Orthologs Set ID: EOG4003GJ


Orthology Database
OrthoDB4
Gene Symbol(s)
PFKL

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 9145 159, 237, 427, 593, 638, 747, 843, 936, 1062, 1127, 1191, 1338, 1409, 1497, 1650, 1815, 1877, 1989, 2089, 2195
Cavia porcellus 24350 159, 237, 427, 593, 638, 747, 843, 936, 1062, 1127, 1191, 1338, 1409, 1497, 1650, 1815, 1877, 1989, 2089, 2195
Dipodomys ordii 14371 36, 74, 85, 144, 159, 237, 427, 593, 638, 747, 843, 936, 1062, 1127, 1191, 1338, 1409, 1497, 1650, 1815, 1877, 1989, 2089, 2195
Gorilla gorilla 3743 85, 159, 237, 427, 593, 638, 747, 843, 936, 1062, 1127, 1191, 1338, 1409, 1497, 1650, 1815, 1877, 1989, 2089, 2195
Homo sapiens 56280 85, 159, 237, 427, 593, 638, 747, 843, 936, 1062, 1127, 1191, 1338, 1409, 1497, 1650, 1815, 1877, 1989, 2089, 2195
Mus musculus 3401 85, 159, 237, 427, 593, 638, 747, 843, 936, 1062, 1127, 1191, 1338, 1409, 1497, 1650, 1815, 1877, 1989, 2089, 2195
Ochotona princeps 8288 237, 427, 593, 638, 747, 843, 936, 1062, 1127, 1191, 1280, 1338, 1409, 1497, 1650, 1815, 1877, 1941, 1989, 2089
Pan troglodytes 21918 85, 159, 237, 427, 593, 638, 732, 747, 843, 936, 1062, 1127, 1191, 1338, 1409, 1497, 1650, 1815, 1877, 1989, 2089, 2195
Rattus norvegicus 20594 85, 159, 237, 427, 593, 638, 747, 843, 936, 1062, 1127, 1191, 1338, 1409, 1497, 1650, 1815, 1877, 1989, 2089, 2195
Tupaia belangeri 16906 159, 237, 427, 453, 468, 474, 480, 501, 510, 522, 534, 549, 561, 570, 582, 593, 638, 747, 843, 936, 1062, 1127, 1191, 1338, 1409, 1497, 1650, 1815, 1877, 1989, 2089

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 9145 ENSCJAT00000024356 100393627 ENSCJAG00000017630 PFKL calJac3
Cavia porcellus 24350 ENSCPOT00000026310 100720033 ENSCPOG00000019438 PFKL cavPor3
Dipodomys ordii 14371 ENSDORT00000007006 ENSDORG00000007006 Pfkl dipOrd1
Gorilla gorilla 3743 ENSGGOT00000031154 101131129 ENSGGOG00000005687 PFKL gorGor3
Homo sapiens 56280 ENST00000349048 5211 ENSG00000141959 PFKL hg19,GRCh37
Mus musculus 3401 ENSMUST00000020522 18641 ENSMUSG00000020277 Pfkl mm9
Ochotona princeps 8288 ENSOPRT00000001808 ENSOPRG00000001792 PFKL OchPri2.0
Pan troglodytes 21918 ENSPTRT00000045146 458602 ENSPTRG00000022972 PFKL panTro2
Rattus norvegicus 20594 ENSRNOT00000001625 25741 ENSRNOG00000001214 Pfkl rn4
Tupaia belangeri 16906 ENSTBET00000016907 ENSTBEG00000016861 PFKL tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 2061 ENSCJAP00000023021 100393627 ENSCJAG00000017630 PFKL calJac3
Cavia porcellus 19302 ENSCPOP00000020281 100720033 ENSCPOG00000019438 PFKL cavPor3
Dipodomys ordii 13493 ENSDORP00000006568 ENSDORG00000007006 Pfkl dipOrd1
Gorilla gorilla 3543 ENSGGOP00000019823 101131129 ENSGGOG00000005687 PFKL gorGor3
Homo sapiens 75245 ENSP00000269848 5211 ENSG00000141959 PFKL hg19,GRCh37
Mus musculus 42108 ENSMUSP00000020522 18641 ENSMUSG00000020277 Pfkl mm9
Ochotona princeps 7222 ENSOPRP00000001668 ENSOPRG00000001792 PFKL OchPri2.0
Pan troglodytes 2316 ENSPTRP00000040215 458602 ENSPTRG00000022972 PFKL panTro2
Rattus norvegicus 14597 ENSRNOP00000001625 25741 ENSRNOG00000001214 Pfkl rn4
Tupaia belangeri 14666 ENSTBEP00000014699 ENSTBEG00000016861 PFKL tupBel1

multiple sequence alignment in CLUSTALW format


Tupaia_belangeri|16906  ------------------------------------------------------------
Ochotona_princeps|8288  ------------------------------------------------------------
Dipodomys_ordii|14371   ---------------TGGGACTCATGGAACCTGAGTGGCCACGAATCCTCTCCAGGTCAC
Callithrix_jacchus|9145 ------------------------------------------------------------
Gorilla_gorilla|3743    ATGGCCGCGGTGGACCTGGAGAAGCTGCGGGCGTCGGGCGCGGGCAAGGCCATCGGCGTC
Homo_sapiens|56280      ATGGCCGCGGTGGACCTGGAGAAGCTGCGGGCGTCGGGCGCGGGCAAGGCCATCGGCGTC
Pan_troglodytes|21918   ATGGCCGCGGTGGACCTGGAGAAGCTGCGGGCGTCGGGCGCGGGCAAGGCCATCGGCGTC
Cavia_porcellus|24350   ------------------------------------------------------------
Mus_musculus|3401       ATGGCTACCGTGGACCTGGAGAAACTGCGGATGTCGGGGGCTGGCAAGGCCATTGGAGTG
Rattus_norvegicus|20594 ATGGCTACCGTGGACCTGGAGAAGTTGCGGATGTCGGGGGCTGGCAAGGCCATCGGAGTG
                                                                                    

Tupaia_belangeri|16906  ---------------------------ATGAATGCTGCCGTCAGGGCTGTGACACGCATG
Ochotona_princeps|8288  ------------------------------------------------------------
Dipodomys_ordii|14371   GATGCGGATCTTCAGGTTCACAGGAGTATGAATGCCGCGGTCAGGGCTGTGACGCGCATG
Callithrix_jacchus|9145 ------------------------GGCATGAATGCTGCTGTCCGGGCTGTGACGCGCATG
Gorilla_gorilla|3743    CTGACCAGCGGCGGCGACGCGCAAGGCATGAACGCTGCTGTCCGGGCTGTGACGCGCATG
Homo_sapiens|56280      CTGACCAGCGGCGGCGACGCGCAAGGCATGAACGCTGCTGTCCGGGCTGTGACGCGCATG
Pan_troglodytes|21918   CTGACCAGCGGCGGCGACGCGCAAGGCATGAACGCTGCTGTCCGGGCTGTGACGCGCATG
Cavia_porcellus|24350   ---------------------GCAGGTATGAACGCTGCCGTGAGGGCTGTGACCCGCATG
Mus_musculus|3401       CTGACCAGCGGCGGTGATGCGCAAGGTATGAATGCTGCTGTCAGGGCTGTGACCCGTATG
Rattus_norvegicus|20594 CTGACAAGCGGCGGTGACGCGCAAGGTATGAATGCTGCTGTCAGGGCTGTGACTCGTATG
                                                                                    

Tupaia_belangeri|16906  GGCATCTACGTGGGAGCCAAAGTCTTCCTCATCTATGAGNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|8288  ---------------------------------------GGCTATGAGGGCCTGGTGGAA
Dipodomys_ordii|14371   GGCATTTACGTGGGAGCCAAAGTC---CTAATCTATGAGGGCTATGAGGGCCTCGTGGAA
Callithrix_jacchus|9145 GGCATTTATGTGGGTGCCAAAGTCTTCCTCATCTACGAGGGATACGAGGGCCTCGTGGAG
Gorilla_gorilla|3743    GGCATTTATGTGGGTGCCAAAGTCTTCCTCATCTACGAGGGCTATGAGGGCCTCGTGGAG
Homo_sapiens|56280      GGCATTTATGTGGGTGCCAAAGTCTTCCTCATCTACGAGGGCTATGAGGGCCTCGTGGAG
Pan_troglodytes|21918   GGCATTTATGTGGGTGCCAAAGTCTTCCTCATCTACGAGGGCTATGAGGGCCTCGTGGAG
Cavia_porcellus|24350   GGCATATATGTGGGCGCCAAGGTGTTCCTCATCTATGAGGGCTATGAGGGCCTCGTGGAG
Mus_musculus|3401       GGCATATATGTGGGGGCCAAAGTCTTCCTCATCTATGAGGGCTACGAGGGCCTTGTGGAA
Rattus_norvegicus|20594 GGCATATATGTGGGGGCCAAAGTCTTCCTCATCTACGAGGGCTACGAGGGCCTCGTGGAA
                                                               .. .  . ...  . ....  

Tupaia_belangeri|16906  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGT
Ochotona_princeps|8288  GGTGGCGAGAACATTCAACAGGCCAGCTGGCTCAGCGTCTCCAACATCATTCAGCTGGGT
Dipodomys_ordii|14371   GGAGGTGAGAATATCAAGCCAGCCAACTGGCTCAGCGTCTCCAACATCATCCAGCTGGGA
Callithrix_jacchus|9145 GGAGGTGAGAACATCAAGCAGGCCAACTGGCTGAGCGTCTCCAACATCATCCAGCTGGGT
Gorilla_gorilla|3743    GGAGGTGAGAACATCAAGCAGGCCAACTGGCTGAGCGTCTCCAACATCATCCAGCTGGGC
Homo_sapiens|56280      GGAGGTGAGAACATCAAGCAGGCCAACTGGCTGAGCGTCTCCAACATCATCCAGCTGGGC
Pan_troglodytes|21918   GGAGGTGAGAACATCAAGCAGGCCAACTGGCTGAGCGTCTCCAACATCATCCAGCTGGGC
Cavia_porcellus|24350   GGAGGTGAGAACATCAAGCCGGCCACCTGGCTCAGCGTCTCCAACATCATCCAGCTGGGT
Mus_musculus|3401       GGAGGCGAGAACATCAAGCCAGCCAACTGGCTCAGCGTTTCCAATATCATCCAGCTGGGT
Rattus_norvegicus|20594 GGAGGCGAGAACATCAAGCCAGCCAACTGGCTCAGTGTCTCCAACATCATCCAGCTGGGC
                        .. .. . .    .       .     ... .  . .. .      .  .   . ..** 

Tupaia_belangeri|16906  GGCACAGTCATCGGCAGCGCCCGCTGCAAGGCCTTCACCACGCGGGAGGGACGCCTGGCA
Ochotona_princeps|8288  GGCACAATCATTGGCAGTGCCCGCTGCAAGGCCTTCACCACGCGGGAGGGCCGCCGCGCC
Dipodomys_ordii|14371   GGCACCATCATTGGCAGTGCCCGCTGCAAGGCCTTCACCACCAGGGAGGGGCGCCGGGCG
Callithrix_jacchus|9145 GGCACTGTCATTGGCAGCGCCCGATGCAAGGCCTTTACCACCCGGGAGGGCCGCCGGGCA
Gorilla_gorilla|3743    GGCACTATCATTGGCAGCGCTCGCTGTAAGGCCTTTACCACCAGGGAGGGGCGCCGGGCA
Homo_sapiens|56280      GGCACTATCATTGGCAGCGCTCGCTGCAAGGCCTTTACCACCAGGGAGGGGCGCCGGGCA
Pan_troglodytes|21918   GGCACTATCATTGGCAGCGCTCGCTGCAAGGCCTTTACCACCAGGGAGGGGCGCCGGGCA
Cavia_porcellus|24350   GGCACTATTATCGGCAGCGCCCGCTGCCAGGCTTTCACCACGCGGGAGGGGCGCCGGGCG
Mus_musculus|3401       GGCACCATTATTGGCAGTGCCCGCTGTAAGGCCTTCACTACGAGGGAAGGCCGCCTGGCT
Rattus_norvegicus|20594 GGCACCATCATTGGCAGTGCCCGCTGTAAGGCCTTCACTACGAGGGAAGGGCGCCTGGCA
                        ***** .* ** ***** ** **.** .**** ** ** ** .****.** ****  ** 

Tupaia_belangeri|16906  GCGGCCTACAACCTGGTCCAGCGTGGCATCACCAACCTGTGCGTCATCGGGGGGGACGGC
Ochotona_princeps|8288  GCGGCCTACAACCTGGTGCAGCGTGGCATCACCAACCTGTGTGTCATCGGCGGCGACGGC
Dipodomys_ordii|14371   GCGGCCTACAACCTTCTGCAGCATGGCATCACCAACCTGTGCGTCATCGGCGGGGATGGC
Callithrix_jacchus|9145 GCGGCCTACAACCTGGTCCAGCGTGGCATCACCAACCTGTGCGTCATTGGCGGGGACGGC
Gorilla_gorilla|3743    GCGGCCTACAACCTGGTCCAGCACGGCATCACCAACCTGTGCGTCATCGGCGGGGATGGC
Homo_sapiens|56280      GCGGCCTACAACCTGGTCCAGCACGGCATCACCAACCTGTGCGTCATCGGCGGGGATGGC
Pan_troglodytes|21918   GCGGCCTACAACCTGGTCCAGCACGGCATCACCAACCTGTGCGTCATCGGCGGGGATGGC
Cavia_porcellus|24350   GCCGCCTACAACCTGGTGCAGCGTGGCATCACCAACCTGTGTGTCATCGGCGGCGATGGC
Mus_musculus|3401       GCAGCCTACAATCTGCTCCAACACGGCATCACCAACCTGTGTGTCATCGGTGGCGACGGC
Rattus_norvegicus|20594 GCGGCCTACAATCTGCTCCAACACGGCATCACCAACCTGTGTGTCATCGGTGGGGATGGC
                        ** ******** **  * **.*. ***************** ***** ** ** ** ***

Tupaia_belangeri|16906  AGCCTCACGGGTGCCAACATCTTCCGCAGCGAGTGGGGCGGCTTGCTGGAAGAGCTGGCC
Ochotona_princeps|8288  AGCCTCACGGGTGCCAACATCTTCCGCAGCGAGTGGGGCAGCCTGCTGGAGGAGCTGGTA
Dipodomys_ordii|14371   AGCCTCACGGGCGCCAACGTCTTCCGCAGCGAGTGGGGCAGCCTGCTGGAGGAGCTGGTG
Callithrix_jacchus|9145 AGCCTCACAGGTGCCAACATCTTCCGCAGCGAGTGGGGTAGCCTGCTGGAGGAGCTGGTG
Gorilla_gorilla|3743    AGCCTCACGGGTGCCAACATCTTCCGCAGCGAGTGGGGCAGCCTGCTGGAGGAGCTGGTG
Homo_sapiens|56280      AGCCTCACAGGTGCCAACATCTTCCGCAGCGAGTGGGGCAGCCTGCTGGAGGAGCTGGTG
Pan_troglodytes|21918   AGCCTCACGGGTGCCAACATCTTCCGCAGCGAGTGGGGCAGCCTGCTGGAGGAGCTGGTG
Cavia_porcellus|24350   AGCCTCACTGGTGCCAACATCTTCCGCAGCGAGTGGGGCGGTCTGCTGGAGGAGCTGGTG
Mus_musculus|3401       AGCCTCACGGGGGCCAACATCTTCCGCAACGAGTGGGGCAGCTTGCTGGAGGAGCTGGTG
Rattus_norvegicus|20594 AGCCTCACGGGGGCCAACATCTTCCGCAACGAGTGGGGCAGCTTGCTGGAGGAACTGGTG
                        ******** ** ******.*********.********* .*  *******.**.****  

Tupaia_belangeri|16906  CGGGAAGGTAAGATCTCAGAGGCCACGACCAGA---TACTCACACCTGATTGCGCTCGTG
Ochotona_princeps|8288  CAGGAAGGGAAGATCTCGGAGAGCACGGCCCAGACCTACTCGCACCTGAACATTGCCGGC
Dipodomys_ordii|14371   AAGGAGGGGAAGATCTCAGAGACCACAGCCCAGACCTACTCCCACCTGAACATCGCGGGA
Callithrix_jacchus|9145 GCGGAAGGTAAGATCTCCGAGTCCACGGCCCGCACCTACTCGCACCTGAACATCGCCGGC
Gorilla_gorilla|3743    GCGGAAGGTAAGATCTCAGAGACTACGGCCCGGACCTACTCACACCTGAACATCGCGGGC
Homo_sapiens|56280      GCGGAAGGTAAGATCTCAGAGACTACAGCCCGGACCTACTCGCACCTGAACATCGCGGGC
Pan_troglodytes|21918   GCGGAAGGTAAGATCTCAGAGACTACGGCCCGGACCTACTCGCACCTGAACATCGCGGGC
Cavia_porcellus|24350   AGGGAAGGCAAGATCTCGGAAACCACGGCTCAGACCTACTCACACCTGAACATCGCGGGG
Mus_musculus|3401       AAGGAAGGCAAGATCTCAGAGTCCACAGCTCAGAACTACGCACACTTGACCATCGCCGGT
Rattus_norvegicus|20594 AAGGAAGGCAAGATCTCAGAGTCCACAGCTCAGAACTACGCACACTTGAGCATCGCCGGT
                          ***.** ******** **.   **..* ..    *** * *** ***  .     *  

Tupaia_belangeri|16906  CTCATC------------GATGACTTCTGC---ACTGACATGATCGTCGACTCG------
Ochotona_princeps|8288  CTGGTGGGCTCCATCGACAACGACTTCTGTGGCACCGACATGACCATTGGCACCGACTCG
Dipodomys_ordii|14371   CTCGTCGGCTCCATCGACAATGACTTCTGTGGCACGGACATGACGATCGGCACCGACTCG
Callithrix_jacchus|9145 CTGGTAGGCTCCATCGACAATGACTTCTGCGGCACCGACATGACCATCGGCACCGACTCG
Gorilla_gorilla|3743    CTAGTGGGCTCCATCGATAACGACTTCTGCGGCACCGACATGACCATTGGCACGGACTCG
Homo_sapiens|56280      CTAGTGGGCTCCATCGATAACGACTTCTGCGGCACCGACATGACCATCGGCACGGACTCG
Pan_troglodytes|21918   CTAGTGGGCTCCATTGATAACGACTTCTGCGGCACCGACATGACCATTGGCACGGACTCG
Cavia_porcellus|24350   CTTGTGGGCTCCATCGACAATGACTTCTGCGGCACTGACATGACCATCGGCACTGACTCA
Mus_musculus|3401       CTGGTGGGCTCCATCGATAACGACTTCTGTGGCACTGACATGACCATTGGCACAGACTCA
Rattus_norvegicus|20594 CTGGTGGGCTCCATCGACAACGACTTCTGCGGCACCGACATGACCATCGGCACGGACTCG
                        ** .*             .* ********    ** *******  .* *.*:*       

Tupaia_belangeri|16906  ---TTGCAC------ATCATGGTCATCGAC------ATCACCACTGCCCAGAGTCACCAG
Ochotona_princeps|8288  GCCCTGCACCGCATTATGGAGGTGATTGATGCCATCACCACCACGGCCCAGAGCCACCAG
Dipodomys_ordii|14371   GCCCTGCACCGCATCATGGAGGTCATCGATGCCATCACCACCACGGCCCAGAGNNNNNNN
Callithrix_jacchus|9145 GCCCTGCACCGCATCATGGAGGTCATCGACGCCATCACCACCACCGCCCAGAGCCACCAG
Gorilla_gorilla|3743    GCCCTCCACCGCATCATGGAGGTCATCGATGCCATCACCACCACTGCCCAGAGCCACCAG
Homo_sapiens|56280      GCCCTCCACCGCATCATGGAGGTCATCGATGCCATCACCACCACTGCCCAGAGCCACCAG
Pan_troglodytes|21918   GCCCTCCACCGCATCATGGAGGTCATCGATGCCATCACCACCACTGCCCAGAGCCACCAG
Cavia_porcellus|24350   GCCCTGCACCGCATCATGGAGGTCATCGATGCCATCACCACCACGGCCCAGAGCCACCAG
Mus_musculus|3401       GCCCTGCACCGCATTATGGAGGTCATTGACGCCATCACTACCACTGCCCAAAGTCACCAG
Rattus_norvegicus|20594 GCCCTGCACCGGATCATGGAGGTCATCGACGCCATCACCACCACTGCCCAGAGCCACCAG
                            * ***      ** .:*** ** **       *  ***** *****.**      .

Tupaia_belangeri|16906  AGAACCTTTGTGCTGGAGGTGATGGGCCGGCACTGTGGGTACCTGGCACTGGTGTCTGCA
Ochotona_princeps|8288  AGGACCTTCGTGCTGGAGGTGATGGGGCGGCACTGCGGGTACCTGGCGCTGGTGTCCGCG
Dipodomys_ordii|14371   NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTACCTGGCGCTGGTGTCCGCC
Callithrix_jacchus|9145 AGGACCTTTGTGCTGGAGGTGATGGGCCGGCACTGTGGGTACCTGGCGCTGGTGTCTGCA
Gorilla_gorilla|3743    AGGACCTTCGTGCTGGAAGTGATGGGCCGGCACTGTGGGTACCTGGCGCTGGTATCTGCA
Homo_sapiens|56280      AGGACCTTCGTGCTGGAAGTGATGGGCCGGCACTGCGGGTACCTGGCGCTGGTATCTGCA
Pan_troglodytes|21918   AGGACCTTCGTGCTGGAAGTGATGGGCCGGCACTGCGGGTACCTGGCGCTGGTATCTGCA
Cavia_porcellus|24350   AGGACATTTGTGCTGGAGGTGATGGGGCGGCACTGTGGGTACCTGGCACTGGTGTCTGCA
Mus_musculus|3401       AGGACCTTTGTTTTGGAGGTGATGGGACGGCACTGCGGGTACCTGGCGCTGGTGTCTGCC
Rattus_norvegicus|20594 AGGACCTTTGTGTTGGAGGTGATGGGACGGCACTGCGGGTACCTGGCGCTGGTGTCTGCG
                         .    .. ..  ...  ... ....  ..   .. ..*********.*****.** ** 

Tupaia_belangeri|16906  CTGGCCTCAGGGGCCGACTGGCTGTTCATCCCCGAGGCGCCCCCTGAGGATGGCTGGGAG
Ochotona_princeps|8288  CTGGCCTCGGGGGCCGACTGGCTGTTCATCCCGGAGGCGCCCCCCGAGGATGGCTGGGAG
Dipodomys_ordii|14371   CTGGCCTCCGGGGCCGACTGGCTGTTCATTCCGGAGGCGCCCCCCGAGGACGGCTGGGAG
Callithrix_jacchus|9145 CTGGCCTCGGGGGCCGACTGGCTCTTCATCCCTGAGTCCCCGCCTGAGGATGGCTGGGAG
Gorilla_gorilla|3743    CTGGCCTCGGGGGCCGACTGGCTGTTCATCCCCGAGGCTCCACCCGAGGACGGCTGGGAG
Homo_sapiens|56280      CTGGCCTCAGGGGCCGACTGGCTGTTCATCCCCGAGGCTCCACCCGAGGACGGCTGGGAG
Pan_troglodytes|21918   CTGGCCTCAGGGGCCGACTGGCTGTTCATCCCCGAGGCTCCACCCGAGGACGGCTGGGAG
Cavia_porcellus|24350   CTGGCCTCGGGTGCCGACTGGCTGTTCATCCCTGAGGCACCCCCTGAGGATGGCTGGGAG
Mus_musculus|3401       CTGGCTTCCGGGGCTGATTGGCTATTCATTCCTGAAGCGCCCCCTGAGGATGGCTGGGAG
Rattus_norvegicus|20594 CTGGCCTCCGGGGCTGATTGGCTGTTCATCCCTGAAGCGCCCCCGGAGGATGGCTGGGAG
                        ***** ** ** ** ** ***** ***** ** **. * ** ** ***** *********

Tupaia_belangeri|16906  AACTTCATGTGTGAGAGGCTTGGCGAGACTCGGAGCCGAGGGTCCCGGCTGAACATCATC
Ochotona_princeps|8288  AATTTCATGTGTGAGCGTCTGGGTGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|14371   AACTTCATGTGTGAGAGGCTGGGGGAGACTCGAAGCCGGGGGTCCCGGCTAAACATCATC
Callithrix_jacchus|9145 AACTTCATGTGCGAGAGGCTGGGTGAGACTCGAAGCCGAGGGTCCCGACTGAACATCATC
Gorilla_gorilla|3743    AACTTCATGTGCGAGAGGCTGGGTGAGACTCGGAGCCGTGGGTCCCGACTGAACATCATC
Homo_sapiens|56280      AACTTCATGTGTGAGAGGCTGGGTGAGACTCGGAGCCGTGGGTCCCGACTGAACATCATC
Pan_troglodytes|21918   AACTTCATGTGCGAGAGGCTGGGTGAGACTCGGAGCCGTGGGTCCCGACTGAACATCATC
Cavia_porcellus|24350   AACTTCATGTGTGAGAGGCTGGGTGAGACCCGCAGCCGCGGCTCCCGTCTGAACATCATC
Mus_musculus|3401       AACTTCATGTGTGAGAGGCTGGGCGAGACTCGGAGCCGAGGCTCTCGGCTGAACATCATC
Rattus_norvegicus|20594 AACTTCATGTGTGAGAGGCTGGGGGAGACTCGGAGCCGGGGGTCTCGACTGAACATCATC
                        ** ******** ***.* ** ** ***    .  .  . .. .   .  .     .  . 

Tupaia_belangeri|16906  ATCATCGCCGAGGGTGCCATTGACCGCCAAGGGAAGCCCATCTCGTCCAGCTACGTGAAG
Ochotona_princeps|8288  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCTACGTGAAG
Dipodomys_ordii|14371   ATCATCGCAGAGGGCGCCATCGACCGCAACGGGAAGCCCATCTCGTCCAGCTACGTGAAG
Callithrix_jacchus|9145 ATCATCGCCGAGGGCGCCATCGACCGCAACGGGAAGCCCATCTTGTCCAGCTACGTGAAG
Gorilla_gorilla|3743    ATTATCGCTGAGGGTGCCATTGACCGCAACGGGAAGCCCATCTCGTCCAGCTACGTGAAG
Homo_sapiens|56280      ATCATCGCTGAGGGTGCCATTGACCGCAACGGGAAGCCCATCTCGTCCAGCTACGTGAAG
Pan_troglodytes|21918   ATTATCGCTGAGGGTGCCATTGACCGCAACGGGAAGCCCATCTCGTCCAGCTACGTGAAG
Cavia_porcellus|24350   ATCATCGCAGAGGGTGCCATCGACCGCCACGGGAAGCCCATCTCATCCAGCTACGTGAAG
Mus_musculus|3401       ATCATCGCAGAGGGTGCCATTGACCGGCATGGAAAGCCTATCTCATCCAGCTACGTGAAG
Rattus_norvegicus|20594 ATCATCGCGGAGGGTGCCATCGACCGGCATGGAAAGCCTATCTCATCCAGCTACGTGAAA
                         .  . .  . ... .   . .   .    ..   .    . .  .   **********.

Tupaia_belangeri|16906  GACCTGGTGGTCCAGAGGCTGGGCTTCGACACACGGGTGACTGTGCTGGGCCATGTGCAG
Ochotona_princeps|8288  GATCTGGTGGTGCAGAGGCTGGGCTTTGACACTCGGGTCACCGTGCTGGGCCATGTGCAG
Dipodomys_ordii|14371   GACCTTGTGGTTCAGAGACTGGGCTTCGACACACGGGTGACCGTGCTGGGGCACGTGCAG
Callithrix_jacchus|9145 GACCTGGTGGTTCAGAGGCTGGGCTTTGACACCCGAGTGACCGTGCTGGGCCATGTGCAG
Gorilla_gorilla|3743    GACCTGGTGGTTCAGAGGCTGGGCTTCGACACCCGTGTAACTGTGCTGGGCCACGTGCAG
Homo_sapiens|56280      GACCTGGTGGTTCAGAGGCTGGGCTTCGACACCCGTGTAACTGTGCTGGGCCACGTGCAG
Pan_troglodytes|21918   GACCTGGTGGTTCAGAGGCTGGGCTTCGACACCCGTGTAACTGTGCTGGGCCACGTGCAG
Cavia_porcellus|24350   GACCTGGTGGTCCAGAGGTTGGGCTTTGACACACGAGTGACCGTGCTGGGCCATGTCCAG
Mus_musculus|3401       GATCTGGTGGTTCAGAGGCTGGGCTTCGATACACGAGTGACTGTGCTGGGTCATGTACAG
Rattus_norvegicus|20594 GACCTGGTGGTTCAGAGGCTGGGCTTCGATACACGAGTGACCGTGCTGGGCCACGTACAG
                        ** ** ***** *****. ******* ** ** ** ** ** ******** ** ** ***

Tupaia_belangeri|16906  AGAGGGGGCACTCCCTCGGCCTTTGACCGTGTCCTGAGCAGCAAGATGGGCATGGAGGCC
Ochotona_princeps|8288  CGAGGAGGGACCCCGTCTGCCTTCGACCGTGTCCTGAGCAGCAAGATGGGCATGGAGGCG
Dipodomys_ordii|14371   CGCGGAGGGACCCCCTCAGCCTTCGACCGCATCCTGAGCAGCAAGATGGGCATGGAGGCC
Callithrix_jacchus|9145 CGGGGAGGGACACCCTCTGCCTTCGACCGAGTCCTGAGCAGCAAGATGGGCATGGAGGCA
Gorilla_gorilla|3743    CGGGGAGGGACGCCCTCTGCCTTCGACCGAATCCTGAGCAGCAAGATGGGCATGGAGGCG
Homo_sapiens|56280      CGGGGAGGGACGCCCTCTGCCTTCGACCGGATCCTGAGCAGCAAGATGGGCATGGAGGCG
Pan_troglodytes|21918   CGGGGAGGGACGCCCTCTGCCTTCGACCGAATCCTGAGCAGCAAGATGGGCATGGAGGCG
Cavia_porcellus|24350   CGCGGCGGGACACCTTCGGCCTTTGACCGGATCCTGAGCAGCAAGATGGGCATAGAGGCC
Mus_musculus|3401       CGAGGAGGGACGCCTTCAGCCTTCGACCGAATCCTGAGTAGCAAGATGGGTATGGAGGCC
Rattus_norvegicus|20594 CGAGGAGGGACACCCTCAGCCTTTGACCGAGTCCTGAGTAGCAAGATGGGTATGGAGGCC
                        .* ** ** ** ** ** ***** ***** .******* *********** **.***** 

Tupaia_belangeri|16906  GTGATGGCGCTGCTGGAGGCCACGCCCGACACGCCAGCCTGCGTGGTCAGCCTTTCTGGA
Ochotona_princeps|8288  GTGATGGCACTGCTGGAGGCCACTCCCGACACGCCGGCCTGTGTAGTCAGCCTGTCGGGG
Dipodomys_ordii|14371   GTGATGGCCCTGCTGGAGGCCACGCCTGACACGCCAGCCTGCGTGGTCAGCCTCTCGGGG
Callithrix_jacchus|9145 GTGATGGCGCTGCTGGAGGCCACGCCCGACACGCCGGCCTGCGTGGTCAGCCTCTCGGGG
Gorilla_gorilla|3743    GTGATGGCACTGCTGGAAGCCACGCCTGACACGCCGGCCTGCGTGGTCACCCTCTCGGGG
Homo_sapiens|56280      GTGATGGCGCTGCTGGAAGCCACGCCTGACACGCCGGCCTGCGTGGTCACCCTCTCGGGG
Pan_troglodytes|21918   GTGATGGCGCTGCTGGAAGCCACGCCTGACACGCCAGCCTGCGTGGTCACCCTCTCGGGG
Cavia_porcellus|24350   GTGATGGCGCTGCTGGAGGCCACGCCTGACACGCCTGCCTGTGTGGTCAGCCTCTCAGGG
Mus_musculus|3401       GTGATGGCGCTGCTAGAGGCCACGCCTGACACGCCGGCCTGTGTGGTCAGCCTCTCCGGG
Rattus_norvegicus|20594 GTGATGGCGCTGCTGGAGGCCACGCCGGACACGCCGGCCTGCGTGGTCAGCCTCTCCGGG
                        ******** *****.**.***** ** ******** ***** **.**** *** ** **.

Tupaia_belangeri|16906  AACCAGTCGGTGCGGCTGCCCCTCATGGAGTGCGTGCAGGTGNNNNNNNNNNNNNNNNNN
Ochotona_princeps|8288  AACCAGTCTGTGCGGCTGCCACTCATGGAGTGTGTGCAAGTGACCAAAGAGGTGCAGAAG
Dipodomys_ordii|14371   AACCAGTCGGTGCGGCTGCCCCTCATGGAGTGCGTGCAGGTGACCAAGGAGGTGCAGAAG
Callithrix_jacchus|9145 AACCAGTCGGTGCGGCTGCCCCTCATGGAGTGCGTGCAGATGACCAAGGAAGTGCAGAAA
Gorilla_gorilla|3743    AACCAGTCAGTGCGGCTGCCCCTCATGGAGTGCGTGCAGATGACCAAGGAAGTGCAGAAA
Homo_sapiens|56280      AACCAGTCAGTGCGGCTGCCCCTCATGGAGTGCGTGCAGATGACCAAGGAAGTGCAGAAA
Pan_troglodytes|21918   AACCAGTCAGTGCGGCTGCCCCTCATGGAGTGTGTGCAGATGACCAAGGAAGTGCAAAAA
Cavia_porcellus|24350   AACCAGTCGGTGCGACTGCCCCTCATGGAGTGTGTGCAGGTGACAAAGGATGTGCAGAAG
Mus_musculus|3401       AACCAGTCTGTGAGGCTACCTCTCATGGAGTGTGTGCAAGTGACAAAGGACGTGCAGAAG
Rattus_norvegicus|20594 AATCAGTCTGTGCGGCTGCCTCTCATGGAGTGTGTGCAAGTGACGAAGGATGTGCAGAAG
                        ** ***** ***.*.**.** *********** *****..**      .  ...      

Tupaia_belangeri|16906  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGCTTCGAGAAC
Ochotona_princeps|8288  GCCATGGACGAGAGGCGGTTTGACGAAGCCATCCAGCTCCGTGGCAGGAGCTTTGAGAAC
Dipodomys_ordii|14371   GCCATGGACGACAAGAGGTTTGACGAGGCCATCCAGCTCCGTGGCAGGAGCTTCGAGAAC
Callithrix_jacchus|9145 GCCATGGACGACAAGAGGTTTGACGAGGCCATCCAGCTCCGCGGCAGGAGCTTCGAGAAC
Gorilla_gorilla|3743    GCCATGGATGACAAGAGGTTTGACGAGGCCACCCAGCTCCGTGGCGGGAGCTTTGAGAAC
Homo_sapiens|56280      GCCATGGATGACAAGAGGTTTGACGAGGCCACCCAGCTCCGTGGTGGGAGCTTCGAGAAC
Pan_troglodytes|21918   GCCATGGATGACAAGAGGTTTGACGAGGCCACCCAGCTCCGTGGCGGGAGCTTCGAGAAC
Cavia_porcellus|24350   GCCATGGACGACAGGAGGTTTGAGGAGGCCATCCAGCTGCGTGGCAGGAGCTTCGAGAAC
Mus_musculus|3401       GCCATGGACGAGGAGAGGTTTGACGAGGCCATCCAGCTCCGTGGCAGGAGCTTTGAGAAC
Rattus_norvegicus|20594 GCCATGGATGAGAAGAGGTTTGACGAGGCCATCCAGCTCCGTGGCAGGAGCTTCGAGAAC
                        .   ...  .    . ......  .  .       . .  . ..  .****** ******

Tupaia_belangeri|16906  AACTGGAACATTTACAAGCTCCTTGCCCACCAGAAGCTCTCCAAGGAGAAGACCAACTTC
Ochotona_princeps|8288  AACTGGAACATGTACAAACTGCTGGCCCACCAGAAACTGTCCAAAGAGAAGNNNNNNNNN
Dipodomys_ordii|14371   AACTGGAACATTTACAAGCTGCTGGCCCATCAGAAGATCTCCAAGGAGAAGAGCAGCTTC
Callithrix_jacchus|9145 AACTGGAACATTTACAAGCTCCTCGCCCACCAGAAGCTCTCCAAGGAGAAGTCCAACTTC
Gorilla_gorilla|3743    AACTGGAACATTTACAAGCTCCTCGCCCACCAGAAGCCCCCCAAGGAGAAGTCTAACTTC
Homo_sapiens|56280      AACTGGAACATTTACAAGCTCCTCGCCCACCAGAAGCCCCCCAAGGAGAAGTCTAACTTC
Pan_troglodytes|21918   AACTGGAACATTTACAAGCTCCTCGCCCACCAGAAGCCCCCTAAGGAGAAGTCTAACTTC
Cavia_porcellus|24350   AACTGGAACATTTACAAGCTCCTCGCCCACCAGAAGGTCTCCAAGGAGAAGACCAACTTC
Mus_musculus|3401       AACTGGAAAATTTACAAGCTCCTTGCCCACCAGAAGGTGTCTAAAGAGAAGTCCAACTTC
Rattus_norvegicus|20594 AACTGGAAAATTTACAAGCTCCTCGCCCACCAGAAGGTGTCTAAGGAGAAGTCCAACTTC
                        ********.** *****.** ** ***** *****.    * **.******      .. 

Tupaia_belangeri|16906  TCCTTGGCCATCCTGAATGTGGGGGCCCCAGCAGCGGGCATGAATGCAGCTGTGCGCTCA
Ochotona_princeps|8288  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|14371   TCGCTGGCCATCCTGAACGTGGGCGCCCCTGCGGCCGGCATGAACGCGGCCGTGCGCTCG
Callithrix_jacchus|9145 TCCCTGGCCATCCTGAACGTGGGGGCCCCGGCGGCCGGCATGAACGCTGCCGTGCGCTCA
Gorilla_gorilla|3743    TCCCTGGCCATCCTGAATGTGGGGGCCCCGGCGGCTGGCATGAATGCGGCTGTGCGCTCG
Homo_sapiens|56280      TCCCTGGCCATCCTGAATGTGGGGGCCCCGGCGGCTGGCATGAATGCGGCCGTGCGCTCG
Pan_troglodytes|21918   TCCCTGGCCATCCTGAATGTGGGGGCCCCGGCGGCTGGCATGAATGCGGCCGTGCGCTCG
Cavia_porcellus|24350   TCCCTGGCCATCCTGAACGTGGGGGCCCCGGCAGCTGGCATGAACGCTGCCGTGCGCTCA
Mus_musculus|3401       TCCCTGGCCATCCTGAATGTGGGGGCTCCAGCTGCTGGCATGAATGCAGCTGTGCGCTCC
Rattus_norvegicus|20594 TCCCTGGCCATCCTGAATGTGGGAGCTCCAGCGGCCGGCATGAACGCAGCCGTGCGCTCC
                        .   ...   .  ..   ..... .     .  .  ..  ..   .  .  ... . .  

Tupaia_belangeri|16906  GCAGTGCGGACTGGCATTTCCCAGGGCCACACAGTGTACGTCGTGCATGATGGCTTTGAG
Ochotona_princeps|8288  NNNNNNNNNNNNNNNNNNNNCCAGGGCCACACCGTGTATGTGGTGCACGACGGCTTCGAG
Dipodomys_ordii|14371   GCGGTGAGGACCGGCATCTCCCAGGGCCACACGGTGTACGTTGTGCACGATGGCTTTGAA
Callithrix_jacchus|9145 GCGGTGCGGACCGGAATCTCCCAGGGCCACACGGTCTATGTCGTGCACGATGGCTTCGAA
Gorilla_gorilla|3743    GCGGTGCGGACCGGCATCTCCCATGGACACACAGTATACGTGGTGCACGATGGCTTCGAA
Homo_sapiens|56280      GCGGTGCGGACCGGCATCTCCCATGGACACACAGTATACGTGGTGCACGATGGCTTCGAA
Pan_troglodytes|21918   GCGGTGCGGACCGGCATCTCCCACGGACACACAGTATACGTGGTGCATGATGGCTTCGAA
Cavia_porcellus|24350   GCGGTGCGGACTGGCATCTCCCAGGGCCACACGGTGTACGTGGTGCACGACGGCTTTGAG
Mus_musculus|3401       GCAGTGCGCACTGGTATCTCCGAGGGACACACGGTATACATCGTGCATGATGGCTTTGAG
Rattus_norvegicus|20594 GCGGTACGCACTGGCATCTCCGAGGGACACACAGTGTACGTTGTGCATGATGGCTTTGAG
                        .  ..  .    ..  . . * * **.***** ** ** .* ***** ** ***** **.

Tupaia_belangeri|16906  GGCCTGGCCAAGGGTCAGGTGCAAGTGGTGGGCTGGCATGATGTGGCTGGCTGGTTGGGA
Ochotona_princeps|8288  GGCCTGGTCAAGGGGCAGGTGCAAGAGGTCAGCTGGCACGATGTGGCTGGCTGGCTGGGC
Dipodomys_ordii|14371   GGCCTAGCCAAGGGTCAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Callithrix_jacchus|9145 GGCCTGGCCAAGGGTCAGGTGCAAGAAGTGGGCTGGCACGACGTGGCTGGCTGGTTGGGG
Gorilla_gorilla|3743    GGCCTAGCCAAGGGTCAGGTACAAGAAGTAGGCTGGCACGACGTGGCCGGCTGGTTGGGG
Homo_sapiens|56280      GGCCTAGCCAAGGGTCAGGTGCAAGAAGTAGGCTGGCACGACGTGGCCGGCTGGTTGGGG
Pan_troglodytes|21918   GGCCTAGCCAAGGGTCAGGTGCAAGAAGTGGGCTGGCACGACGTGGCCGGCTGGTTGGGG
Cavia_porcellus|24350   GGCCTAGCCAAAGGCCAGGTGCAGGAAGTGGGTTGGCATGATGTGGCCGGCTGGCTAGGG
Mus_musculus|3401       GGTCTGGCCAAGGGTCAGGTGCAAGAAGTGGGCTGGCATGATGTGGCAGGCTGGCTGGGA
Rattus_norvegicus|20594 GGCCTGGCCAAGGGTCAGGTGCAAGAAGTGGGCTGGCATGATGTGGCAGGTTGGCTGGGA
                        ** **.* ***.** ***..    .  ..  . ...   .  ....  .. ... . .. 

Tupaia_belangeri|16906  CGAGGCGGCTCCATGCTGGGCACTAAGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|8288  CGCGGTGGCTCCATGCTGGGGACCAAGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|14371   NNNNNNNNNNNNNNNNNNNNNNNNNNNNNGACGCTGCCTAGAGCCCACCTAGAGTCTATC
Callithrix_jacchus|9145 CGTGGTGGCTCCATGCTGGGGACCAAGAGGACCCTGCCCAAGGGCCACCTGGAGTCCATC
Gorilla_gorilla|3743    CGTGGTGGCTCCATGCTGGGGACCAAGAGGACCCTGCCCAAGGGCCAGCTGGAGTCCATT
Homo_sapiens|56280      CGTGGTGGCTCCATGCTGGGGACCAAGAGGACCCTGCCCAAGGGCCAGCTGGAGTCCATT
Pan_troglodytes|21918   CGTGGTGGCTCCATGCTGGGGACCAAGAGGACCCTGCCCAAGGGCCAGCTGGAGTCCATC
Cavia_porcellus|24350   CGTGGTGGCTCCATGTTGGGCACCAAGAGGACACTGCCCAAGGGCCACATGGAGGCCATC
Mus_musculus|3401       CGTGGTGGCTCGATGCTGGGGACCAAGAGGACACTGCCCAAGCCCCACCTGGAGGCCATT
Rattus_norvegicus|20594 CGTGGTGGCTCAATGCTGGGGACCAAGAGGACCCTGCCCAAGCCCCACCTGGAGGCCATT
                         . .. .. .   .. ....      . ..    ..             . . .    . 

Tupaia_belangeri|16906  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|8288  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCC
Dipodomys_ordii|14371   GTGGAGAACCTGCGCACCTACAACATCCACGCCCTGCTTGTCATCGGCGGGTTCGAGGCC
Callithrix_jacchus|9145 GTGGAGAACATCCGCACCTACGGCATCCATGCCCTGCTGGCCGTCGGCGGGTTTGAGGCC
Gorilla_gorilla|3743    GTGGAGAACGTCCGCATCTATGGTATTCACGCCCTGCTGGTGGTCGGCGGGTTTGAGGCC
Homo_sapiens|56280      GTGGAGAACATCCGCATCTATGGTATTCACGCCCTGCTGGTGGTCGGTGGGTTTGAGGCC
Pan_troglodytes|21918   GTGGAGAACATCCGCATCTATGGTATTCACGCCCTGCTGGTGGTTGGCGGGTTCGAGGCC
Cavia_porcellus|24350   GTGGAGAATCTCCGGGCACACAACATCCATGCCCTGCTGGTCATTGGCGGATTTGAGGCT
Mus_musculus|3401       GTGGAGAATCTCCGCACCTACAACATCCACGCCCTGCTGGTGATTGGTGGCTTTGAGGCC
Rattus_norvegicus|20594 GTAGAAAATCTCCGTACCTACAACATTCATGCCCTGTTGGTGATCGGTGGCTTTGAGGCC
                        .. .      .  .           .    .   .. . .   . .. .. .. . ..  

Tupaia_belangeri|16906  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|8288  TATGAGGGCGTGCTGCAGCTGGTGGAGGCCCGGGGCCGCTACGAGGAGCTGTGCATTGTC
Dipodomys_ordii|14371   TACGAGGGTGTGCTGCAGCTGGTAGAAGCTAGAGAGCGCTACGAGGAACTCTGCATCGTC
Callithrix_jacchus|9145 TATGAGGGGGTGCTGCAGCTGGTGGAGGCACGTGGGCGTTACGAGGAACTCTGCATCGTC
Gorilla_gorilla|3743    TATGAAGGGGTGCTGCAGCTGGTGGAGGCTCGCGGGCGCTACGAGGAGCTCTGCATCGTC
Homo_sapiens|56280      TATGAAGGGGTGCTGCAGCTGGTGGAGGCTCGCGGGCGCTACGAGGAGCTCTGCATCGTC
Pan_troglodytes|21918   TATGAAGGGGTGCTGCAGCTGGTGGAGGCTCGCGGGCGCTACGAGGAGCTCTGCATCGTC
Cavia_porcellus|24350   TATGAGGGGGTGCTGCAGCTGGTGGAGGCGCGTGGGCGCTATGAGGAACTGTGCATCGTC
Mus_musculus|3401       TACGAGGGTGTGCTGCAGCTGGTGGAGGCCCGGGGGCGCTACGAGGAACTCTGCATTGTC
Rattus_norvegicus|20594 TACGAGGGTGTGCTGCAGCTGGTGGAGGCTAGGGGGCGCTACGAGGAACTCTGTATCGTC
                        .  .  .. ... ..  . .... .  .   . .   . .  . ..   . ..  . .. 

Tupaia_belangeri|16906  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|8288  ATGTGTGTGGTCCCCGCCACCATCAGCAACAACGTGCCCGGCACGGACTTCAGCCTGGGC
Dipodomys_ordii|14371   ATGTGCGTCATCCCAGCCACCATCAGCAACAACGTGCCCGGCACCGACTTCAGCCTGGGC
Callithrix_jacchus|9145 ATGTGCGTCATCCCGGCCACCATCAGCAACAACGTCCCTGGCACTGACTTCAGCCTGGGC
Gorilla_gorilla|3743    ATGTGTGTCATCCCAGCCACCATCAGCAACAACGTCCCTGGCACCGACTTCAGCCTGGGC
Homo_sapiens|56280      ATGTGTGTCATCCCAGCCACCATCAGCAACAACGTCCCTGGCACCGACTTCAGCCTGGGC
Pan_troglodytes|21918   ATGTGTGTCATCCCAGCCACCATCAGCAACAACGTCCCTGGCACCGACTTCAGCCTGGGC
Cavia_porcellus|24350   ATGTGCGTCATCCCTGCCACCATCAGCAATAACGTGCCGGGCACCGACTTCAGCCTGGGC
Mus_musculus|3401       ATGTGTGTCATCCCAGCCACCATCAGCAACAATGTGCCTGGCACTGACTTCAGCCTGGGC
Rattus_norvegicus|20594 ATGTGCGTCATCCCAGCCACCATCAGCAACAATGTCCCTGGCACTGACTTCAGCCTGGGC
                         .... ..  .    .      .  .       ..    ..    .  ..  .  .... 

Tupaia_belangeri|16906  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGCTGTGACCGCATCAAGCAATCAGCCTCA
Ochotona_princeps|8288  TCGGACACCGCCGTGAACGCAGCCATGGAGAGCTGTGACCGCATCAAGCAGTCGGCCTCG
Dipodomys_ordii|14371   TCGGACACGGCCGTCAACGCCGCCATGGAGAGCTGTGATCGCATCAAGCAGTCGGCCTCT
Callithrix_jacchus|9145 TCCGATACCGCTGTCAACGCCGCCATGGAGAGCTGTGACCGCATCAAGCAGTCCGCCTCG
Gorilla_gorilla|3743    TCCGACACTGCTGTAAATGCCGCCATGGAGAGCTGTGACCGCATCAAACAGTCCGCCTCG
Homo_sapiens|56280      TCCGACACTGCTGTAAATGCCGCCATGGAGAGCTGTGACCGCATCAAACAGTCTGCCTCG
Pan_troglodytes|21918   TCTGACACTGCTGTAAATGCCGCCATGGAGAGCTGTGACCGCATCAAACAGTCCGCCTCG
Cavia_porcellus|24350   TCAGACACGGCGGTCAATGCTGCCATGGAGAGCTGCGACCGCATCAAGCAGTCAGCCTCG
Mus_musculus|3401       TCAGACACGGCTGTCAACGCTGCAATGGAGAGTTGTGATCGCATCAAGCAGTCAGCCTCA
Rattus_norvegicus|20594 TCGGACACGGCCGTCAACGCTGCAATGGAGAGTTGTGACCGCATCAAACAATCGGCCTCG
                        .  .     .  ..    .  .   ... .** ** ** ********.**.** ***** 

Tupaia_belangeri|16906  GGGACCAAGCGCCGCGTGTTCATCGTGGAGACCATGGGGGGCTACTGCGGCTACCTGGCC
Ochotona_princeps|8288  GGCACCAAGCGCCGTGTGTTCATCGTGGAGACCATGGGCGGCTACTGCGGCTACCTGGCC
Dipodomys_ordii|14371   GGGACCAAGCGCCGCGTGTTCATCGTGGAGACCATGGGCGGCTACTGCGGGTACCTGGCC
Callithrix_jacchus|9145 GGGACCAAGCGCCGCGTGTTCGTCGTGGAGACCATGGGGGGTTACTGCGGCTACCTGGCC
Gorilla_gorilla|3743    GGGACCAAGCGCCGTGTGTTCATCGTGGAGACCATGGGGGGTTACTGTGGCTACCTGGCC
Homo_sapiens|56280      GGGACCAAGCGCCGTGTGTTCATCGTGGAGACCATGGGGGGTTACTGTGGCTACCTGGCC
Pan_troglodytes|21918   GGGACCAAGCGCCGTGTGTTCATCGTGGAGACCATGGGGGGTTACTGTGGCTACCTGGCC
Cavia_porcellus|24350   GGCACCAAGCGCCGTGTATTCATTGTGGAGACCATGGGGGGCTACTGCGGCTACCTGGCC
Mus_musculus|3401       GGGACAAAGCGGCGTGTGTTCATTGTAGAGACCATGGGGGGCTACTGTGGCTACCTGGCT
Rattus_norvegicus|20594 GGGACAAAGCGGCGTGTGTTCATTGTAGAGACCATGGGGGGCTACTGTGGCTACCTGGCC
                        ** **.***** ** **.***.* **.*********** ** ***** ** ******** 

Tupaia_belangeri|16906  ACGGTGACTGGCATTGCTGTAGGGGCTGACGCCGCCTATGTCTTTGAGGATCCTTTCAAC
Ochotona_princeps|8288  ACTGTGACAGGCATCGCCGTGGGTGCTGATGCTGCTTATGTCTTCGAAGACCCTTTCAAC
Dipodomys_ordii|14371   ACGGTGACCGGCATCGCCGTGGGGGCCGACGCCGCCTATGTCTTTGAGGACCCTTTCAAC
Callithrix_jacchus|9145 ACGGTGACTGGCATTGCCGTGGGGGCCGACGCCGCCTACGTCTTCGAGGACCCCTTCAAT
Gorilla_gorilla|3743    ACCGTGACTGGCATTGCTGTGGGGGCCGACGCCGCCTACGTCTTCGAGGACCCTTTCAAC
Homo_sapiens|56280      ACCGTGACTGGCATTGCTGTGGGGGCCGACGCCGCCTACGTCTTCGAGGACCCTTTCAAC
Pan_troglodytes|21918   ACCGTGACTGGCATTGCTGTGGGGGCCGACGCCGCCTACGTCTTTGAGGACCCTTTCAAC
Cavia_porcellus|24350   ACTGTGACCGGCATTGCTGTGGGCGCCGATGCTGCTTATGTCTTCGAGGACCCTTTCAAC
Mus_musculus|3401       ACTGTGACCGGCATTGCTGTGGGTGCCGATGCTGCCTACGTCTTTGAGGACCCTTTCAAC
Rattus_norvegicus|20594 ACTGTGACAGGCATTGCTGTGGGCGCCGATGCCGCCTACGTCTTTGAGGACCCTTTCAAC
                        ** ***** ***** ** **.** ** ** ** ** ** ***** **.** ** ***** 

Tupaia_belangeri|16906  ATCCATGACTTAAAGGCCAACGTGGAGCACATGACAGAGAAGATGAAGACAGACATCCAG
Ochotona_princeps|8288  ATTCACGACTTAAAGGCCAACGTGGAACACATGACAGAGAAGATGAAGACAGACATCCAG
Dipodomys_ordii|14371   ATCCACGACTTGAAAGCCAACGTGGAGCACATGACGGAGAAGATGAAGACGGACATCCAG
Callithrix_jacchus|9145 ATCCATGACTTAAAGGCCAATGTGGAGCACATGACGGAGAAGATGAAGACGGACATTCAG
Gorilla_gorilla|3743    ATCCATGACTTAAAGGTCAACGTGGAGCACATGACAGAGAAGATGAAGACAGACATTCAG
Homo_sapiens|56280      ATCCACGACTTAAAGGTCAACGTGGAGCACATGACGGAGAAGATGAAGACAGACATTCAG
Pan_troglodytes|21918   ATCCATGACTTAAAGGTCAACGTGGAGCACATGACGGAGAAGATGAAGACAGACATTCAG
Cavia_porcellus|24350   ATTCATGACCTCGAGGCCAATGTGGAGCACATGACGGAGAAGATGAAGACGGACATCCAG
Mus_musculus|3401       ATCCATGACTTAAAGGCCAATGTGGAGCATATGACAGAGAAGATGAAGACAGACATCCAG
Rattus_norvegicus|20594 ATCCACGACTTGAAGGCCAATGTGGAGCATATGACAGAGAAGATGAAGACAGACATCCAG
                        ** ** *** * .*.* *** *****.** *****.**************.***** ***

Tupaia_belangeri|16906  AGGGGCCTGGTGCTCCGCAACGAGAAGTGCCATGAACACTACAGCACAGAGTTCCTGTAC
Ochotona_princeps|8288  AGGGGCCTGGTGCTCCGGAATGAGAAATGCCATGACTACTACACCACGGAATTCCTCTAC
Dipodomys_ordii|14371   AGGGGCCTGGTGCTGCGAAACGAGAAATGCCACGAGCACTACACCACGGAGTTCCTGTAC
Callithrix_jacchus|9145 AGGGGCCTGGTGCTGCGGAACGAGAAGTGCCACGACCATTATACCACGGAGTTCCTGTAC
Gorilla_gorilla|3743    AGGGGCCTGGTGCTGCGGAACGAGAAGTGCCATGACTACTACACCACGGAGTTCCTGTAC
Homo_sapiens|56280      AGGGGCCTGGTGCTGCGGAACGAGAAGTGCCATGACTACTACACCACGGAGTTCCTGTAC
Pan_troglodytes|21918   AGGGGCCTGGTGCTGCGGAACGAGAAGTGCCATGACTACTACACCACAGAGTTCCTGTAC
Cavia_porcellus|24350   AGGGGCCTGGTGCTGCGGAACGAGAAGTGTCATGAGCACTACACCACGGAGTTCCTGTAC
Mus_musculus|3401       AGGGGACTGGTGCTCCGGAACGAGAAGTGTCACGAACACTACACCACAGAGTTCCTATAC
Rattus_norvegicus|20594 AGGGGCCTGGTGCTCCGGAACGAGAAGTGTCACGAACACTACACCACGGAATTCCTATAC
                        *****.******** ** ** *****.** ** **  * ** * ***.**.***** ***

Tupaia_belangeri|16906  AACCTCTACTCGTCAGAGGGCAAAGGCGTCTTTGACTGTCGGACCAACGTCCTGGGTCAC
Ochotona_princeps|8288  AACCTGTACTCCTCGGAGGGC---GGTGTCTTTGACTGTAGGACCAACGTCCTGGGCCAC
Dipodomys_ordii|14371   CACCTGTATTCCTCCGAAGGCAGGGGCGTGTTTGACTGCCGGACCAACGTGCTGGGCCAT
Callithrix_jacchus|9145 AACCTCTACTCCTCAGAGGGCAAGGGCGTCTTCGACTGCAGGACCAATGTGCTGGGCCAT
Gorilla_gorilla|3743    AACCTGTACTCATCAGAGGGCAAGGGCGTGTTCGACTGCAGGACCAATGTCCTGGGCCAC
Homo_sapiens|56280      AACCTGTACTCATCAGAGGGCAAGGGCGTCTTCGACTGCAGGACCAATGTCCTGGGCCAC
Pan_troglodytes|21918   AACCTGTACTCATCAGAGGGCAAGGGTGTGTTCGACTGCAGGACCAACGTCCTGGGCCAC
Cavia_porcellus|24350   AACCTGTACTCGTCGGAGGGCAAGGGCGTCTTCGACTGCAGGACCAACGTGCTGGGCCAC
Mus_musculus|3401       AACCTGTACTCCTCAGAAGGCAGGGGCGTGTTTGACTGCAGGACCAATGTGCTGGGCCAC
Rattus_norvegicus|20594 AACCTATACTCCTCGGAAGGCAGAGGTGTGTTCGACTGCAGGACCAACGTGCTGGGCCAC
                        .**** ** ** ** **.***   ** ** ** ***** .******* ** ***** ** 

Tupaia_belangeri|16906  CTGCAGCAGGGCGGTGCTCCCACACCCTTCGACCGGAACTACGGGACCAAGCTGGGAGTG
Ochotona_princeps|8288  CTGCAGCAGGGTGGGGCACCTACACCCTTTGACCGCAACTATGGCACGAAGCTGGGCGTG
Dipodomys_ordii|14371   CTCCAGCAGGGTGGAGCTCCAACACCCTTTGACCGGAACTACGGGACCAAGCTAGGGGTG
Callithrix_jacchus|9145 CTGCAGCAGGGTGGCGCTCCGACCCCCTTTGACCGGAACTATGGCACCAAGCTGGGGGTG
Gorilla_gorilla|3743    CTGCAGCAGGGTGGCGCTCCAACCCCCTTTGACCGGAACTACGGGACCAAGCTGGGGGTG
Homo_sapiens|56280      CTGCAGCAGGGTGGCGCTCCAACCCCCTTTGACCGGAACTATGGGACCAAGCTGGGGGTG
Pan_troglodytes|21918   CTGCAGCAGGGTGGCGCTCCAACCCCCTTTGACCGGAACTACGGGACCAAGCTGGGGGTG
Cavia_porcellus|24350   CTGCAGCAGGGTGGAGCGCCCACACCCTTTGATCGGAACTATGGGACCAAGCTGGGGGTG
Mus_musculus|3401       TTGCAGCAGGGTGGTGCTCCAACCCCTTTCGACCGGAACTATGGGACCAAACTGGGGGTG
Rattus_norvegicus|20594 CTGCAGCAGGGTGGCGCTCCAACCCCCTTCGACCGGAACTATGGGACCAAACTGGGGGTG
                         * ******** ** ** ** **.** ** ** ** ***** ** ** **.**.** ***

Tupaia_belangeri|16906  AAGGCCATGCTCTGGATGTCAGAGAAGCTTCGGGCTGTCTACCGCAAGGGGCGGGTGTTT
Ochotona_princeps|8288  AAGGCAATGCTGTGGGTGTCGGAGATGCTGCGGGCTGTGTACCGCAAGGGCCGGGTCTTT
Dipodomys_ordii|14371   AAGGCCATGCTCTGGATGTCGGAGAAGCTGCGGGCCGTCTACCGCAAGGGGCGCGTGTTC
Callithrix_jacchus|9145 AAGGCCATGCTCTGGGTGTCGGAGAAGCTTCGTGAGGTTTACCGCAAGGGACGAGTGTTC
Gorilla_gorilla|3743    AAGGCCATGCTGTGGTTGTCGGAGAAGCTGCGTGAGGTTTACCGCAAGGGACGGGTGTTC
Homo_sapiens|56280      AAGGCCATGCTGTGGTTGTCGGAGAAGCTGCGCGAGGTTTACCGCAAGGGACGGGTGTTC
Pan_troglodytes|21918   AAGGCCATGCTGTGGTTGTCGGAGAAGCTGCGCGAGGTTTACCGCAAGGGACGGGTGTTC
Cavia_porcellus|24350   AAGGCCATGCTTTGGATGTCAGACAAGCTGCAGGCTGTCTACCGCAAGGGGCGGGTGTTT
Mus_musculus|3401       AAGGCCATGTTGTGGGTGTCTGAGAAGCTACGTGATGTCTACCGTAAAGGGCGGGTGTTT
Rattus_norvegicus|20594 AAGGCCATGTTGTGGATGTCGGAGAAGCTGCGTGATGTCTACCGCAAAGGGCGGGTGTTT
                        *****.*** * *** **** ** *:*** *. *. ** ***** **.** ** ** ** 

Tupaia_belangeri|16906  GCCAACGCGCCCGACTCAGCCTGTGTGATCGGCCTGCAGAAGAAGACAGTGGCCTTCAGC
Ochotona_princeps|8288  GCCAACGCGCCCGACTCGGCCTGTGTGATCGGTCTGCGCAAGAAGGCGGTGGCCTTCAGC
Dipodomys_ordii|14371   GCCAACGCACCGGACTCGGCCTGCGTGATCGGCCTTCGGAAGAAGGCGGTGGCCTTCAGC
Callithrix_jacchus|9145 GCCAATGCCCCAGACTCTGCCTGTGTGATCGGCCTGAAGAAGAAGGCAGTGGCCTTCAGC
Gorilla_gorilla|3743    GCCAATGCCCCAGACTCGGCCTGCGTGATCGGCCTGAAGAAGAAGGCGGTGGCCTTCAGC
Homo_sapiens|56280      GCCAATGCCCCAGACTCGGCCTGCGTGATCGGCCTGAAGAAGAAGGCGGTGGCCTTCAGC
Pan_troglodytes|21918   GCCAATGCCCCAGACTCGGCCTGCGTGATCGGCCTGAAGAAGAAGGCGGTGGCCTTCAGC
Cavia_porcellus|24350   GCTAATGCCCCGGACTCGGCCTGCGTGATTGGCCTGCGGAAGAAGGTGGTGGCCTTCAGC
Mus_musculus|3401       GCCAATGCTCCAGACTCAGCCTGTGTGATCGGCCTGCGGAAGAAGGTAGTGGCCTTCAGT
Rattus_norvegicus|20594 GCCAATGCTCCGGACTCAGCCTGTGTGATCGGCCTGAGGAAGAAGGTGGTGGCCTTCAGT
                        ** ** ** ** ***** ***** ***** ** ** .. ******. .*********** 

Tupaia_belangeri|16906  CCTGTCACAGAACTCAAGAAAGACACCGACTTC---------------------------
Ochotona_princeps|8288  CCTGTCACCGAGCTCAAGAAGGACACAGACTTC---------------------------
Dipodomys_ordii|14371   CCTGTCACTGAGCTCAAGAAGGACACAGACTTTGACCACCGCATGCCCCGGGAGCAGTGG
Callithrix_jacchus|9145 CCCGTCACTGAGCTCAAGAAAGACACTGACTTCGAGCACCGCATGCCGCGGGAGCAGTGG
Gorilla_gorilla|3743    CCCGTCACTGAGCTCAAGAAAGACACTGATTTCGAGCACCGCATGCCGCGGGAGCAGTGG
Homo_sapiens|56280      CCCGTCACTGAGCTCAAGAAAGACACTGATTTCGAGCACCGCATGCCACGGGAGCAGTGG
Pan_troglodytes|21918   CCCGTCACTGAGCTCAAGAAAGATACTGATTTCGAGCACCGCATGCCACGGGAGCAGTGG
Cavia_porcellus|24350   CCTGTCACAGAGCTCAAGGAGGACACAGATTTCGAGCACCGAATGCCACGGGAGCAGTGG
Mus_musculus|3401       CCGGTCACAGAACTCAAGAAAGAGACTGATTTTGAGCACCGCATGCCCCGGGAGCAGTGG
Rattus_norvegicus|20594 TCGGTCACAGAACTCAAGAAAGAGACAGATTTTGAGCACCGTATGCCGCGGGAGCAGTGG
                         * ***** **.******.*.** ** ** **                            

Tupaia_belangeri|16906  ------------------------------------------------------------
Ochotona_princeps|8288  ------------------------------------------------------------
Dipodomys_ordii|14371   TGGCTGAACCTGCGGCTGATGCTGAAGATGTTGGCGCACTACCGCATCAGCATGGCAGAC
Callithrix_jacchus|9145 TGGCTGAGCCTGCGGCTCATGCTGAAGATGCTGGCGCACTACCGCATCAGCATGGCTGCC
Gorilla_gorilla|3743    TGGCTGAGCCTGAGGCTCATGCTGAAGATGCTGGCACAATACCGCATCAGTATGGCCGCC
Homo_sapiens|56280      TGGCTGAGCCTGCGGCTCATGCTGAAGATGCTGGCACAATACCGCATCAGTATGGCCGCC
Pan_troglodytes|21918   TGGCTGAGCCTGCGGCTCATGCTGAAGATGCTGGCACAATACCGCATCAGTATGGCCGCC
Cavia_porcellus|24350   TGGCTGAACCTGCGGCTGATGCTGAAGATGCTGGCACACTATCACATCAGCATGGCCGAC
Mus_musculus|3401       TGGCTGAATCTGCGGCTGATGCTGAAGATGCTGGCACACTACCGCATCAGCATGGCAGAC
Rattus_norvegicus|20594 TGGCTGAATCTGCGGCTGATGCTGAAGATGTTGGCACACTACCGCATCAGCATGGCCGAC
                                                                                    

Tupaia_belangeri|16906  ------------------------------------------------------------
Ochotona_princeps|8288  ------------------------------------------------------------
Dipodomys_ordii|14371   TACGTGTCCGGCGAGCTGGAGCACGTCACCCGCCGCACCCTGAGCATCGACAAG------
Callithrix_jacchus|9145 TACGTGTCGGGGGAGCTGGAGCACGTGACCCGCCGCACTCTGAGCATGGAGACGGGCTTC
Gorilla_gorilla|3743    TACGTGTCAGGGGAGCTGGAGCACGTGACCCGCCGCACCCTGAGCATGGACAAGGGCTTC
Homo_sapiens|56280      TACGTGTCAGGGGAGCTGGAGCACGTGACCCGCCGCACCCTGAGCATGGACAAGGGCTTC
Pan_troglodytes|21918   TACGTGTCAGGGGAGCTGGAGCACGTGACCCGCCGCACCCTGAGCATGGACAAGGGCTTC
Cavia_porcellus|24350   TATGTGTCGGGGGAGCTGGAGCACGTCACGCGCCGCACGCTTAGCCTGGACACTGGCTTC
Mus_musculus|3401       TATGTGTCTGGGGAGCTGGAGCACGTCACACGCCGCACCTTGAGCATAGACAAGGGTTTC
Rattus_norvegicus|20594 TACGTGTCTGGGGAGCTGGAGCACGTCACACGCCGCACCTTGAGCATAGACAAGGGTTTC
                                                                                    

Tupaia_belangeri|16906  ---
Ochotona_princeps|8288  ---
Dipodomys_ordii|14371   ---
Callithrix_jacchus|9145 TGA
Gorilla_gorilla|3743    TGA
Homo_sapiens|56280      TGA
Pan_troglodytes|21918   TGA
Cavia_porcellus|24350   ---
Mus_musculus|3401       TGA
Rattus_norvegicus|20594 TGA
                           

multiple sequence alignment in CLUSTALW format


Tupaia_belangeri|14666  -----------------------------MNAAVRAVTRMGIYVGAKVFLIYEXXXXXXX
Ochotona_princeps|7222  -----------------------------------------------------GYEGLVE
Dipodomys_ordii|13493   -----WDSWNLSGHESSPGHDADLQVHRSMNAAVRAVTRMGIYVGAKV-LIYEGYEGLVE
Callithrix_jacchus|2061 ----------------------------GMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
Gorilla_gorilla|3543    MAAVDLEKLRASGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
Homo_sapiens|75245      MAAVDLEKLRASGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
Pan_troglodytes|2316    MAAVDLEKLRASGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
Cavia_porcellus|19302   ---------------------------AGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
Mus_musculus|42108      MATVDLEKLRMSGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
Rattus_norvegicus|14597 MATVDLEKLRMSGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
                                                                                    

Tupaia_belangeri|14666  XXXXXXXXXXXXXXXXXXXGGTVIGSARCKAFTTREGRLAAAYNLVQRGITNLCVIGGDG
Ochotona_princeps|7222  GGENIQQASWLSVSNIIQLGGTIIGSARCKAFTTREGRRAAAYNLVQRGITNLCVIGGDG
Dipodomys_ordii|13493   GGENIKPANWLSVSNIIQLGGTIIGSARCKAFTTREGRRAAAYNLLQHGITNLCVIGGDG
Callithrix_jacchus|2061 GGENIKQANWLSVSNIIQLGGTVIGSARCKAFTTREGRRAAAYNLVQRGITNLCVIGGDG
Gorilla_gorilla|3543    GGENIKQANWLSVSNIIQLGGTIIGSARCKAFTTREGRRAAAYNLVQHGITNLCVIGGDG
Homo_sapiens|75245      GGENIKQANWLSVSNIIQLGGTIIGSARCKAFTTREGRRAAAYNLVQHGITNLCVIGGDG
Pan_troglodytes|2316    GGENIKQANWLSVSNIIQLGGTIIGSARCKAFTTREGRRAAAYNLVQHGITNLCVIGGDG
Cavia_porcellus|19302   GGENIKPATWLSVSNIIQLGGTIIGSARCQAFTTREGRRAAAYNLVQRGITNLCVIGGDG
Mus_musculus|42108      GGENIKPANWLSVSNIIQLGGTIIGSARCKAFTTREGRLAAAYNLLQHGITNLCVIGGDG
Rattus_norvegicus|14597 GGENIKPANWLSVSNIIQLGGTIIGSARCKAFTTREGRLAAAYNLLQHGITNLCVIGGDG
                                           ***:******:******** ******:*:************

Tupaia_belangeri|14666  SLTGANIFRSEWGGLLEELAREGKISEATTR-YSHLIALVLI----DDFC-TDMIVDS--
Ochotona_princeps|7222  SLTGANIFRSEWGSLLEELVQEGKISESTAQTYSHLNIAGLVGSIDNDFCGTDMTIGTDS
Dipodomys_ordii|13493   SLTGANVFRSEWGSLLEELVKEGKISETTAQTYSHLNIAGLVGSIDNDFCGTDMTIGTDS
Callithrix_jacchus|2061 SLTGANIFRSEWGSLLEELVAEGKISESTARTYSHLNIAGLVGSIDNDFCGTDMTIGTDS
Gorilla_gorilla|3543    SLTGANIFRSEWGSLLEELVAEGKISETTARTYSHLNIAGLVGSIDNDFCGTDMTIGTDS
Homo_sapiens|75245      SLTGANIFRSEWGSLLEELVAEGKISETTARTYSHLNIAGLVGSIDNDFCGTDMTIGTDS
Pan_troglodytes|2316    SLTGANIFRSEWGSLLEELVAEGKISETTARTYSHLNIAGLVGSIDNDFCGTDMTIGTDS
Cavia_porcellus|19302   SLTGANIFRSEWGGLLEELVREGKISETTAQTYSHLNIAGLVGSIDNDFCGTDMTIGTDS
Mus_musculus|42108      SLTGANIFRNEWGSLLEELVKEGKISESTAQNYAHLTIAGLVGSIDNDFCGTDMTIGTDS
Rattus_norvegicus|14597 SLTGANIFRNEWGSLLEELVKEGKISESTAQNYAHLSIAGLVGSIDNDFCGTDMTIGTDS
                        ******:**.***.*****. ******:*:: *:**    *:    :*** *** :.:  

Tupaia_belangeri|14666  -LH--IMVID--ITTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
Ochotona_princeps|7222  ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
Dipodomys_ordii|13493   ALHRIMEVIDAITTTAQXXXXXXXXXXXXXXXXYLALVSALASGADWLFIPEAPPEDGWE
Callithrix_jacchus|2061 ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPESPPEDGWE
Gorilla_gorilla|3543    ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
Homo_sapiens|75245      ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
Pan_troglodytes|2316    ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
Cavia_porcellus|19302   ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
Mus_musculus|42108      ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
Rattus_norvegicus|14597 ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
                         **  : ***   ****                *******************:*******

Tupaia_belangeri|14666  NFMCERLGETRSRGSRLNIIIIAEGAIDRQGKPISSSYVKDLVVQRLGFDTRVTVLGHVQ
Ochotona_princeps|7222  NFMCERLGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXYVKDLVVQRLGFDTRVTVLGHVQ
Dipodomys_ordii|13493   NFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPISSSYVKDLVVQRLGFDTRVTVLGHVQ
Callithrix_jacchus|2061 NFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPILSSYVKDLVVQRLGFDTRVTVLGHVQ
Gorilla_gorilla|3543    NFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPISSSYVKDLVVQRLGFDTRVTVLGHVQ
Homo_sapiens|75245      NFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPISSSYVKDLVVQRLGFDTRVTVLGHVQ
Pan_troglodytes|2316    NFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPISSSYVKDLVVQRLGFDTRVTVLGHVQ
Cavia_porcellus|19302   NFMCERLGETRSRGSRLNIIIIAEGAIDRHGKPISSSYVKDLVVQRLGFDTRVTVLGHVQ
Mus_musculus|42108      NFMCERLGETRSRGSRLNIIIIAEGAIDRHGKPISSSYVKDLVVQRLGFDTRVTVLGHVQ
Rattus_norvegicus|14597 NFMCERLGETRSRGSRLNIIIIAEGAIDRHGKPISSSYVKDLVVQRLGFDTRVTVLGHVQ
                        *********                            ***********************

Tupaia_belangeri|14666  RGGTPSAFDRVLSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQVXXXXXX
Ochotona_princeps|7222  RGGTPSAFDRVLSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQVTKEVQK
Dipodomys_ordii|13493   RGGTPSAFDRILSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQVTKEVQK
Callithrix_jacchus|2061 RGGTPSAFDRVLSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQMTKEVQK
Gorilla_gorilla|3543    RGGTPSAFDRILSSKMGMEAVMALLEATPDTPACVVTLSGNQSVRLPLMECVQMTKEVQK
Homo_sapiens|75245      RGGTPSAFDRILSSKMGMEAVMALLEATPDTPACVVTLSGNQSVRLPLMECVQMTKEVQK
Pan_troglodytes|2316    RGGTPSAFDRILSSKMGMEAVMALLEATPDTPACVVTLSGNQSVRLPLMECVQMTKEVQK
Cavia_porcellus|19302   RGGTPSAFDRILSSKMGIEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQVTKDVQK
Mus_musculus|42108      RGGTPSAFDRILSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQVTKDVQK
Rattus_norvegicus|14597 RGGTPSAFDRVLSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQVTKDVQK
                        **********:******:******************:****************:      

Tupaia_belangeri|14666  XXXXXXXXXXXXXXXXSFENNWNIYKLLAHQKLSKEKTNFSLAILNVGAPAAGMNAAVRS
Ochotona_princeps|7222  AMDERRFDEAIQLRGRSFENNWNMYKLLAHQKLSKEKXXXXXXXXXXXXXXXXXXXXXXX
Dipodomys_ordii|13493   AMDDKRFDEAIQLRGRSFENNWNIYKLLAHQKISKEKSSFSLAILNVGAPAAGMNAAVRS
Callithrix_jacchus|2061 AMDDKRFDEAIQLRGRSFENNWNIYKLLAHQKLSKEKSNFSLAILNVGAPAAGMNAAVRS
Gorilla_gorilla|3543    AMDDKRFDEATQLRGGSFENNWNIYKLLAHQKPPKEKSNFSLAILNVGAPAAGMNAAVRS
Homo_sapiens|75245      AMDDKRFDEATQLRGGSFENNWNIYKLLAHQKPPKEKSNFSLAILNVGAPAAGMNAAVRS
Pan_troglodytes|2316    AMDDKRFDEATQLRGGSFENNWNIYKLLAHQKPPKEKSNFSLAILNVGAPAAGMNAAVRS
Cavia_porcellus|19302   AMDDRRFEEAIQLRGRSFENNWNIYKLLAHQKVSKEKTNFSLAILNVGAPAAGMNAAVRS
Mus_musculus|42108      AMDEERFDEAIQLRGRSFENNWKIYKLLAHQKVSKEKSNFSLAILNVGAPAAGMNAAVRS
Rattus_norvegicus|14597 AMDEKRFDEAIQLRGRSFENNWKIYKLLAHQKVSKEKSNFSLAILNVGAPAAGMNAAVRS
                                        ******::******** .***                       

Tupaia_belangeri|14666  AVRTGISQGHTVYVVHDGFEGLAKGQVQVVGWHDVAGWLGRGGSMLGTKXXXXXXXXXXX
Ochotona_princeps|7222  XXXXXXXQGHTVYVVHDGFEGLVKGQVQEVSWHDVAGWLGRGGSMLGTKXXXXXXXXXXX
Dipodomys_ordii|13493   AVRTGISQGHTVYVVHDGFEGLAKGQXXXXXXXXXXXXXXXXXXXXXXXXTLPRAHLESI
Callithrix_jacchus|2061 AVRTGISQGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKGHLESI
Gorilla_gorilla|3543    AVRTGISHGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKGQLESI
Homo_sapiens|75245      AVRTGISHGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKGQLESI
Pan_troglodytes|2316    AVRTGISHGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKGQLESI
Cavia_porcellus|19302   AVRTGISQGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKGHMEAI
Mus_musculus|42108      AVRTGISEGHTVYIVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKPHLEAI
Rattus_norvegicus|14597 AVRTGISEGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKPHLEAI
                               .*****:********.***                                  

Tupaia_belangeri|14666  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Ochotona_princeps|7222  XXXXXXXXXXXXXXXXXXXAYEGVLQLVEARGRYEELCIVMCVVPATISNNVPGTDFSLG
Dipodomys_ordii|13493   VENLRTYNIHALLVIGGFEAYEGVLQLVEARERYEELCIVMCVIPATISNNVPGTDFSLG
Callithrix_jacchus|2061 VENIRTYGIHALLAVGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
Gorilla_gorilla|3543    VENVRIYGIHALLVVGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
Homo_sapiens|75245      VENIRIYGIHALLVVGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
Pan_troglodytes|2316    VENIRIYGIHALLVVGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
Cavia_porcellus|19302   VENLRAHNIHALLVIGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
Mus_musculus|42108      VENLRTYNIHALLVIGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
Rattus_norvegicus|14597 VENLRTYNIHALLVIGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
                                                                                    

Tupaia_belangeri|14666  XXXXXXXXXXSCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
Ochotona_princeps|7222  SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
Dipodomys_ordii|13493   SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
Callithrix_jacchus|2061 SDTAVNAAMESCDRIKQSASGTKRRVFVVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
Gorilla_gorilla|3543    SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
Homo_sapiens|75245      SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
Pan_troglodytes|2316    SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
Cavia_porcellus|19302   SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
Mus_musculus|42108      SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
Rattus_norvegicus|14597 SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
                                  *****************:********************************

Tupaia_belangeri|14666  IHDLKANVEHMTEKMKTDIQRGLVLRNEKCHEHYSTEFLYNLYSSEGKGVFDCRTNVLGH
Ochotona_princeps|7222  IHDLKANVEHMTEKMKTDIQRGLVLRNEKCHDYYTTEFLYNLYSSEG-GVFDCRTNVLGH
Dipodomys_ordii|13493   IHDLKANVEHMTEKMKTDIQRGLVLRNEKCHEHYTTEFLYHLYSSEGRGVFDCRTNVLGH
Callithrix_jacchus|2061 IHDLKANVEHMTEKMKTDIQRGLVLRNEKCHDHYTTEFLYNLYSSEGKGVFDCRTNVLGH
Gorilla_gorilla|3543    IHDLKVNVEHMTEKMKTDIQRGLVLRNEKCHDYYTTEFLYNLYSSEGKGVFDCRTNVLGH
Homo_sapiens|75245      IHDLKVNVEHMTEKMKTDIQRGLVLRNEKCHDYYTTEFLYNLYSSEGKGVFDCRTNVLGH
Pan_troglodytes|2316    IHDLKVNVEHMTEKMKTDIQRGLVLRNEKCHDYYTTEFLYNLYSSEGKGVFDCRTNVLGH
Cavia_porcellus|19302   IHDLEANVEHMTEKMKTDIQRGLVLRNEKCHEHYTTEFLYNLYSSEGKGVFDCRTNVLGH
Mus_musculus|42108      IHDLKANVEHMTEKMKTDIQRGLVLRNEKCHEHYTTEFLYNLYSSEGRGVFDCRTNVLGH
Rattus_norvegicus|14597 IHDLKANVEHMTEKMKTDIQRGLVLRNEKCHEHYTTEFLYNLYSSEGRGVFDCRTNVLGH
                        ****:.*************************::*:*****:****** ************

Tupaia_belangeri|14666  LQQGGAPTPFDRNYGTKLGVKAMLWMSEKLRAVYRKGRVFANAPDSACVIGLQKKTVAFS
Ochotona_princeps|7222  LQQGGAPTPFDRNYGTKLGVKAMLWVSEMLRAVYRKGRVFANAPDSACVIGLRKKAVAFS
Dipodomys_ordii|13493   LQQGGAPTPFDRNYGTKLGVKAMLWMSEKLRAVYRKGRVFANAPDSACVIGLRKKAVAFS
Callithrix_jacchus|2061 LQQGGAPTPFDRNYGTKLGVKAMLWVSEKLREVYRKGRVFANAPDSACVIGLKKKAVAFS
Gorilla_gorilla|3543    LQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANAPDSACVIGLKKKAVAFS
Homo_sapiens|75245      LQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANAPDSACVIGLKKKAVAFS
Pan_troglodytes|2316    LQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANAPDSACVIGLKKKAVAFS
Cavia_porcellus|19302   LQQGGAPTPFDRNYGTKLGVKAMLWMSDKLQAVYRKGRVFANAPDSACVIGLRKKVVAFS
Mus_musculus|42108      LQQGGAPTPFDRNYGTKLGVKAMLWVSEKLRDVYRKGRVFANAPDSACVIGLRKKVVAFS
Rattus_norvegicus|14597 LQQGGAPTPFDRNYGTKLGVKAMLWMSEKLRDVYRKGRVFANAPDSACVIGLRKKVVAFS
                        *************************:*: *: ********************:**.****

Tupaia_belangeri|14666  PVTELKKDTDF-------------------------------------------------
Ochotona_princeps|7222  PVTELKKDTDF-------------------------------------------------
Dipodomys_ordii|13493   PVTELKKDTDFDHRMPREQWWLNLRLMLKMLAHYRISMADYVSGELEHVTRRTLSIDK--
Callithrix_jacchus|2061 PVTELKKDTDFEHRMPREQWWLSLRLMLKMLAHYRISMAAYVSGELEHVTRRTLSMETGF
Gorilla_gorilla|3543    PVTELKKDTDFEHRMPREQWWLSLRLMLKMLAQYRISMAAYVSGELEHVTRRTLSMDKGF
Homo_sapiens|75245      PVTELKKDTDFEHRMPREQWWLSLRLMLKMLAQYRISMAAYVSGELEHVTRRTLSMDKGF
Pan_troglodytes|2316    PVTELKKDTDFEHRMPREQWWLSLRLMLKMLAQYRISMAAYVSGELEHVTRRTLSMDKGF
Cavia_porcellus|19302   PVTELKEDTDFEHRMPREQWWLNLRLMLKMLAHYHISMADYVSGELEHVTRRTLSLDTGF
Mus_musculus|42108      PVTELKKETDFEHRMPREQWWLNLRLMLKMLAHYRISMADYVSGELEHVTRRTLSIDKGF
Rattus_norvegicus|14597 SVTELKKETDFEHRMPREQWWLNLRLMLKMLAHYRISMADYVSGELEHVTRRTLSIDKGF
                        .*****::***