPF---------------------------------
                                                                                                

Tarsius_syrichta|7763               -----------------------VLGL---------------------------------
Dipodomys_ordii|13398               -----------------------FLAF---------------------------------
Spermophilus_tridecemlineatus|13063 -----------------------VLGL---------------------------------
Tupaia_belangeri|1178               -----------------------VLGL---------------------------------
Oryctolagus_cuniculus|23506         PVRHCR-----------------LNGM---------------------------------
Ochotona_princeps|9600              -----------------------FLRL---------------------------------
Otolemur_garnettii|8560             ------------------------------------------------------------
Cavia_porcellus|4694                -----------------------VLGL---------------------------------
Mus_musculus|15374                  -----------------------VLGF---------------------------------
Homo_sapiens|2278                   NGTGTNTYAALNSVYLMMNNQMRLLGMETMAWQEIRHAIILLTDGKSNMGGSPKTAVDHI
Pan_troglodytes|17528               -----------------------ILGL---------------------------------
Homo_sapiens|85590                  -----------------------ILGL---------------------------------
Homo_sapiens|152636                 -----------------------ILGL---------------------------------
Homo_sapiens|84191                  -----------------------ILGL---------------------------------
Homo_sapiens|1945                   -----------------------ILGL---------------------------------
Homo_sapiens|88746                  -----------------------ILGL---------------------------------
Homo_sapiens|87535                  -----------------------ILGL---------------------------------
                                                                                                

Tarsius_syrichta|7763               ------------------------------------------------------------
Dipodomys_ordii|13398               ------------------------------------------------------------
Spermophilus_tridecemlineatus|13063 ------------------------------------------------------------
Tupaia_belangeri|1178               ------------------------------------------------------------
Oryctolagus_cuniculus|23506         ------------------------------------------------------------
Ochotona_princeps|9600              ------------------------------------------------------------
Otolemur_garnettii|8560             ------------------------------------------------------------
Cavia_porcellus|4694                ------------------------------------------------------------
Mus_musculus|15374                  ------------------------------------------------------------
Homo_sapiens|2278                   REILNINQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQVFEHM
Pan_troglodytes|17528               ------------------------------------------------------------
Homo_sapiens|85590                  ------------------------------------------------------------
Homo_sapiens|152636                 ------------------------------------------------------------
Homo_sapiens|84191                  ------------------------------------------------------------
Homo_sapiens|1945                   ------------------------------------------------------------
Homo_sapiens|88746                  ------------------------------------------------------------
Homo_sapiens|87535                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|7763               ------------------------------------------------------------
Dipodomys_ordii|13398               ------------------------------------------------------------
Spermophilus_tridecemlineatus|13063 ------------------------------------------------------------
Tupaia_belangeri|1178               ------------------------------------------------------------
Oryctolagus_cuniculus|23506         ------------------------------------------------------------
Ochotona_princeps|9600              ------------------------------------------------------------
Otolemur_garnettii|8560             ------------------------------------------------------------
Cavia_porcellus|4694                ------------------------------------------------------------
Mus_musculus|15374                  ------------------------------------------------------------
Homo_sapiens|2278                   LDVSKLTDTICGVGNMSANASDQERTPWHVTIKPKSQETCRGALISDQWVLTAAHCFRDG
Pan_troglodytes|17528               ------------------------------------------------------------
Homo_sapiens|85590                  ------------------------------------------------------------
Homo_sapiens|152636                 ------------------------------------------------------------
Homo_sapiens|84191                  ------------------------------------------------------------
Homo_sapiens|1945                   ------------------------------------------------------------
Homo_sapiens|88746                  ------------------------------------------------------------
Homo_sapiens|87535                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|7763               ------------------------------------------------------------
Dipodomys_ordii|13398               ------------------------------------------------------------
Spermophilus_tridecemlineatus|13063 ------------------------------------------------------------
Tupaia_belangeri|1178               ------------------------------------------------------------
Oryctolagus_cuniculus|23506         ------------------------------------------------------------
Ochotona_princeps|9600              ------------------------------------------------------------
Otolemur_garnettii|8560             ------------------------------------------------------------
Cavia_porcellus|4694                ------------------------------------------------------------
Mus_musculus|15374                  ------------------------------------------------------------
Homo_sapiens|2278                   NDHSLWRVNVGDPKSQWGKEFLIEKAVISPGFDVFAKKNQGILEFYGDDIALLKLAQKVK
Pan_troglodytes|17528               ------------------------------------------------------------
Homo_sapiens|85590                  ------------------------------------------------------------
Homo_sapiens|152636                 ------------------------------------------------------------
Homo_sapiens|84191                  ------------------------------------------------------------
Homo_sapiens|1945                   ------------------------------------------------------------
Homo_sapiens|88746                  ------------------------------------------------------------
Homo_sapiens|87535                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|7763               -----------------------------------------------LSQ----------
Dipodomys_ordii|13398               -----------------------------------------------SCG----------
Spermophilus_tridecemlineatus|13063 -----------------------------------------------LAG----------
Tupaia_belangeri|1178               -----------------------------------------------LSG----------
Oryctolagus_cuniculus|23506         -----------------------------------------------WDGETDHENGTGT
Ochotona_princeps|9600              -----------------------------------------------LTG----------
Otolemur_garnettii|8560             ------------------------------------------------------------
Cavia_porcellus|4694                -----------------------------------------------WSG----------
Mus_musculus|15374                  -----------------------------------------------SSG----------
Homo_sapiens|2278                   MSTHARPICLPCTMEANLALRRPQGSTCRDHENELLNKQSVPAHFVALNGSKLNINLKMG
Pan_troglodytes|17528               -----------------------------------------------LSG----------
Homo_sapiens|85590                  -----------------------------------------------LSG----------
Homo_sapiens|152636                 -----------------------------------------------LSG----------
Homo_sapiens|84191                  -----------------------------------------------LSG----------
Homo_sapiens|1945                   -----------------------------------------------LSG----------
Homo_sapiens|88746                  -----------------------------------------------LSG----------
Homo_sapiens|87535                  -----------------------------------------------LSG----------
                                                                                                

Tarsius_syrichta|7763               --------------------------------------------GVSTTP-LPFTRPQVS
Dipodomys_ordii|13398               --------------------------------------------GVSTTP-SPVDQAQSS
Spermophilus_tridecemlineatus|13063 --------------------------------------------SVNTIPLWP--QPQGS
Tupaia_belangeri|1178               --------------------------------------------GVSATP-VPADQSQRS
Oryctolagus_cuniculus|23506         NIYKALNAVNIMMNNQMQRL------------------------GMETTG-WQEIRHAII
Ochotona_princeps|9600              --------------------------------------------GVGTTP-LPEDQPQRS
Otolemur_garnettii|8560             ------------------------------------------------------------
Cavia_porcellus|4694                --------------------------------------------GVSSTT-LPTSRPWSP
Mus_musculus|15374                  --------------------------------------------GVSATP-VLEARPQVS
Homo_sapiens|2278                   VEWTSCAEVVSQEKTMFPNLTDVREVVTDQFLCSGTQEDESPCKGVTTTP-WSLARPQGS
Pan_troglodytes|17528               --------------------------------------------GVTTTP-WPLAQPQES
Homo_sapiens|85590                  --------------------------------------------GVTTTP-WSLARPQGS
Homo_sapiens|152636                 --------------------------------------------GVTTTP-WSLARPQGS
Homo_sapiens|84191                  --------------------------------------------GVTTTP-WSLARPQGS
Homo_sapiens|1945                   --------------------------------------------GVTTTP-WSLARPQGS
Homo_sapiens|88746                  --------------------------------------------GVTTTP-WSLARPQGS
Homo_sapiens|87535                  --------------------------------------------GVTTTP-WSLARPQGS
                                                                                                

Tarsius_syrichta|7763               CSLEGVXXXXXXXX------------------XXXXXXXXXXXX----------------
Dipodomys_ordii|13398               CSLEGVEIKGGSFQ------------------LLQEGQTLEYLC----------------
Spermophilus_tridecemlineatus|13063 CSLEGVEIKGGSFQ------------------LLQEGKTVEYIC----------------
Tupaia_belangeri|1178               CSPEEAAIKGGSFR------------------LLQEGRTLEYVC----------------
Oryctolagus_cuniculus|23506         LLTDGKSNMGGSPKPAVDSIKDVLNIKEKRNDYLDVSKLTDTICGVGNMSANASDQERTP
Ochotona_princeps|9600              CSLEGVEIKGGSFQ------------------LLRGGEALEYIC----------------
Otolemur_garnettii|8560             ------------------------------------------------------------
Cavia_porcellus|4694                CSLEGIEIKGGSFQ------------------LLKQGRALEYVC----------------
Mus_musculus|15374                  CSLEGVEIKGGSFQ------------------LLQGGQALEYLC----------------
Homo_sapiens|2278                   CSLEGVEIKGGSFR------------------LLQEGQALEYVC----------------
Pan_troglodytes|17528               CSLEGVEIKGGSFR------------------LLQEGQALEYVC----------------
Homo_sapiens|85590                  CSLEGVEIKGGSFR------------------LLQEGQALEYVC----------------
Homo_sapiens|152636                 CSLEGVEIKGGSFR------------------LLQEGQALEYVC----------------
Homo_sapiens|84191                  CSLEGVEIKGGSFR------------------LLQEGQALEYVC----------------
Homo_sapiens|1945                   CSLEGVEIKGGSFR------------------LLQEGQALEYVC----------------
Homo_sapiens|88746                  CSLEGVEIKGGSFR------------------LLQEGQALEYVC----------------
Homo_sapiens|87535                  CSLEGVEIKGGSFR------------------LLQEGQALEYVC----------------
                                                                                                

Tarsius_syrichta|7763               ------------------------------------------------------------
Dipodomys_ordii|13398               ------------------------------------------------------------
Spermophilus_tridecemlineatus|13063 ------------------------------------------------------------
Tupaia_belangeri|1178               ------------------------------------------------------------
Oryctolagus_cuniculus|23506         WHVTFKPRAQETCRGALISDQWVLTAAHCFHHAEDRSLWRVSVGDPNSQHGKEFLIEKVE
Ochotona_princeps|9600              ------------------------------------------------------------
Otolemur_garnettii|8560             ------------------------------------------------------------
Cavia_porcellus|4694                ------------------------------------------------------------
Mus_musculus|15374                  ------------------------------------------------------------
Homo_sapiens|2278                   ------------------------------------------------------------
Pan_troglodytes|17528               ------------------------------------------------------------
Homo_sapiens|85590                  ------------------------------------------------------------
Homo_sapiens|152636                 ------------------------------------------------------------
Homo_sapiens|84191                  ------------------------------------------------------------
Homo_sapiens|1945                   ------------------------------------------------------------
Homo_sapiens|88746                  ------------------------------------------------------------
Homo_sapiens|87535                  ------------------------------------------------------------
                                                                                                

Tarsius_syrichta|7763               -XXXXXXXXXXXX----------------------------------------------X
Dipodomys_ordii|13398               -PSGFYPYPVQTR----------------------------------------------T
Spermophilus_tridecemlineatus|13063 -PSGFYPYPVKTR----------------------------------------------T
Tupaia_belangeri|1178               -PSGFYPYPAQTR----------------------------------------------T
Oryctolagus_cuniculus|23506         VPSGFNVYAKKSQGIPEFYGDDIALLKLTQKVKISTHARPICLPCTVEANLALRKPQGST
Ochotona_princeps|9600              -PSGFYPYPVQTR----------------------------------------------T
Otolemur_garnettii|8560             ------------------------------------------------------------
Cavia_porcellus|4694                -PSGFYPYPVQTR----------------------------------------------I
Mus_musculus|15374                  -PSGFYPYPVQTR----------------------------------------------T
Homo_sapiens|2278                   -PSGFYPYPVQTR----------------------------------------------T
Pan_troglodytes|17528               -PSGFYPYPVQTR----------------------------------------------T
Homo_sapiens|85590                  -PSGFYPYPVQTR----------------------------------------------T
Homo_sapiens|152636                 -PSGFYPYPVQTR----------------------------------------------T
Homo_sapiens|84191                  -PSGFYPYPVQTR----------------------------------------------T
Homo_sapiens|1945                   -PSGFYPYPVQTR----------------------------------------------T
Homo_sapiens|88746                  -PSGFYPYPVQTR----------------------------------------------T
Homo_sapiens|87535                  -PSGFYPYPVQTR----------------------------------------------T
                                                                                                

Tarsius_syrichta|7763               XXX----------------------------------------XXXXXXXXXXXXXXXXX
Dipodomys_ordii|13398               CKA----------------------------------------TGSWSTLKTRDQKIVKK
Spermophilus_tridecemlineatus|13063 CRS----------------------------------------TGSWSSLKTRDQKIVKK
Tupaia_belangeri|1178               CRS----------------------------------------TGSWNTLKTQDQKIVKK
Oryctolagus_cuniculus|23506         CRDHEEELLSQRSIPAHFVALDGNKLNVKLKTGAEWKNCIQAVSERFPNLTDVSEVVTDQ
Ochotona_princeps|9600              CRS----------------------------------------TGSWSPLRTQDQRMIAK
Otolemur_garnettii|8560             ------------------------------------------------------------
Cavia_porcellus|4694                CRS----------------------------------------TGNWSSLKTQDHKIVKK
Mus_musculus|15374                  CRS----------------------------------------TGSWSDLQTRDQKIVQK
Homo_sapiens|2278                   CRS----------------------------------------TGSWSTLKTQDQKTVRK
Pan_troglodytes|17528               CRS----------------------------------------TGSWSTLKTQVQKTVRK
Homo_sapiens|85590                  CRS----------------------------------------TGSWSTLKTQDQKTVRK
Homo_sapiens|152636                 CRS----------------------------------------TGSWSTLKTQDQKTVRK
Homo_sapiens|84191                  CRS----------------------------------------TGSWSTLKTQDQKTVRK
Homo_sapiens|1945                   CRS----------------------------------------TGSWSTLKTQDQKTVRK
Homo_sapiens|88746                  CRS----------------------------------------TGSWSTLKTQDQKTVRK
Homo_sapiens|87535                  CRS----------------------------------------TGSWSTLKTQDQKTVRK
                                                                                                

Tarsius_syrichta|7763               XXX-------------XXIHCPRPQDFENGEYWPRSPYYNVSDEISFHCYDGYTLRGSAN
Dipodomys_ordii|13398               AEC-------------RXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Spermophilus_tridecemlineatus|13063 AEC-------------RAIYCPRPQEFENGYYWPRSSYYXXXXXXXXXXXXXXXXXXXXX
Tupaia_belangeri|1178               AEC-------------RAIRCPRPQDFETG-YWPRAPYYT-SDEISFSCYDGYS-SGSAN
Oryctolagus_cuniculus|23506         FLCSGAEQDDNPCKGGRAIRCPKPQDFENGDYWPRSPYYNVNDEISFHCYHGYTLRGSAN
Ochotona_princeps|9600              AEC-------------RXXXXXXXXXXXXXXXXXXXXXYNVNDEISFHCYDGYTLRGSAN
Otolemur_garnettii|8560             ------------------------------------PYYNVSDEISFHCYDGYTLRGSAN
Cavia_porcellus|4694                AEC-------------RAIHCPRPQEFENGDYWPRSLHYNVSDEISFHCYNGYTLRGSAN
Mus_musculus|15374                  AEC-------------RAIRCPRPQDFENGEFWPRSPFYNLSDQISFQCYDGYVLRGSAN
Homo_sapiens|2278                   AEC-------------RAIHCPRPHDFENGEYWPRSPYYNVSDEISFHCYDGYTLRGSAN
Pan_troglodytes|17528               AEC-------------RAIHCPRPHDFENGEYWPRSPYYNVSDEISFHCYDGYTLRGSAN
Homo_sapiens|85590                  AEC-------------RAIHCPRPHDFENGEYWPRSPYYNVSDEISFHCYDGYTLRGSAN
Homo_sapiens|152636                 AEC-------------RAIHCPRPHDFENGEYWPRSPYYNVSDEISFHCYDGYTLRGSAN
Homo_sapiens|84191                  AEC-------------RAIHCPRPHDFENGEYWPRSPYYNVSDEISFHCYDGYTLRGSAN
Homo_sapiens|1945                   AEC-------------RAIHCPRPHDFENGEYWPRSPYYNVSDEISFHCYDGYTLRGSAN
Homo_sapiens|88746                  AEC-------------RAIHCPRPHDFENGEYWPRSPYYNVSDEISFHCYDGYTLRGSAN
Homo_sapiens|87535                  AEC-------------RAIHCPRPHDFENGEYWPRSPYYNVSDEISFHCYDGYTLRGSAN
                                                                                                

Tarsius_syrichta|7763               RTCQVNGRWSGQTAICDNGAGYCSNPGTPIGTRKVGSQYRLEDSVTYYCSRGLTLRGSQR
Dipodomys_ordii|13398               XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Spermophilus_tridecemlineatus|13063 XXXXXXXXXXXXXXXXXXXXGYCPNPGIPIGTRKVGSQYRLEDTVTYHCSRGLTLRGSQQ
Tupaia_belangeri|1178               RTCV--NRW--RQTICDD-TGYCPT---SIPRTKVGSQYRLEDSVTYYCSRGLTLRGSQR
Oryctolagus_cuniculus|23506         RTCQVNGRWDGQTAICDDGAGYCPNPGIPIGTRKAGSRYRLEDTVTYHCSQGLTLRGSQQ
Ochotona_princeps|9600              RTCQSNGRWDGQTVICDDGAGYCPNPGIPIGMRKVGSQYRLEDTVTYHCSQSFTLRGSQQ
Otolemur_garnettii|8560             RTCQENGRWDGQTTICDNGAGYCSNPGIPIGTRKVGSQYRLEDSVTYYCSRGLTLRGSQR
Cavia_porcellus|4694                RTCQANGRWDGQTAICDDGAAYCPNPGIPIGMRKVGSQYRLEDTVTYHCSRGLMLRGSQQ
Mus_musculus|15374                  RTCQENGRWDGQTAICDDGAGYCPNPGIPIGTRKVGSQYRLEDIVTYHCSRGLVLRGSQK
Homo_sapiens|2278                   RTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQYRLEDSVTYHCSRGLTLRGSQR
Pan_troglodytes|17528               RTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQYRLEDSVTYHCSRGLTLRGSQR
Homo_sapiens|85590                  RTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQYRLEDSVTYHCSRGLTLRGSQR
Homo_sapiens|152636                 RTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQYRLEDSVTYHCSRGLTLRGSQR
Homo_sapiens|84191                  RTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQYRLEDSVTYHCSRGLTLRGSQR
Homo_sapiens|1945                   RTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQYRLEDSVTYHCSRGLTLRGSQR
Homo_sapiens|88746                  RTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQYRLEDSVTYHCSRGLTLRGSQR
Homo_sapiens|87535                  RTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQYRLEDSVTYHCSRGLTLRGSQR
                                                                                                

Tarsius_syrichta|7763               RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEVVDAEDGHSPXXXXXXXXX
Dipodomys_ordii|13398               XXXXXXXXXXXXXXXXXXSFMYDTPEEVAEAFLSSLTETIEGVDAEDGHRPGEQQKRKIV
Spermophilus_tridecemlineatus|13063 RKCQEGGSWSGTEPSCQDTFMYDTPQEVAEAFLSSLTETIEGVDAEDGHSPGEQQKRKIV
Tupaia_belangeri|1178               RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHSPGEQHKRKII
Oryctolagus_cuniculus|23506         RTCQEGGSWSGTEPSCQGSFMYDTPQEVAEAFLSSLTQTLEGVDAEDGHSPGELQKRKIV
Ochotona_princeps|9600              RTCQEGGSWSGTEPSCQGSFMYDTPQEVAEAFLSSLTQTLEGVDAEDGHSPGELQKRKIV
Otolemur_garnettii|8560             RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHSPGEQQKRKIV
Cavia_porcellus|4694                RKCQESGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHSPGEQQKRRII
Mus_musculus|15374                  RKCQEGGSWSGTEPSCQDSFMYDSPQEVAEAFLSSLTETIEGADAEDGHSPGEQQKRKIV
Homo_sapiens|2278                   RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIV
Pan_troglodytes|17528               RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIV
Homo_sapiens|85590                  RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIV
Homo_sapiens|152636                 RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIV
Homo_sapiens|84191                  RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIV
Homo_sapiens|1945                   RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIV
Homo_sapiens|88746                  RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIV
Homo_sapiens|87535                  RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIV
                                                      :****:*:***********:*:* .****** *         

Tarsius_syrichta|7763               XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Dipodomys_ordii|13398               LDPSGSMNIYLVLDGSDSIGASNFTGAKKCLTNLIEKVASYGVRPRYALVTYATAPKIVV
Spermophilus_tridecemlineatus|13063 LDPSGSMNIYLVLDGSDSIGTGNFTGAKRCLANLIEKIASYGVRPRYALVTYATEPKVVI
Tupaia_belangeri|1178               IDPSGSMNIYLVLDGSDSIGARNFTGAKRCLTNLIEKVASYGVKPKYGLVTYATVPKVLV
Oryctolagus_cuniculus|23506         LDPAGSMNIYLVLDGSDSIGASNFTGAKRCLVNLIEKVASYGVRPRYGLVTYATYPNVLV
Ochotona_princeps|9600              LDPAGSLNIYLVLDGSESIGKSNFTGAKRCLANLIEKVASYGVKPRYGLVTYATNANVLV
Otolemur_garnettii|8560             LDPSGSMNIYLVLDGSDSIGASNFTGAKRCLANLIEK-----------------------
Cavia_porcellus|4694                LDPAGSMNIYLVLDGSDSIGASNFTGAKRCLASLIEKVASYGVKPRYALVTYATEPKVLV
Mus_musculus|15374                  LDPSGSMNIYLVLDGSDSIGSSNFTGAKRCLTNLIEKVASYGVRPRYGLLTYATVPKVLV
Homo_sapiens|2278                   LDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWV
Pan_troglodytes|17528               LDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATHPKIWV
Homo_sapiens|85590                  LDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWV
Homo_sapiens|152636                 LDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWV
Homo_sapiens|84191                  LDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWV
Homo_sapiens|1945                   LDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWV
Homo_sapiens|88746                  LDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWV
Homo_sapiens|87535                  LDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWV
                                                                                                

Tarsius_syrichta|7763               XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Dipodomys_ordii|13398               KVSDEKSSDADWVTEQL-KISY-DHKLKSGTNTKRALQTVYSMMSWAGDVPPEGWNRTRH
Spermophilus_tridecemlineatus|13063 RVSDQKSSDADWVTEKLNQISYEDHKLKTGTNTKRALQAVYNMMNWAGDVPPEGWNRTRH
Tupaia_belangeri|1178               RVSDPRSSDADWVTQKLNEISYEDHKLKSGTNTKRALQAVYSMMSWAGDHPPEGWNRTRH
Oryctolagus_cuniculus|23506         RVSDPKSSDANWVTEKLNQISYEDHKLKTGTNTKRALVEVYNMMSWPGDVPPEGWNRTRH
Ochotona_princeps|9600              RVSNAKSSDADWVIQQLDKISYDDHKLKAGTNTKRALMEVYNMMSWPGETPPEGWNRTRH
Otolemur_garnettii|8560             ------------------------------------------------------------
Cavia_porcellus|4694                SVVQDKSSDADWVTEKLNKISYEDHKLKSGTNTKRALQEVYNMMNLAVDSQPGSWNRTRH
Mus_musculus|15374                  RVSDERSSDADWVTEKLNQISYEDHKLKSGTNTKRALQAVYSMMSWAGDAPPEGWNRTRH
Homo_sapiens|2278                   KVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPEGWNRTRH
Pan_troglodytes|17528               KVSDPDSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDIPPEGWNRTRH
Homo_sapiens|85590                  KVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPEGWNRTRH
Homo_sapiens|152636                 KVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPEGWNRTRH
Homo_sapiens|84191                  KVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPEGWNRTRH
Homo_sapiens|1945                   KVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPEGWNRTRH
Homo_sapiens|88746                  KVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPEGWNRTRH
Homo_sapiens|87535                  KVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPEGWNRTRH
                                                                                                

Tarsius_syrichta|7763               XXXXXXXXLHNMGGDPVPVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPLVDQENINAL
Dipodomys_ordii|13398               VIILMTDGLHNMGGDPVTVIDEIRSWLDIGRDRKNPREDYLDVYVFGVGPLVDQDNINAL
Spermophilus_tridecemlineatus|13063 VIILMTDGLYNMGGDPVTIIGEIRDLLDIGRDRKNPREDYLDVYVFGVGPLVDEVNINAL
Tupaia_belangeri|1178               VIILMTDGLHNMGGDPVTVIDEIRNLLDIGRDRKNPREDYLDVYVFGVGPLVDQVNINAL
Oryctolagus_cuniculus|23506         VIILMTDGLHNMGGDPVTVINEIRDLLNIGKDRKNPREDYLDVYVFGVGPLVEPANINAL
Ochotona_princeps|9600              VIILMTDGLHNMGGDPVPVIDQIRDLLNIGRNRKNPREDYLDVYVFGVGPLVEAANINAL
Otolemur_garnettii|8560             --------LHNMGGDPVTVIDEIRDLLNIGRDRKNPREDYLDIYVFGVGPLVDQVNINAL
Cavia_porcellus|4694                VIILMTDGLYNMGGDPVTIIHDIRYLLDIGRDRKNPREDYLDVYVFGVGPLVDQVNINAL
Mus_musculus|15374                  VIIIMTDGLHNMGGNPVTVIQDIRALLDIGRDPKNPREDYLDVYVFGVGPLVDSVNINAL
Homo_sapiens|2278                   VIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPLVNQVNINAL
Pan_troglodytes|17528               VIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPLVNQVNINAL
Homo_sapiens|85590                  VIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPLVNQVNINAL
Homo_sapiens|152636                 VIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPLVNQVNINAL
Homo_sapiens|84191                  VIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPLVNQVNINAL
Homo_sapiens|1945                   VIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPLVNQVNINAL
Homo_sapiens|88746                  VIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPLVNQVNINAL
Homo_sapiens|87535                  VIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPLVNQVNINAL
                                            *:****:*:.:* :**  * **:: *********:*********:  *****

Tarsius_syrichta|7763               ASKKNNEQHVFKVKDMENLEDIFFQMIDETKTLSLCGMVWEHREGTDYHKQPWQAKISVT
Dipodomys_ordii|13398               ASKKENEQHVFRVKDMENLEDVFYQMIDETKSLGLCGMVWEHRKGTDYHKQPWQAKISVT
Spermophilus_tridecemlineatus|13063 ASKKDNERHVFKVKDMENLEDVFYQMIDETQTLGLCGMVWEHRKGTDYHKQPWHAKISVT
Tupaia_belangeri|1178               ASKKEKEQHVFKVRDMN--EDVFYQMIDETKSLGLCGMVWEHKQGTDYHKQPWQAKISVT
Oryctolagus_cuniculus|23506         ASKKENEQHVFRVKDMEHLEDVFFQMIDESQSLGLCGMVWEHREGTDYHKQPWHAKISVT
Ochotona_princeps|9600              ASKKDNEQHVFRVKDMENLEDVFYQMIDETKSLGLCGMVWEHREGTDYHKQPWHAKISIT
Otolemur_garnettii|8560             ASKKDNEQHVFKVKDMENLEDVFFQMIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Cavia_porcellus|4694                ASKKDGEQHVFKVRDMEHLEDVFFQMIDESQALGLCGMVWEHRKGTDYHKHPWQAKISVT
Mus_musculus|15374                  ASKKDNEHHVFKVKDMEDLENVFYQMIDETKSLSLCGMVWEHKKGNDYHKQPWQAKISVT
Homo_sapiens|2278                   ASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVI
Pan_troglodytes|17528               ASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVI
Homo_sapiens|85590                  ASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVI
Homo_sapiens|152636                 ASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVI
Homo_sapiens|84191                  ASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVI
Homo_sapiens|1945                   ASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVI
Homo_sapiens|88746                  ASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVI
Homo_sapiens|87535                  ASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVI
                                    ****: *:***:*:**:  *::*:***                                 

Tarsius_syrichta|7763               XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Dipodomys_ordii|13398               RPLKGHENCMGAVVSEYFVLTAAHCFTVDDEKHSIKVSVGGRKRDLEVEEVLFHPNYNIN
Spermophilus_tridecemlineatus|13063 RPLKGHENCMGAVVSEYFVLTAAHCFTVDDQKHSIKVSVXXXXXXXXXXXXXXXXXXXXX
Tupaia_belangeri|1178               RPLKGHENCMGAVVSEYFVLTAAHCFTVEDQKHSIKVSVGGKRKDLEVEEVLFHPNYNIN
Oryctolagus_cuniculus|23506         RPQKGHENCMGAVVSEYFVLTAAHCFTVDDQKHSIKVSVGGKRRDLEVEEVLFHANYNIN
Ochotona_princeps|9600              RPQKGHETCMGAVVSEYFVLTAAHCFTVDDQAHSIKISIGGKRRDLEVEEVLVHPKYNIN
Otolemur_garnettii|8560             XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQRRELEVEEVLFHPNYNIN
Cavia_porcellus|4694                RPQKGHENCMGAVVSEYFVLTAAHCFTVEDQKHSIKVNVGGKRQDLEIEEVLFHPKYNIN
Mus_musculus|15374                  RPLKGHETCMGAVVSEYFVLTAAHCFMVDDQKHSIKVSVGGQRRDLEIEEVLFHPKYNIN
Homo_sapiens|2278                   RPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNIN
Pan_troglodytes|17528               RPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNIN
Homo_sapiens|85590                  RPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNIN
Homo_sapiens|152636                 RPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNIN
Homo_sapiens|84191                  RPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNIN
Homo_sapiens|1945                   RPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNIN
Homo_sapiens|88746                  RPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNIN
Homo_sapiens|87535                  RPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNIN
                                                                                                

Tarsius_syrichta|7763               XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXE
Dipodomys_ordii|13398               GKTAQGIPEFYDYDVALIKLKKRLTYDQTV--RPICLPCTEGTTRALRLPQTATCQQHKE
Spermophilus_tridecemlineatus|13063 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tupaia_belangeri|1178               GKKAAGIPEFYDYDVALIKLKNKLHYDQTL--RPICLPCTEGTTRALRLPPTTTXXXXXX
Oryctolagus_cuniculus|23506         GKKAEGIPEFYDYDVALVKLKSKLTYSQTLRNRPICLPCTEGTTRALRLPQSTTCQQHKE
Ochotona_princeps|9600              GKNAEGIPEFYDYDVALVKLKTKLMYSQTL--RPICLPCTEGATRALRLPQSATCQQHRQ
Otolemur_garnettii|8560             GKKAEGIPEFYDYDVALVKLKNKLKYGQTL--RPICLPCTEGTTRALRLPQTTTCQQHNE
Cavia_porcellus|4694                AKKEQGILEFYDYDVALVKLKNKVTFSQTL--RPVCLPCTLGTTRALRLPPTATCRQHKE
Mus_musculus|15374                  GKKAEGIPEFYDYDVALVKLKNKLKYGQTL--RPICLPCTEGTTRALRLPQTATCKQHKE
Homo_sapiens|2278                   GKKEAGIPEFYDYDVALIKLKNKLKYGQTI--RPICLPCTEGTTRALRLPPTTTCQQQKE
Pan_troglodytes|17528               GKKAAGIPEFYDYDVALIKLKNKLKYGQTI--RPICLPCTEGTTRALRLPPTTTCQQQKE
Homo_sapiens|85590                  GKEEAGIPEFYDYDVALIKLKNKLKYGQTI--RPICLPCTEGTTRALRLPPTTTCQQQKE
Homo_sapiens|152636                 GKKEAGIPEFYDYDVALIKLKNKLKYGQTI--RPICLPCTEGTTRALRLPPTTTCQQQKE
Homo_sapiens|84191                  GKKEAGIPEFYDYDVALIKLKNKLKYGQTI--RPICLPCTEGTTRALRLPPTTTCQQQKE
Homo_sapiens|1945                   GKKEAGIPEFYDYDVALIKLKNKLKYGQTI--RPICLPCTEGTTRALRLPPTTTCQQQKE
Homo_sapiens|88746                  GKKEAGIPEFYDYDVALIKLKNKLKYGQTI--RPICLPCTEGTTRALRLPPTTTCQQQKE
Homo_sapiens|87535                  GKKEAGIPEFYDYDVALIKLKNKLKYGQTI--RPICLPCTEGTTRALRLPPTTTCQQQKE
                                                                                                

Tarsius_syrichta|7763               VLLPAKNIKALFVSEEKKKLTRKEVYIKNGDKKASCEKDALRAPGYDKVKDVSEVVTPQF
Dipodomys_ordii|13398               ELLPAKDIKALFVSEEEKKLTRKHVFIKNGDKKASCERDAQNAPGYDKVKDISEVVTPRF
Spermophilus_tridecemlineatus|13063 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tupaia_belangeri|1178               XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Oryctolagus_cuniculus|23506         ELLPAKNVKALFVSEEEKKLTRKEVYIKNGDKKASCERDAQYAPGYDKVKDISAVVTPRF
Ochotona_princeps|9600              ELLPAKDVKAFFVSEEERKLTRREVYIKNGDKKASCERDAQYAPGYSKVKDISEVVTPRF
Otolemur_garnettii|8560             -LLPAMDVKALFVSEE-KKLTRKEVYIKNGDKKASCERDAQYAPGYDKVKDISEVVTPRF
Cavia_porcellus|4694                ELLPAKDVKALFISEEQKKLTRKEVYIKNGEKKAGCEQDAKHATGYDKIKDISEVVTPRF
Mus_musculus|15374                  QLLPVKDVKALFVSEQGKSLTRKEVYIKNGDKKASCERDATKAQGYEKVKDASEVVTPRF
Homo_sapiens|2278                   ELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRF
Pan_troglodytes|17528               ELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRF
Homo_sapiens|85590                  ELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRF
Homo_sapiens|152636                 ELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRF
Homo_sapiens|84191                  ELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRF
Homo_sapiens|1945                   ELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRF
Homo_sapiens|88746                  ELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRF
Homo_sapiens|87535                  ELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRF
                                                                                                

Tarsius_syrichta|7763               LCTGGVDPYADHNTCRGDSGGPLIIHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARD
Dipodomys_ordii|13398               LCTGGVDPYADPNTCRGDSGGPLIIHKRSRFIQVGVISWGVVDVCKHQK--KQVPAHARD
Spermophilus_tridecemlineatus|13063 XXXXXXXPYADPNTCKGDSGGPLIIHKKSRFIQVGVISWGVVDVCKDHRLQQQVPAHARD
Tupaia_belangeri|1178               XXXXXXXXXXXXXXXXXXXXGPLIIHKRSRFIQVGVISWGVVDVCKNQRREQQVPAHARD
Oryctolagus_cuniculus|23506         LCTGGVDPYADPNTCRGDSGGPLIIHKRSRFIQVGVISWGVVDVCKDHKRRLQAPAYARD
Ochotona_princeps|9600              LCTGGSDPYADPNTCRGDSGGPLIIHKRSRFIQVGVISWGVVDVCKGQKRYKQVPAHARD
Otolemur_garnettii|8560             LCTGGANPYADPNTCRGDSGGPLIIHKRSRFIQIGIISWGVVDVCKNQRRQRQAPAHARD
Cavia_porcellus|4694                LCTGGVDPYDDPNTCKGDSGGPLIIHKRSRFIQVGVISWGVVDVCYHRKRQQRVPAYARD
Mus_musculus|15374                  LCTGGVDPYADPNTCKGDSGGPLIVHKRSRFIQVGVISWGVVDVCRDQRRQQLVPSYARD
Homo_sapiens|2278                   LCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARD
Pan_troglodytes|17528               LCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARD
Homo_sapiens|85590                  LCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARD
Homo_sapiens|152636                 LCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARD
Homo_sapiens|84191                  LCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARD
Homo_sapiens|1945                   LCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARD
Homo_sapiens|88746                  LCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARD
Homo_sapiens|87535                  LCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARD
                                                        ****:**:*****:*:*********  ::    .*::***

Tarsius_syrichta|7763               FHINLFQVLPWLKEKLKDEDLGFL
Dipodomys_ordii|13398               FHVNLFQVLPWLKEKLKDEDLGFL
Spermophilus_tridecemlineatus|13063 FHVNLFQVLPWLKEKLKDEDLGFL
Tupaia_belangeri|1178               FHINLFHVLPWLKEKLKDEDLEFL
Oryctolagus_cuniculus|23506         FHINLFQVLPWLKDKLKDEDLGFL
Ochotona_princeps|9600              FHINLFQVLPWLKDKLKDEDLGFL
Otolemur_garnettii|8560             FHINLFQVLPWLKEKLKDEDLDFL
Cavia_porcellus|4694                FHVNLFQVLPWLKEKLKDENLDFL
Mus_musculus|15374                  FHINLFQVLPWLKDKLKDEDLGFL
Homo_sapiens|2278                   FHINLFQVLPWLKEKLQDEDLGFL
Pan_troglodytes|17528               FHINLFQVLPWLKEKLQDEDLGFL
Homo_sapiens|85590                  FHINLFQVLPWLKEKLQDEDLGFL
Homo_sapiens|152636                 FHINLFQVLPWLKEKLQDEDLGFL
Homo_sapiens|84191                  FHINLFQVLPWLKEKLQDEDLGFL
Homo_sapiens|1945                   FHINLFQVLPWLKEKLQDEDLGFL
Homo_sapiens|88746                  FHINLFQVLPWLKEKLQDEDLGFL
Homo_sapiens|87535                  FHINLFQVLPWLKEKLQDEDLGFL
                                    **:***:******:**:**:* **