Orthologs Set ID: EOG4003GK


Orthology Database
OrthoDB4
Gene Symbol(s)
FSD2

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 19976 648, 744, 975, 998, 1126, 1282, 1417, 1574, 1708, 1847, 2030
Cavia porcellus 1754 648, 744, 975, 1004, 1126, 1282, 1423, 1574, 1708, 1847, 2030
Dipodomys ordii 7247 744, 992, 1126, 1282, 1423, 1574, 1708, 1847, 2030
Gorilla gorilla 9312 648, 744, 975, 998, 1126, 1282, 1417, 1574, 1708, 1847, 2030
Homo sapiens 29686 648, 744, 975, 1004, 1126, 1282, 1423, 1574, 1708, 1847, 2030
Microcebus murinus 18467 648, 744, 979, 1126, 1282, 1423, 1574, 1712, 1847, 2030
Mus musculus 39351 648, 744, 975, 1004, 1126, 1282, 1423, 1574, 1708, 1847, 2030
Ochotona princeps 17067 648, 744, 981, 1126, 1282, 1423, 1574, 1708, 1847, 2030
Oryctolagus cuniculus 21668 648, 744, 975, 1004, 1126, 1282, 1423, 1574, 1708, 1847, 2030
Otolemur garnettii 4081 648, 744, 979, 1126, 1257, 1282, 1423, 1574, 1712, 1847, 1857, 1890, 1902, 1905, 1923, 2030
Pan troglodytes 13352 648, 744, 992, 1126, 1282, 1423, 1574, 1708, 1847, 2030, 2104
Rattus norvegicus 2275 249, 648, 744, 975, 1004, 1126, 1282, 1423, 1574, 1708, 1843, 2030
Spermophilus tridecemlineatus 8770 200, 648, 744, 824, 834, 843, 885, 894, 979, 1126, 1282, 1423, 1574, 1712, 1847
Tarsius syrichta 8135 55, 648, 744, 992, 1126, 1282, 1423, 1574, 1708, 1847, 2030
Tupaia belangeri 1933 648, 744, 979, 1126, 1282, 1423, 1574, 1593, 1618, 1647, 1712, 1847, 2030

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 19976 ENSCJAT00000031068 100395828 ENSCJAG00000015939 FSD2 calJac3
Cavia porcellus 1754 ENSCPOT00000002763 100730664 ENSCPOG00000002729 FSD2 cavPor3
Dipodomys ordii 7247 ENSDORT00000007252 ENSDORG00000007252 Fsd2 dipOrd1
Gorilla gorilla 9312 ENSGGOT00000012415 101141250 ENSGGOG00000012365 FSD2 gorGor3
Homo sapiens 29686 ENST00000334574 123722 ENSG00000186628 FSD2 hg19,GRCh37
Microcebus murinus 18467 ENSMICT00000017198 ENSMICG00000017199 FSD2 micMur1
Mus musculus 39351 ENSMUST00000042318 244091 ENSMUSG00000038663 mm9
Ochotona princeps 17067 ENSOPRT00000004089 101525860 ENSOPRG00000004079 FSD2 OchPri2.0
Oryctolagus cuniculus 21668 ENSOCUT00000024873 100358652 ENSOCUG00000026686 FSD2 oryCun2.0
Otolemur garnettii 4081 ENSOGAT00000003946 100958665 ENSOGAG00000003943 FSD2 otoGar1
Pan troglodytes 13352 ENSPTRT00000013606 453595 ENSPTRG00000007383 FSD2 panTro2
Rattus norvegicus 2275 ENSRNOT00000026089 308779 ENSRNOG00000019278 Fsd2 rn4
Spermophilus tridecemlineatus 8770 ENSSTOT00000008771 speTri1
Tarsius syrichta 8135 ENSTSYT00000007681 ENSTSYG00000007674 FSD2 tarSyr1
Tupaia belangeri 1933 ENSTBET00000001934 ENSTBEG00000001939 FSD2 tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 12403 ENSCJAP00000029402 100395828 ENSCJAG00000015939 FSD2 calJac3
Cavia porcellus 1366 ENSCPOP00000002478 100730664 ENSCPOG00000002729 FSD2 cavPor3
Dipodomys ordii 6809 ENSDORP00000006798 ENSDORG00000007252 Fsd2 dipOrd1
Gorilla gorilla 7960 ENSGGOP00000012069 101141250 ENSGGOG00000012365 FSD2 gorGor3
Homo sapiens 20709 ENSP00000335651 123722 ENSG00000186628 FSD2 hg19,GRCh37
Microcebus murinus 15666 ENSMICP00000015667 ENSMICG00000017199 FSD2 micMur1
Mus musculus 12037 ENSMUSP00000047775 244091 ENSMUSG00000038663 mm9
Ochotona princeps 14877 ENSOPRP00000003766 101525860 ENSOPRG00000004079 FSD2 OchPri2.0
Oryctolagus cuniculus 97 ENSOCUP00000020322 100358652 ENSOCUG00000026686 FSD2 oryCun2.0
Otolemur garnettii 3508 ENSOGAP00000003509 100958665 ENSOGAG00000003943 FSD2 otoGar1
Pan troglodytes 18792 ENSPTRP00000012615 453595 ENSPTRG00000007383 FSD2 panTro2
Rattus norvegicus 27958 ENSRNOP00000026089 308779 ENSRNOG00000019278 Fsd2 rn4
Spermophilus tridecemlineatus 7861 ENSSTOP00000007862 speTri1
Tarsius syrichta 7444 ENSTSYP00000007038 ENSTSYG00000007674 FSD2 tarSyr1
Tupaia belangeri 1685 ENSTBEP00000001678 ENSTBEG00000001939 FSD2 tupBel1

multiple sequence alignment in CLUSTALW format


Spermophilus_tridecemlineatus|8770 ATGGAGGAGGAAGCTGGGGAGGAACCTGGGCTGGACAGGTCTACTGCCCCTAAGGACTTC
Tarsius_syrichta|8135              ATGGAGGAAGAAGCTGGGGAGGAACCAGGGCTGGACAGGTCTGCT---CCCAAGGATTTC
Otolemur_garnettii|4081            ATGGAAGGGGAAGCTGGGGAGGAACTGGGGCCAGACAAGTCTGCC---CCCAAAGATTTC
Dipodomys_ordii|7247               ------------------------------------------------------------
Ochotona_princeps|17067            ---GAGGCGGATGCTGGGGAGGAACCAGGACTGGACAGCCACACTGCCCCTACGGACTTC
Oryctolagus_cuniculus|21668        ------GAGGATGCTGGAGAGGAACCAGGGCTCGGCAGGTGCACGGCTCCCACAGACTTC
Tupaia_belangeri|1933              ATGGAGGAGGAAGGTGGAGAGGAAGCTGGGATGGACAGGTCAGCTGTTGCCAAGGACTTC
Mus_musculus|39351                 ------------------------------------------------------------
Rattus_norvegicus|2275             ATGGAGGAGGAAGCAGGGGAGGAGCCGGGGCTGGGGAGATCAACAGCCCCCAGAGACTTC
Cavia_porcellus|1754               ------------------------------------------------------------
Microcebus_murinus|18467           ATGGAGGAGGAAGCTGGGGAAGAACCAGGGCTGGACAGGTCTTCT---CCCAGGGACTTC
Callithrix_jacchus|19976           ATGGAGGAAGAATCGGGGGAGGAACTGGGGTTGGACAGGTCTACT---CCCAAGGATTTC
Pan_troglodytes|13352              ATGGAGGAGGAATCGGGGGAGGAACTGGGGCTGGACAGGTCTACT---CCCAAGGATTTC
Gorilla_gorilla|9312               ATGGAGGAGGAATCGGGGGAGGAACTGGGGCTGGACAGGTCTACT---CCCAAGGATTTC
Homo_sapiens|29686                 ATGGAGGAGGAATCGGGGGAGGAACTGGGGCTGGACAGGTCTACT---CCCAAGGATTTC
                                                                                               

Spermophilus_tridecemlineatus|8770 CACTTTTATAACATGGATCTGTATGACTCTGAAGACAGAATGCAGATCATTCCACAAGAA
Tarsius_syrichta|8135              CACTTTTATCACATGGATCTTTATGATTCTGAAGACAGACTGCAGATCTTTCCAGAAGAA
Otolemur_garnettii|4081            CACTTTTATCATATGGATCTCTATGACACTGAAGACAGATTACACATCTTCCCTGAAGAA
Dipodomys_ordii|7247               ------------------------------------------------------------
Ochotona_princeps|17067            AACTTTTATCACATGGATCTGTATGACCCGGACAACAGGCTGCTGCTCCTCCCGGAAGAA
Oryctolagus_cuniculus|21668        CACTTCTATCACATGGATCTGTACGACTCTGACAGCAGGCTGCAGGTCCTCCCGGAAGAA
Tupaia_belangeri|1933              CACTTTTATCACATGGATCTGTATGACTCTGAAGACAGACTGCAGATCTTCCCCGAAGAA
Mus_musculus|39351                 ------------ATGGACCTGTATGACTCTGAAGATAGACTGCAGCTCTTCCCAGGAGAC
Rattus_norvegicus|2275             CACTTTTATCACATGGACCTGTATGACTCTGAAGATAGACTGCAGCTCTTCCCAGGAGAA
Cavia_porcellus|1754               ------------------------------------------------------------
Microcebus_murinus|18467           TACTTTTATCACACAGATCTGTATGACCCCGAAGACAGGCTACAGATCTTCCCAAAACAA
Callithrix_jacchus|19976           CACTTTTACCACATGGACCTGTATGACTCTGAAGACAGACTGCAGCTCTTTCCAGAAGAG
Pan_troglodytes|13352              CACTTTTACCACATGGACCTGTATGACTCTGAAGACAGACTGCACCTCTTTCCAGAAGAG
Gorilla_gorilla|9312               CACTTTTACCACATGGACCTGTATGACTCTGAAGACAGACTGCACCTCTTTCCAGAAGAG
Homo_sapiens|29686                 CACTTTTACCACATGGACCTGTATGACTCTGAAGACAGACTGCACCTCTTTCCAGAAGAG
                                                                                               

Spermophilus_tridecemlineatus|8770 AACACTAGAATGAGAAGAGAAGTAGTCCAAGCTGAAATGACCAAGGACCCAAGAGGGGCA
Tarsius_syrichta|8135              AATACTAGGATGAGGAGAGAAGTAGTCCAGGCTGAAAAGACCAGTGAGCCAAGAGGGGCA
Otolemur_garnettii|4081            AACATTAGGATGCAGAGGGATGGCATCCAAGCTGAAGTGAGCAGTGAGCCGAGAGGGGAA
Dipodomys_ordii|7247               ------------------------------------------------------------
Ochotona_princeps|17067            AGTCCTGGAACAAGGAGAGAGGTGATCCAAGCCGAGCGAACCTTCGAGGCAAGAGGGGCA
Oryctolagus_cuniculus|21668        AGCACTGGAGTGAGGAGAGAGGCAGTCCAGGCTGAAAGGACCTACGAGCCAAGAGGGGCG
Tupaia_belangeri|1933              AACATGAGGATGAGGAGAGATGTAGCCCCAGCTGACATGACCAGCAAGCCAAGCGGGGCA
Mus_musculus|39351                 AGCAGCAGAATCAGGAGGGAAGTAACCCAAGCC---------------------------
Rattus_norvegicus|2275             AGCAGCAGAACCCGGAGGGAAGTAACCCAGGCT---------------------------
Cavia_porcellus|1754               ------------------------------------------------------------
Microcebus_murinus|18467           AACGTTAGAACAAGGAGGGAAGTCGTCCAGGCTGAAAGGAGCCATGAGCCAAGAGGGACA
Callithrix_jacchus|19976           AACACTAGGAGGAGGAAAGAAGTAGTCCAAGCTGAAAGGGCCAATGAGTCAACAGGAGCA
Pan_troglodytes|13352              AACACTAGGATGAGGAAA---GTAGTCCAAGCTGAAATGGCCAATGAGTCAAGAGGAGCA
Gorilla_gorilla|9312               AACACTAGGATGAGGAAA---GTAGTCCAAGCTGAAATGGCCAATGAGTCAAGAGGAGCA
Homo_sapiens|29686                 AACACTAGGATGAGGAAA---GTAGTCCAAGCTGAAATGGCCAATGAGTCAAGAGGAGCA
                                                                                               

Spermophilus_tridecemlineatus|8770 GGGGAAAGGAAGATTCAAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|8135              GGGGATGCTAAGGCTCAAAGAGACCTTCAAGAGGAAGTGGACGAACTTGCCCACTTATAT
Otolemur_garnettii|4081            GGGGATGGTAAGATTCAAAGAGACCTTCAAGAGGAAGTGGATGAACTTGTCCATTTATAC
Dipodomys_ordii|7247               ------------------------------------------------------------
Ochotona_princeps|17067            AGGGAGGGGCAGACCCACAGGCATCTGCACCAGGAAGTAGATGAGCTGGTGCATCTCTAT
Oryctolagus_cuniculus|21668        AGGGAGGGGCAGGCCCACAGAGCCCTTCACGAGGAAGCGGACGAACTCGTCCATCTGTAT
Tupaia_belangeri|1933              GGGGAAGGTAAGACTCAAAGAGACCTTCAAGAGGAAGTAGATGAACTTGTCCACTTATAT
Mus_musculus|39351                 ------------------------------------------------------------
Rattus_norvegicus|2275             ------------------------------------------------------------
Cavia_porcellus|1754               ------------------------------------------------------------
Microcebus_murinus|18467           GGGGATGGTAAGGTTCAAAGAGACCTTCAAGAGGAAGTGGATGAACTTGTCCACTTGTAC
Callithrix_jacchus|19976           GGGGATGGTAAGGCTCAAAGAGACCTTCAAGAGGAAGTGGAGGAACTTGTCCACTTATAT
Pan_troglodytes|13352              GGGGATGGTAAGGCTCAAAGAGACCTTCAAGAGGAAGTGGATGAACTTGTCCACTTATAT
Gorilla_gorilla|9312               GGGGATGGTAAGGCTCAAAGAGACCTTCAAGAGGAAGTGGATGAACTTGTCCACTTATAT
Homo_sapiens|29686                 GGGGATGGTAAGGCTCAAAGAGACCTTCAAGAGGAAGTGGATGAACTTGTCCACTTATAT
                                                                                               

Spermophilus_tridecemlineatus|8770 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|8135              GGACTTGAAGATGATAATGATTTAGGGGATGAGTTTGTTGATGAAAACATGACCAGAATG
Otolemur_garnettii|4081            GGACTTGAAGATGATCATGAGTTAGGGGATGAGTTTGTTGATGAAAACTTGTTCAGAGTA
Dipodomys_ordii|7247               ------------------------------------------------------------
Ochotona_princeps|17067            GGTCTTGAAGATGACCATGAATTAGGGGATGAGATTATTGATGGAAACATGCCCAGCACT
Oryctolagus_cuniculus|21668        GGACTTGAAGATGATCACGAGTTAGGGGACGAGATTATGGATGAAGACACGCCCAGACTG
Tupaia_belangeri|1933              GGACTTGAAGATGATCACGAGTTAGGGGATGAGTTTGTTGATGAAAATATGCCTGGAATG
Mus_musculus|39351                 ------GAAGATGACCGTGAATTAGGGGATGAATTTGTGGATGAACAC------AGACTG
Rattus_norvegicus|2275             ------GAAGATGAACATGAGTTAGGGGGTGAATTTGTGGATGAACAC------AGATTG
Cavia_porcellus|1754               ------------------------------------------------------------
Microcebus_murinus|18467           GGACTTGAAGATGATCACGAGTTAGGGGATGAGTTCGTTGATGAAAACTTGCCCAGGATG
Callithrix_jacchus|19976           GGACTTGAAGATGATCACGAATTAGGGGATGAGTTTGTT---GAAAACATGCCCAGAATG
Pan_troglodytes|13352              GGACTTGAAGATGATCATGAATTAGGGAATGAGTTTGTTGATGAAAACATACCCAGAACA
Gorilla_gorilla|9312               GGACTTGAAGATGATCATGAATTAGGGGATGAGTTTGTTGATGAAAACATACCCAGAACA
Homo_sapiens|29686                 GGACTTGAAGATGATCATGAATTAGGGGATGAGTTTGTTGATGAAAACATACCCAGAACA
                                                                                               

Spermophilus_tridecemlineatus|8770 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|8135              GGGGTTCCGGAATACCCTCCTTATGTGATGAAGAGGAGAGACCCAACCAGGGGGCAAAGT
Otolemur_garnettii|4081            GGGGTTCCAGAATATCCTTCTCATATGATGAAGAGGAGAGACCCAGCCAGGGAGCAGAGA
Dipodomys_ordii|7247               ------------------------------------------------------------
Ochotona_princeps|17067            GGAATTGAAGAATATCCTCCTTATGGGGTGAAGCGGGGAGACCCAGCCTGGGAGCAGCAG
Oryctolagus_cuniculus|21668        GGGACCGCAGAATATCCTCCTTATGGGGTGAAGAGGGGCGACCCGGCCTGGGAGCAGCGG
Tupaia_belangeri|1933              GGGGTTTCGGAATATTCTCCTTATGCAATGAAGGGGAGAGACCCAACCAGGGAGCAGAGA
Mus_musculus|39351                 GGGACTCTGGGGTATCCTTCTTACGGGATGAGGAGGAGGGACCCAGGCAGGGAGCCGAGA
Rattus_norvegicus|2275             GGGACTCTGGGGTATCCG---TACGGGATGAGGAGGAGGGATCCAGGCAGGGAGCAGAGA
Cavia_porcellus|1754               ------------------------------------------------------------
Microcebus_murinus|18467           GGGGCTTCAGAATACCCTCCTCATATGATGAAGAGGACAGAGCCGGCCAGGGAGCAGAGA
Callithrix_jacchus|19976           GGAGTTTCGGAATATCCTCCTTATGGGATGAAGAGGAGAGACCCAGCCAGGGAGCAGAGA
Pan_troglodytes|13352              GGGGTTTCAGAATATCCTCCTTATATGATGAAGAGGAGAGACCCAGCCAGGGAGCAGAGA
Gorilla_gorilla|9312               GGGGTTTCAGAATATCCTCCTTATATGATGAAGAGGAGAGACCCAGCCAGGGAGCAGAGA
Homo_sapiens|29686                 GGGGTTTCAGAATATCCTCCTTATATGATGAAGAGGAGAGACCCAGCCAGGGAGCAGAGA
                                                                                               

Spermophilus_tridecemlineatus|8770 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNN
Tarsius_syrichta|8135              GACTGGAGACTTAGTGGAGAAGCAGCGGAGGCTGAGGACCTGGGTTTT---GGAGAGTGG
Otolemur_garnettii|4081            GACTGGAGACTCACTGGAGAGGCAGCAGAGGCCAAGGACCTGGGCTTC---AGAGGGTGG
Dipodomys_ordii|7247               ------------------------------------------------------------
Ochotona_princeps|17067            GACTGGCGTCTTGGAGGAGAGGTGGCTGAGGCAGGGGACCTGGGCTTT---GGAGGGTGG
Oryctolagus_cuniculus|21668        GACTGGAGACTCGGCGGAGAGGCAGCCGAGGCCGAGGACCTGGGCTTC---GGAGGGTGG
Tupaia_belangeri|1933              GACTGGAGACTTACTGGAGAGGCAGCTGAGGCCAACGACCTGGGCTTT---GGAGGGTGG
Mus_musculus|39351                 GACTGG---------GGTGAGGCAGCTGAGGCGGAGGACCTGGGCTACGGAGGAGGGCAA
Rattus_norvegicus|2275             GACTGGGGGCTTAGTGGTGAGGCAGCTGAGGCCGAGGACCTGTGCTAC---GGAGTTCAA
Cavia_porcellus|1754               ------------------------------------------------------------
Microcebus_murinus|18467           GACTGGAGACTCACTGGAGAGGTGGCAGAGGCCGAGGACCTGGGCCTG---GGCGGGTGG
Callithrix_jacchus|19976           GACTGGAGACTTAGTGGAGAGGCAACGGAGGCCGAGGACCTGGGCTTC---GGAGGGTGG
Pan_troglodytes|13352              GACTGGAGACTTAGTGGAGAGGCAGCGGAGGCCGAGGACCTGGGCTTC---GGAGGGTGG
Gorilla_gorilla|9312               GACTGGAGACTTAGTGGAGAGGCAGCGGAGGCCGAGGACCTGGGCTTC---GGAGGGTGG
Homo_sapiens|29686                 GACTGGAGACTTAGTGGAGAGGCAGCGGAGGCCGAGGACCTGGGCTTC---GGAGGGTGG
                                                                                               

Spermophilus_tridecemlineatus|8770 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|8135              GGCTCAGCAGGCCAGTGCCAGGACCTGCGGGAAGCCTATAGGTATGCACATGGCCGTGCC
Otolemur_garnettii|4081            GGATCAGCAGGTCAGTGCCAGGACTTGCGGGAAGCCTACAGGTACACGCATGGCCGAGCC
Dipodomys_ordii|7247               ------------------------------------------------------------
Ochotona_princeps|17067            GGCTCCAGGGGCCAGTGCCAAGACCTGCGGGAAGCCTATCAGTACAGTCATGGCCGCGCC
Oryctolagus_cuniculus|21668        GGCTCCAGGGGCCAGTGCCAAGACTTGCGGGAGGCCTATCGGTACACTCACGGCCGTGCC
Tupaia_belangeri|1933              GGTTCAGCAGGTCATTGCCAGGACTTGCGGGAAGCATATAGATACACACACGGCCGTACC
Mus_musculus|39351                 GGCCCTCTTGACCAGTGCCAAGACCTCCGGGAAGCCTACAGGTACACACATGGCCGTGCC
Rattus_norvegicus|2275             GGCCCTCCTGACCAATGCCAAGACCTTCGGGAAGCCTACAGGTACACACATGGCCGCGCC
Cavia_porcellus|1754               ------------CAGAGCCAGGCCTTGTGGGAATCCTACAGGTACACACACGGCCGTGCC
Microcebus_murinus|18467           GGCTCGGCTGGGCAGTGCCAGGACCTGCGGGAAGCGTACAGGTACGCGCACGGCCGGGCC
Callithrix_jacchus|19976           GGTTCGGCAGGCCAGTGCCAGGACTTGCGGGAAGTCTATAGGTACACACATGGCCGTGCC
Pan_troglodytes|13352              GGCTCAGCAGGCCAGTGCCAGGACTTGCGGGAAGCCTATAGGTACACACACGGCCGTGCC
Gorilla_gorilla|9312               GGCTCAGCAGGCCAGTGCCAGGACTTGCGGGAAGCCTATAGGTACACACACGGCCGTGCC
Homo_sapiens|29686                 GGCTCAGCAGGCCAGTGCCAGGACTTGCGGGAAGCCTATAGGTACACACACGGCCGTGCC
                                                                                               

Spermophilus_tridecemlineatus|8770 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|8135              AGTGAAGAATATGAATGCTATGTCATTCCAGAGGAGGAGGATGAGGAAGAAGCTGCCGAC
Otolemur_garnettii|4081            AGTGAGGAGTATGAATGCTATGTCATCCCTGAAGAGGAGGATGAGGAGGAAGCTGCCGAT
Dipodomys_ordii|7247               ------------------------------------------------------------
Ochotona_princeps|17067            AGTGAGGAGTATGAATGCTACGTGATCCCAGAGGAAGAGGATGAGGAAGAAGCTGCTGAT
Oryctolagus_cuniculus|21668        AGTGAGGAGTACGAATGCTACGTCATCCCAGAGGAGGAGGATGAGGAAGAAGCTGCCGAC
Tupaia_belangeri|1933              AGCGAGGAGTATGAGTGCTACGTCATCCCAGAAGAGGAGGATGAAGAAGAAACTGCCGAT
Mus_musculus|39351                 AGCGAGGAGTATGAATGCTATGTCATCCCAGAGGAGGAAGACGAAGAAGAGCCTGCTGAT
Rattus_norvegicus|2275             AGCGAGGAATATGAATGCTACGTCATCCCAGAGGAGGAAGATGAGGAAGAGCCTGCTGAT
Cavia_porcellus|1754               AGTGAGGAGTACGAGTGCTACGTCATCCCAGAGGAGGAGGACGAGGAAGAAGCCGCCGAT
Microcebus_murinus|18467           AGCGAGGAGTACGAATGCTATGTCATCCCAGAAGAGGAGGATGAGGAGGAAGCTGTTGAT
Callithrix_jacchus|19976           AGCGAGGAGTATGAATGCTATGTCATTCCCGAGGAAGAAGATGAAGAAGAAACTGCTGAT
Pan_troglodytes|13352              AGCGAGGAGTATGAATGCTATGTCATCCCCGAGGAAGAGGATGAAGAAGAAGCTGCTGAT
Gorilla_gorilla|9312               AGCGAGGAGTATGAATGCTATGTCATCCCCGAGGAAGAGGATGAAGAAGAAGCTGCTGAT
Homo_sapiens|29686                 AGCGAGGAGTATGAATGCTATGTCATCCCCGAGGAAGAGGATGAAGAAGAAGCTGCTGAT
                                                                                               

Spermophilus_tridecemlineatus|8770 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|8135              ATCTTCTGTGTCACCTGCAAAACCCCAGTAAGAACTTTTGAGAAGGATTTTGATGAACAC
Otolemur_garnettii|4081            GTCTTCTGCATCACTTGCAAAACTCAAATAAGAGCTTTTCAGAAAACTTTTGATGAACAC
Dipodomys_ordii|7247               ------------------------------------------------------------
Ochotona_princeps|17067            GTCTTCTGCATCACTTGCAAAACTCCGGTAAGAGCTGCTGAG---GACCTAGTCGTCCAC
Oryctolagus_cuniculus|21668        GTCTTCTGCGTCACTTGCAAAATCCCCGTAAGAGCTGTTGAG---AACCTTGATGCACAC
Tupaia_belangeri|1933              GTCTTTTGTGTCACATGTAAAACTCCCATAAGAGCTTCTGATACGGTTTCTGATGAACAC
Mus_musculus|39351                 GTCTTCTGCATCACTTGCAAAACTCCAGTAAGAACTGTTGAGAAGGATTTTGATACACAC
Rattus_norvegicus|2275             GTCTTCTGTGTCACTTGCAAAACTCCAGTGAGAACTGTTGAGAAGGATTTTGATATACAC
Cavia_porcellus|1754               CTCTTCTGTGTCACTTGCAGAACTCCCATCAGAGCTGTTGAGAAGGATTTCGGTGAACAC
Microcebus_murinus|18467           GTCTTCTGTGTCACTTGCAAAACTCCAATAAGAGCTTTCCAGAAGGTTTTTGATGAGCAC
Callithrix_jacchus|19976           GTCTTCTGTGTCACTTGTAAAACTCCAATAAGAGCTTTTCAGAAGGTTTTTGATGAACAT
Pan_troglodytes|13352              GTCTTCTGTGTCACTTGTAAGACTCCAATAAGAGCTTTTCAGAAGGTTTTTGATGAACAT
Gorilla_gorilla|9312               GTCTTCTGTGTTACTTGTAAGACTCCAATAAGAGCTTTTCAGAAGGTTTTTGATGAACAT
Homo_sapiens|29686                 GTCTTCTGTGTCACTTGTAAGACTCCAATAAGAGCTTTTCAGAAGGTTTTTGATGAACAT
                                                                                               

Spermophilus_tridecemlineatus|8770 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATGAAATTCAC
Tarsius_syrichta|8135              AAGGAGCATGAAGTGACCCCACTCAGTAAAGCACTAGAGAGTGCCAAGGATGAAATTCAC
Otolemur_garnettii|4081            AAGGAGCATGAAGTGATGCCACTCAGCAAGGCCCTGGAAAGCGCCAAGGATGAAATTCAC
Dipodomys_ordii|7247               ------------------------------------------------GATGAGATCCAC
Ochotona_princeps|17067            AAGGAACACGAAGTGACCCCGCTCAACCAAGCCCTGGAAAGCGCCAAGGATGAAATTCAC
Oryctolagus_cuniculus|21668        AAGGAGCACGAAGTGACCCCACTCAACCAAGCGCTGGAAAGCGCCAAGGATGAAATTCAC
Tupaia_belangeri|1933              AAGGAGCATGAAGTGACCCCGCTCAATAAGGCACTGGAAAGCGCCAAGGATGAAATTCAC
Mus_musculus|39351                 AAGGAACACGAAGTAACCCCAATCAGCAAAGCTCTGGAACATGCCAAGGATGAGGTTCAC
Rattus_norvegicus|2275             AAGGAACACGAAGTAACCCCAATCAACAAGGCTCTGGAACACGCCAAGGATGAAATTCAC
Cavia_porcellus|1754               AAAGAGCATGAAGTGACCCCACTCAGTAAAGCCCTGGAGAGTGCCAAGGAAGAAATTCAC
Microcebus_murinus|18467           AAGGAGCATGAAGTGATCCCACTCAATAAAGCCCTGGAAAGTGCCAAGGATGAAATTCAC
Callithrix_jacchus|19976           AAGGAGCATGAAGTGATCCCACTCAATGAAGCACTGGAAAGTGCCAAGGATGAAATTCAC
Pan_troglodytes|13352              AAGGAGCATGAAGTGATCCCACTCAATGAAGCACTGGAAAGTGCCAAGGATGAAATTCAC
Gorilla_gorilla|9312               AAGGAGCATGAAGTGATCCCACTCAATGAAGCACTGGAAAGTGCCAAGGATGAAATTCAC
Homo_sapiens|29686                 AAGGAGCATGAAGTGATCCCACTCAATGAAGCACTGGAAAGTGCCAAGGATGAAATTCAC
                                                                                   **:**..* ***

Spermophilus_tridecemlineatus|8770 AAAAACATGTACAAATTGGAAAAGCAGATTATTGAGATGGAAAATTTTGCAAGTCACTTG
Tarsius_syrichta|8135              AAAAACATGTACAAATTGGAAAAGCAGATTATCGAAATGGAAAACTTTGCAAATCACTTG
Otolemur_garnettii|4081            AAAAACATGTACAAATTGGAAAAACAGATTATTGAAATGGAAAACTTTGCCAACCACTTG
Dipodomys_ordii|7247               AGGAACATGTACCGCCTGGAACAGCAGATCATCGACATGGAGAACTTCGCAAGCCACCTG
Ochotona_princeps|17067            AAGAACATGTGCAAATTGGAAAAGCAGATCATTGACATGGAAAATTTCGCAAGTCACTTG
Oryctolagus_cuniculus|21668        AAAAACATGTACAAACTGGAAAAGCAGATTATCGACATGGAAAACTTCGCAAGTCATTTG
Tupaia_belangeri|1933              AAAAACATGTACAAACTGGAAAAGCAGATTATCGAGATGGAAAACTTTGCAAGTCACTTG
Mus_musculus|39351                 AAAAATATGTGCAAATTGGAACAGCAGATAATTGAGATGGAAAATTTCGCTAGCCACCTG
Rattus_norvegicus|2275             AAAAATATGTGCAAATTGGAACAGCAGATTATTGAGATGGAAAATTTCGCTAGCCACCTG
Cavia_porcellus|1754               AAAAACATGTACAAGTTGGAGCAGCAGATAATAGAAATGGAAAACTTTGCAAGTCACTTG
Microcebus_murinus|18467           AAAAACATGTACAAGTTGGAAAAGCAGATTCTCGAGATGGAAAACTTTGCCAACCACTTG
Callithrix_jacchus|19976           AAAAACATGTACAAATTGGAAAAACAGATAATTGATATGGAAAACTTTGCAAATCACTTG
Pan_troglodytes|13352              AAAAACATGTACAAATTGGAAAAGCAGATAATTGAGATGGAAAACTTTGCAAATCACTTG
Gorilla_gorilla|9312               AAAAACATGTACAAATTGGAAAAGCAGATAATTGAGATGGAAAACTTTGCAAATCACTTG
Homo_sapiens|29686                 AAAAACATGTACAAATTGGAAAAGCAGATAATTGAGATGGAAAACTTTGCAAATCATTTG
                                   *..** ****.*..  ****..*.***** .* ** *****.** ** ** *. **  **

Spermophilus_tridecemlineatus|8770 GAAGAGGTTTTCATCACCGTGGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|8135              GAGGAGGTTTTCATCACAGTGGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|4081            GAGGAGGTTTTCATCACTGTGGAG------------------GAACAAAACTTTGAGTCC
Dipodomys_ordii|7247               GAGGAGGTTTTCGTCACGGTGGAGGAGAACTTCGGAAGACAGGAGCAAAACTTCGAGTCA
Ochotona_princeps|17067            GAGGAGGTCTTCATCACTGTGGAGGAGAATTTTGGAAGACAAGAACAAAACTTCGAGTCT
Oryctolagus_cuniculus|21668        GAGGAGGTCTTCATCACCGTGGAGGAGAATTTCGGAAGACAAGAACAAAACTTTGAGTCA
Tupaia_belangeri|1933              GAGGAGGTTTTCATCACTGTGGAGGAGAATTTTGGAAGACAAGAACAAAACTTTGAGTTG
Mus_musculus|39351                 GAAGAAGTGTTCATTACTGTGGAGGAGAATTTTGGAAGACAGGAACAAAACTTTGAGTGC
Rattus_norvegicus|2275             GAAGAAGTGTTCATCACTGTGGAGGAGAATTTTGGAAGACAAGAACAAAACTTCGAGTGC
Cavia_porcellus|1754               GAGGAGGTTTTCATCACTGTAGAGGAAAATTTTGGAAGACAAGAACAAAACTTTGAGTCA
Microcebus_murinus|18467           GAGGAGGTTTTCATCACGGTGGAGGAGAATTTTGGAAAACAAGAACAAAATTTTGAGTCA
Callithrix_jacchus|19976           GAGGAAGTTTTCATCACTGTGGAGGAGAATTTTGGAAAACAAGAACAAAACTTTGAGTCA
Pan_troglodytes|13352              GAGGAGGTTTTCATCACTGTGGAGGAGAATTTTGGAAAACAAGAACAAAACTTTGAGTCA
Gorilla_gorilla|9312               GAGGAGGTTTTCATCACTGTGGAGGAGAATTTTGGAAAACAAGAACAAAACTTTGAGTCA
Homo_sapiens|29686                 GAGGAGGTTTTCATCACTGTGGAGGAGAATTTTGGAAAACAAGAACAAAACTTTGAGTCA
                                   **.**.** ***.* ** **.***                  .        .. . ..  

Spermophilus_tridecemlineatus|8770 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAAATACAA---CTA
Tarsius_syrichta|8135              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|4081            CATTACAATGAGATCTTGGAAACACTTGCTCAAAAATATGAAGAAAAAATACAAGCTCTA
Dipodomys_ordii|7247               CATTACAACGAGATCTTGGAAACGCTTGCCCAAAACTATGAGGAAAACATACAGGCTCTC
Ochotona_princeps|17067            CATTACAATGAGATCTTGGAAACGCTCGCCCAAAAATACGAAGAAAAAATCCAAGCTCTG
Oryctolagus_cuniculus|21668        CACTACAATGAGATCTTGGAAACACTCGCGCAAAAATATGAAGAAAAAATACAAGCTCTG
Tupaia_belangeri|1933              CATTACAACGAGATCTTAGAAACACTTGCTCAAAAATATGAAGAAAAAATACAAGCTCTA
Mus_musculus|39351                 CATTACAATGGGATCTTGGAAACCCTCGCTCAAAAGTATGAAGAAAAAATTCAAGCTCTG
Rattus_norvegicus|2275             CATTACAACGAGATCTTGGAAACCCTCGCTCAGAAGTATGAAGAAAAAATTCAAGCTCTG
Cavia_porcellus|1754               CATTACAATGGAATCTTGGAAACACTTGCCCAAAAGTACGAAGAAAAGATCCAAGCTCTA
Microcebus_murinus|18467           CATTACAACGAAATCTTGGAAACACTTGCTCAAAAATACGAAGAAAAAATACAAGCTCTA
Callithrix_jacchus|19976           CATTACAATGAGATCTTGGAAACACTTGCTCAAAAATATGAAGAAAAAATACAAGCTCTA
Pan_troglodytes|13352              CATTACACCGAGATCTTGGAAACACTTGCTCAAAAATATGAGGAAAAAATACAAGCTCTA
Gorilla_gorilla|9312               CATTACAACGAAATCTTGGAAACACTTGCTCAAAAATATGAGGAAAAAATACAAGCTCTA
Homo_sapiens|29686                 CATTACAACGAGATCTTGGAAACACTTGCTCAAAAATATGAGGAAAAAATACAAGCTCTA
                                      .     .   . .. .      . .        .  .  .      .        . 

Spermophilus_tridecemlineatus|8770 GGC---AAAAAGAAAGAGAAGCTGGAAGCCTTGTATGGACAACTGAGC---TGT---GAG
Tarsius_syrichta|8135              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|4081            GGGGAGAAAAAGAAGGAGAAGCTGGAAACATTATATGGACAACTGGTCAGCTGTGGAGAA
Dipodomys_ordii|7247               GGGGAGAGAAAGAAAGAGAAGCTGGAGGCCCTGTACGGACAGCTGGTCAACTGCGGAGAA
Ochotona_princeps|17067            GGGCAGAAAAAGAGAGAGAAGCTGGAATCTTTGTACGGGCAGCTGGTCAGCTGCGGGGAG
Oryctolagus_cuniculus|21668        GGGCAGAAGAAGAAGGAGAAGCTGGAAGCCTTGTACGAGCAGCTGGTCAGCTGCGGGGAG
Tupaia_belangeri|1933              GGGGAGAAAAAGAAAGAGAAGCTGGAAGCCTTATATGGACAACTGGTCAGCTGTGGAGAA
Mus_musculus|39351                 GGGGAGAAAAAGAGAGAGAAACTGGAAGCCTTATACGGACAACTGGTCAGCTGTGGAGAG
Rattus_norvegicus|2275             GGGGAGAAAAAGAAAGAGAAGCTGGAAGCCCTATATGGACAGCTGGTCAGCTGTGGAGAG
Cavia_porcellus|1754               GGAGAAAAGAAGAAAGAGAAGCTGGAGGCCTTGTATGGACAGCTGGTTAGTTGTGGGGAA
Microcebus_murinus|18467           GGGGAGAAAAAGAAAGAGAAGCTAGAAGCCTTATATGGACAGCTGATCAGCTGTGGGGAG
Callithrix_jacchus|19976           GGGGAGAAAAAGAAAGAGAAGGTGGAAGCCTTATATGAACAACTGGTCAGCTGTGGAGAA
Pan_troglodytes|13352              GGGGAGAAAAAGAAAGAGAAGCTGGAAGCCTTATATGGACAACTGGTCAGCTGTGGAGAA
Gorilla_gorilla|9312               GGGGAGAAAAAGAAAGAGAAGCTGGAAGCCTTATATGGACAACTGGTCAGCTGTGGAGAA
Homo_sapiens|29686                 GGGGAGAAAAAGAAAGAGAAGCTGGAAGCCTTATATGGACAACTGGTCAGCTGTGGAGAA
                                   ..         .   . .    . .      . .  .      ..      ..    .  

Spermophilus_tridecemlineatus|8770 AACCTTGACACCTGTAAAGAACTGATGGAAACAATAGAGGAGATGTGTCATGAGGAGAAG
Tarsius_syrichta|8135              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|4081            AACCTGGACACCTGTAAAGAGCTGATGGAAACCATAGAGGAGATGTGCCATGAGGAGAAG
Dipodomys_ordii|7247               AGCCTGGAGACCTGCAAAGAGCTGATGGAGGCGATCGAGGAGGTGTGTCACCAGGACAAG
Ochotona_princeps|17067            AACCTGGACACGTGCAGGGAGCTGATGGAGACCATAGAGGAGATGTGTCATGAGGAGAAG
Oryctolagus_cuniculus|21668        AACCTTGACACCTGTAAGGAACTGATGGAAACCATCGAGGAGATGTGCCACGAGGAGAAG
Tupaia_belangeri|1933              AACCTAGATACTTGTAAAGAACTGATGGAAACAATAGAGGAGATGTGTCATGAGGAGAAG
Mus_musculus|39351                 AACCTCGATGCCTGCAGGGAGCTGATGGAAACCGTAGAGGAGATGTGTCATGAGGAAAAG
Rattus_norvegicus|2275             AACCTCGATGCCTGCAGAGAGCTGATGGAAACCATAGAGGAGATGTGTCACGAGGAAAAG
Cavia_porcellus|1754               AACCTTGATACCTGCAAAGAACTGATGGAAACCATAGAGGAGATGTGTCATGAGGAGAAG
Microcebus_murinus|18467           AACCTGGACACCTGCAAAGAACTGATGGAAACCATAGAGGAGATGTGTCACCAGGAGAAG
Callithrix_jacchus|19976           AACCTAGATACCTGCAAAGAACTGATGGAAACAATAGAAGAGATGTGTCACGAGGAGAAG
Pan_troglodytes|13352              AACCTAGATACTTGCAAAGAACTGATGGAAACAATAGAGGAGATGTGTCACGAGGAGAAG
Gorilla_gorilla|9312               AACCTAGATACTTGCAAAGAACTGATGGAAACAATAGAGGAGATGTGTCACGAGGAGAAG
Homo_sapiens|29686                 AACCTAGATACTTGCAAAGAACTGATGGAAACAATAGAGGAGATGTGTCACGAGGAGAAG
                                       . .     ..    .   .. ...      . .  . . ....      ..    .

Spermophilus_tridecemlineatus|8770 GTTGATTTCTTAAAGGTCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|8135              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAAC------AGACTAGGGAAGTTTCTG
Otolemur_garnettii|4081            GTTGATTTCATAAAGGTCATCAGCATGTGTTTTTATACCAACAGACTTGGAAGATTCCTG
Dipodomys_ordii|7247               GCCAACTTCTTAAAGGTCAGAAACACAGCACACTAC------AGACTGGGGAACTTCCTG
Ochotona_princeps|17067            ACTGAGTTCGTCAAGGTCAGTAAC------------------AGACTCGGGAAATTCCTG
Oryctolagus_cuniculus|21668        GTGGATTTCCTAAAGGACGCAGTGGCCATGGCCGAC------AGACTCGGGCAGTTCCTG
Tupaia_belangeri|1933              ATTGATTTCATAAAGGTTATTAGCATATCTTTTTATCCTAACAGACTCGGGAAATTCTTG
Mus_musculus|39351                 GTGGAGTTCTTAAAGGATGCAGTGGCTATGACTGAC------AGACTGGGGAAATTCCTG
Rattus_norvegicus|2275             GTTGACTTCTTAAAGGATGCAGTGGCTATGACTGAC------AGACTGGGGAAATTCCTG
Cavia_porcellus|1754               GTTGACTTCCTAAAGGATGCATTGGCCATGACTGAC------AGGCTCGGAAAATTTCTG
Microcebus_murinus|18467           GTTGACTTCATGAAGGTCATTGGCATGTCTTTTTACACCAACAGACTCGGGAAGTTCCTG
Callithrix_jacchus|19976           GTGGATTTCATAAAGGATGCAGTGGCTATGGCTGACAGCAACAGACTCGGGAAATTCCTG
Pan_troglodytes|13352              GTGGATTTCATAAAGGTCAGTAATGAAACAAACAAC------AGACTCGGGAAATTCCTG
Gorilla_gorilla|9312               GTGGATTTCATAAAGGATGCAGTGGCTATGGCTGACAGCAACAGACTCGGGAAATTCCTG
Homo_sapiens|29686                 GTGGATTTCATAAAGGATGCAGTGGCTATGGCTGAC------AGACTCGGGAAATTCCTG
                                         ..  .   ..                           .  . ..    ..  ..

Spermophilus_tridecemlineatus|8770 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|8135              AAAACAAAAACAGATGTGGAAATCTCTGCACAGCCAGACTTTGAAGACCAGACCTTGGAC
Otolemur_garnettii|4081            AAAACAAAGACAGACATGGAAATCTCTGCGCAACCTGACTTTGAAGATCAGACCTTAGAC
Dipodomys_ordii|7247               AAAACACAGACCGATGTGGAGATCTCTGCACAACCCGACTTTGAAGACCAGACCTTGGAC
Ochotona_princeps|17067            AAAACCAAAACAGATGTGGAAATCTCCACGCAACCTGACTTTGAAGAGCAGACGATGGAT
Oryctolagus_cuniculus|21668        AAAACAAAAACAGATGTGGAAATCTCTGCACAGCCCGACTTTGAAGAGCAGACCTTGGAC
Tupaia_belangeri|1933              AAAACAAAAACAGATGTGGAAATCTCTACGCATCCTGATTTTGAAGACCAGACCTTGGAC
Mus_musculus|39351                 AAAACCAAAACTGATGTGGAGCTCTCTGCACAACCTGAGTTTGAAGACCAGACCTTGGAC
Rattus_norvegicus|2275             AAGACCAAGACAGACGTGGAACTCTCTGCAAAGCCTGAGTTTGAAGACCAGACCCTGGAC
Cavia_porcellus|1754               AAAACAAAAACAGATGTGGAAATCGCTGCACAGCCTGAGTTTGAAGACCAGACCTTGGAC
Microcebus_murinus|18467           AAAACAAAAACCGATGTGGAAATCTCTGCGCAGCCCGACTTTGAAGACCAGACCCTGGAC
Callithrix_jacchus|19976           AAAACAAAAACAGATGTGGAAATCTCCACACAGCCTGATTTTGAAGACCAGACCTTGGAT
Pan_troglodytes|13352              AAAACAAAAACAGACGTGGAAATCTCTGCACAGCCTGAGTTTGAAGACCAGACCTTGGAT
Gorilla_gorilla|9312               AAAACAAAAACAGACGTGGAAATCTCTGCACAGCCTGAGTTTGAAGACCAGACCTTGGAT
Homo_sapiens|29686                 AAAACAAAAACAGACGTGGAAATCTCTGCACAGCCTGAGTTTGAAGACCAGACCTTGGAT
                                               .   ...   .             .  ....  .    .    . .  

Spermophilus_tridecemlineatus|8770 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|8135              TTCTCTGATGTTGAGCAGTTGATGGGCTCCATTAACACCATTCCAGNNNNNNNNNNNNNN
Otolemur_garnettii|4081            TTCTCTGATGTGGAGCAGCTAATGGGCTCCATTAACACCATTCCAGCTCCTTCTGCTCCA
Dipodomys_ordii|7247               TTCACTGAGGTGGAGCAACTGATGGGGTCAATGAATGCCATTCCAGCTCCCTCCGCTCCG
Ochotona_princeps|17067            TTCTCAGACGTGGAAGAGCTGATGGGCTCCATCAACAGCGTCCCAGCTCCTTCCGCTCCT
Oryctolagus_cuniculus|21668        TTCTCGGACGTGGAAGAGCTGATGGGCTCCATTAACAGCATTCCAGCTCCTTCCGCTCCA
Tupaia_belangeri|1933              TTCTCTGATGTGGAACAGCTGATGGGCTCCATCAACACCATTCCAGCTCCTTCTGCTCCA
Mus_musculus|39351                 TTCTCTGATGTGGAGCAGCTGATGGACGCCATCAATACCATTCCAGCGCCCTCTGCTCCA
Rattus_norvegicus|2275             TTCTCGGATGTGGAACAGCTGATGGACTCCATCAATACCGTTCCAGCTCCCTCTGCTCCA
Cavia_porcellus|1754               TTCTCTGATGTGGAACAGCTGATGGGTTCCATGAACACCATTCTGGCTCCTTCTGCTCCA
Microcebus_murinus|18467           TTCTCTGACGTGGAGCAGCTCATGGGCTCCATCAACGCCGTTCCAGCTCCTTCCGCTCCA
Callithrix_jacchus|19976           TTCTCTGATGTGGAGCAGCTGATGGGATCCATTAACACCATTCCAGCTCCTTCTGCTCCA
Pan_troglodytes|13352              TTCTCTGATGTGGAGCAGCTGATGGGATCCATTAACACCATTCCAGCTCCTTCTGCTCCA
Gorilla_gorilla|9312               TTCTCTGATGTGGAGCAGCTGATGGGCTCCATTAACACCATTCCAGCTCCTTCTGCTCCA
Homo_sapiens|29686                 TTCTCTGATGTGGAGCAGCTGATGGGCTCCATTAACACCATTCCAGCTCCTTCTGCTCCA
                                   ..    .  .. .      .  ...      .        .    .     .  . .   

Spermophilus_tridecemlineatus|8770 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|8135              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|4081            GTGATAAATCCGCAGGACCCCAACTCATGCATGCGTGCCTCAGTCCGAGAGTGCTGGAGC
Dipodomys_ordii|7247               GTGATAAATCGGCAGGCCCCCAACTCGGCCACCAGCTCCTCTGTCCGGGTGTGCTGGAGC
Ochotona_princeps|17067            GTAATAAATCCCCAAGCCCCCAACTCCGCCACGGGATCCTCAGTGCGCGTGTGCTGGAGT
Oryctolagus_cuniculus|21668        GTGATCAATCCCCAGGCCCCCAACTCGGCCACGGGCTCCTCGGTCCGCGTGTGCTGGAGC
Tupaia_belangeri|1933              GTGATAAACCCACAGGCGCCCAACTCAGCCACGGGTTCTTCAGTCCGAGTGTGCTGGAGC
Mus_musculus|39351                 GTGATAAATCCCCAGGCACCCAACTCCGCCACCGGCTCCTCAGTGCGTGTATGCTGGAGC
Rattus_norvegicus|2275             GTGATAAATCCCCAGGCACCCAACTCAGCAACTGGCTCCTCGGTGCGTGTGTGCTGGAGT
Cavia_porcellus|1754               GTGATAAATCCACAGGCCCCCAACTCAGCCACAGGTTCCTCTGTCCGGGTGTGCTGGAGT
Microcebus_murinus|18467           GTGATAAATCCGCAGGCCCCCAACTCAGCCACGGGTTCCTCGGTCCGAGTGTGCTGGAGC
Callithrix_jacchus|19976           GTCATAAATCCACAAACCCCTAACTCAGCCACAGGTTCCTCAGTCCGAGTGTGCTGGAGC
Pan_troglodytes|13352              GTCATAAATCCACAGGTCCCTAACTCAGCCACAGGTTCCTCAGTCCGAGTGTGCTGGAGC
Gorilla_gorilla|9312               GTCATAAATCCACAGGTCCCTAACTCAGCCACAGGTTCCTCAATCCGAGTGTGCTGGAGC
Homo_sapiens|29686                 GTCATAAATCCACAGGTCCCTAACTCAGCCACAGGTTCCTCAGTCCGAGTGTGCTGGAGC
                                   ..  .                   .         .    .   .  . .  .. ... . 

Spermophilus_tridecemlineatus|8770 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|8135              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|4081            TTGAACTCCGATGACACTGTGGAGAGCTACCAGCTGTCCTACTCGCCAGAGCAGTATATC
Dipodomys_ordii|7247               TTGCACTCCGACGACACGGTGGAGCGCTACCAGCTGTGCTACCGGCCTGCGCAGGACGGC
Ochotona_princeps|17067            TTGTACTCTGATGACACGGTGGAGAGCTACCAGCTGTCCTACCGGCTGGTGCAGGACGGC
Oryctolagus_cuniculus|21668        TTGTACTCCGATGACACCGTGGAGAGCTACCAGCTGTCCTACAGGCCAGTAGGGGACGGC
Tupaia_belangeri|1933              TTATACTCTGATGACACAGTGGAGAGTTACCAGTTGTCCTACCGGCCAGTGAGGGACAGC
Mus_musculus|39351                 TTATATTCTGACGACACCGTGGAGAGCTACCAGCTGTCCTATAGGCCGGTGCAGGACAGC
Rattus_norvegicus|2275             TTATACTCTGATGACACCGTGGAGAGCTATCAGCTGTCCTACAGGCCGGTGCAGGACAGC
Cavia_porcellus|1754               TTATATGCCGATGACACTGTGGAGAGCTATCAGTTGTCCTACCGGCCAGTGCGGGACAGC
Microcebus_murinus|18467           TTGTACTCGGATGACACAGTGGAGCGCTACCAGCTGTGCTACCGGCCAGTGCGGGACAGC
Callithrix_jacchus|19976           TTATACTCCGATGACACTGTGGAGAGCTATCAACTGTCCTACCGGCCAGTGCAGGACAGC
Pan_troglodytes|13352              TTATACTCCGACGACACTGTGGAGAGCTATCAGCTGTCCTACCGGCCAGTGCAGGACAGC
Gorilla_gorilla|9312               TTATACTCCGACGACACTGTGGAGAGCTATCAGCTGTCCTACCGGCCAGTGCAGGACAGC
Homo_sapiens|29686                 TTATACTCCGACGACACTGTGGAGAGCTATCAGCTGTCCTACCGGCCAGTGCAGGACAGC
                                   ..       .  .     .... . . .      ...  .    .   .    .      

Spermophilus_tridecemlineatus|8770 NNNNNNNNNNNNNNNNNNNNNNAGTTTACAGTGACCGTCAAAGAAACATATTGCTCAGTG
Tarsius_syrichta|8135              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|4081            TCATCTGGACAGAACCGAGCAAAGTTCACTGTGACCATCAAAGAAACATATTGCTCAGTG
Dipodomys_ordii|7247               TCTCCCCACAAGGACCACGCGGAATTTACAGTGACAGTCAAAGAAACATACTGCTCGGTG
Ochotona_princeps|17067            TTGCCCGGGAAAGGCCAAGCAGAATCTACAGTGACCGTCAAAGAAACATACTGCTCCGTG
Oryctolagus_cuniculus|21668        TCGCCCGGGAAGGACCAAGCAGAGTTTACAGTGACTGTCAAGGAAACATACTGCTCAGTG
Tupaia_belangeri|1933              TCTCCTGGGAAGGACCAGGCAGAGTTTACAGTGACCGTCAAAGAAACATACTGCTCAGTG
Mus_musculus|39351                 TCATCTGGCAAGGACCGAGCAGAATTCACCATGATGGTCAAAGAAACATATTGCTCAGTG
Rattus_norvegicus|2275             TCACCTGGCAAGGACCAAGCAGAGTTCACCATGACGGTCAAAGAAACATATTGCTCAGTG
Cavia_porcellus|1754               CTACCTGGAAAGGAGCAAGCAGAGTTTACAGTGACCGTCAAAGAATCGTACTGCTCAGTG
Microcebus_murinus|18467           TCACCTGGGAAGGACCAAGCGGAGTTTACTGTGACTGTCAAAGAAACATATTGCTCAGTG
Callithrix_jacchus|19976           TCACCTGGGAAGGACCAAGCAGAGTTTACAATGACCATCAAAGAAACATATTGCTCAGTG
Pan_troglodytes|13352              TCACCTGGGAAGGACCAAGCAGAGTTTACAGTGACTGTCAAAGAAACATATTGCTCAGTG
Gorilla_gorilla|9312               TCACCTGGAAAGGACCAAGCAGAGTTTACAGTGACCGTCAAAGAAACATATTGCTCAGTG
Homo_sapiens|29686                 TCACCTGGGACGGACCAAGCAGAGTTTACAGTGACTGTCAAAGAAACATATTGCTCAGTG
                                                     .     .      ..    .    .     .  .. .  ...

Spermophilus_tridecemlineatus|8770 GCAAACCTTGAACCAAATACCCAGTATGAATTTTGGGTCATTGCTCAGAACAGAGCTGGC
Tarsius_syrichta|8135              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|4081            ATGAAACTTGTGCCGAATACACAGTATGAATTTTGGGTGACGGCTCATAACAGAGCTGGC
Dipodomys_ordii|7247               CGAAACCTTGAGCCCAATACGCAGTATGAATTCTGGGTCATAGCAGAGAACAGGGCAGGA
Ochotona_princeps|17067            AAAAACCTCGCACCGAACAGTCAGTATGAGTTTTGGGTCACAGCTCAGAACAGGGCTGGC
Oryctolagus_cuniculus|21668        AAGAACCTTATGCCCAACACCCAGTATGAATTCTGGGTCACAGCTCAGAACAGGGCTGGC
Tupaia_belangeri|1933              ACAAACCTCGTGCCCAATACCCAGTATGAATTTTGGGTCACAGCTCAGAATAGGACTGGT
Mus_musculus|39351                 ACAAATCTTGAGCCAAATACTCAGTATGAGTTTTGGGTCATAGCTCAGAACAGGACTGGC
Rattus_norvegicus|2275             AAAAATCTTGAGCCAAATACCCAGTATGAGTTTTGGGTCATAGCTCAAAACAGGACCGGC
Cavia_porcellus|1754               ACAAACCTTGAACCAAATACCCAGTATGAATTCTGGGTCATAGCTCAGAACAGAGCTGGC
Microcebus_murinus|18467           ATGAAACTTGTGCCAAATACTCAGTACGAATTTTGGGTGACAGCTCATAACAGGGCTGGC
Callithrix_jacchus|19976           ACAGACCTTGTGCCAAATACCCAGTATGAATTTTGGGTCACAGCTCACAACAGGGCTGGC
Pan_troglodytes|13352              ACAAACCTTGTGCCAAATACCCAGTATGAATTTTGGGTCACAGCTCACAACAGGGCTGGC
Gorilla_gorilla|9312               ACAAACCTTGTGCCAAATACCCAGTATGAATTTTGGGTCACAGCTCACAACAGGGCTGGC
Homo_sapiens|29686                 ACAAACCTTGTGCCAAATACCCAGTATGAATTTTGGGTCACAGCTCACAACAGGGCTGGC
                                          .               ..  .  .. .....    .         .    .. 

Spermophilus_tridecemlineatus|8770 CCCAGTCCTTCCAGCGAGCGTGCAGTATACATGACA------GCCCCATCTCCTCCCATT
Tarsius_syrichta|8135              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNN
Otolemur_garnettii|4081            TCCAGCCCTCCGAGTGAGCACGCAGTGTACATGACA------GCACCTTCTCCCCCCATC
Dipodomys_ordii|7247               CCCAGCCCAAGCAGTGAAGTCGCCACATACGTGACA------GCGCCCTCTCCGCCGGTG
Ochotona_princeps|17067            TCAAGCCCTGCCAGCGAGCGTGCTGTGTATGTAACA------GCTCCATCTCCCCCCATC
Oryctolagus_cuniculus|21668        TCGAGCCCCTCCAGCGAGCGTGCTGTGTACATGACA------GCCCCTTCTCCCCCCATC
Tupaia_belangeri|1933              CCCAGCCCCTCCAGTGAGCGTGCAGTGTACATGACA------GCCCCTTCCCCTCCCATT
Mus_musculus|39351                 CCCAGCCCCTGCAGTGAGCACGCAGTGTATATGACA------GCCCCCTCTCCCCCCTCT
Rattus_norvegicus|2275             CCCAGCCCCTCTAGTGAGCACGTAGTGTATATGACA------GCCCCCTCTCCTCCCTCT
Cavia_porcellus|1754               CCCAGCCCCTCCAGTGAACATGCAATGTACATGACA------GCCCCTTCTCCCCCCATT
Microcebus_murinus|18467           CCCAGCCCCCCCAGCGAGCGTGCAGTGTACATGACA------GCGCCTTCGCCCCCCATT
Callithrix_jacchus|19976           CTGAGCCCCTCCAGCGAGCGTGCAGTGTACGTGACAGATTTAGCGCCTTCTCCCCCCATC
Pan_troglodytes|13352              CCCAGCCCCTCTAGCGAGCGTGCAGTGTACATGACA------GCACCTTCTCCCCCCATT
Gorilla_gorilla|9312               CCCAGCCCCTCTAGCGAGCGTGCAGTGTACATGACAGATTTAGCACCTTCTCCCCCCATT
Homo_sapiens|29686                 CCCAGCCCCTCTAGCGAGCGTGCAGTGTACATGACA------GCACCTTCTCCCCCCATT
                                       .        . .     .     .   .          .     .           

Spermophilus_tridecemlineatus|8770 ATAAAAAGCAAAGAGATAAGGAGCTGTGAAGAGGCTGCATTCATTTGCTGGGAGTCTGGG
Tarsius_syrichta|8135              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|4081            ATCAAAACCAAAGAGATAAGAAGCTGTGAGGAGGCGGCGCTGATTTGCTGGGAGTCTGGG
Dipodomys_ordii|7247               ATAAGGTGCGAGGAGATCAGGAGCTGTGAGAGGGCTGCTCTCATCAGCTGGGAGTCAGGG
Ochotona_princeps|17067            ATAAAAGTCAAGGAGATCCGGAGCTGTGAAGAGGCTGCGCTCATTTGCTGGGAGTCCGGG
Oryctolagus_cuniculus|21668        ATAAAAAGCAAAGAGATACGGAGCTGCGAAGAGGCTGCGCTCATCTGCTGGGAGTCCGGG
Tupaia_belangeri|1933              ATAAAGAGGAAGGAGATAAGGAGCTGTGAAGAGGCCGCGCTGATTTGCTGGGAGTCTGGA
Mus_musculus|39351                 ATAAAAACCGAGGCAATCAGAAGCTGTGAAGAGGCTGTGCTGATTTGCTGGGAGTCTGGG
Rattus_norvegicus|2275             ATAAAAACCGAGGCAATCAGGAGCTGTGAAGAGGCCGTGCTGATTTGCTGGGAGTCTGGA
Cavia_porcellus|1754               ATAAAAACTGAGGCGATAAGGAGCTGTGAAGAGGCTGCGCTCATCTGCTGGGAGTCTGGG
Microcebus_murinus|18467           ATAAAAACCCAAGAGATAAGAAGCTGCGAAGAGGCCGCCCTGATCTGCTGGGAGTCTGGA
Callithrix_jacchus|19976           ATAAAAACCAAAGAGATAAGGAGCTGTGAAGAGGCTGTGCTGATCTGCTGGGAGTCTGGG
Pan_troglodytes|13352              ATTAAAACCAAAGAGATAAGGAGCTGTGAAGAGGCTGTGCTGATTTGCTGGGAGTCTGGG
Gorilla_gorilla|9312               ATTAAAACCGAAGAGATAAGGAGCTGTGAAGAGGCTGTGCTGATTTGCTGGGAGTCTGGG
Homo_sapiens|29686                 ATTAAAACCAAAGAGATAAGGAGCTGTGAAGAGGCTGTGCTGATTTGCTGGGAGTCTGGG
                                    .          .   .  .  . .. .    ..  .   .  .  . .... ..  .. 

Spermophilus_tridecemlineatus|8770 AATCTGAATCCTGTGGACTCATACACAGTGGAGCTGACCCAAGCAGAAACACCAGAAGCC
Tarsius_syrichta|8135              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|4081            AACCTGAATCCCGTGGACTCATACACCATGGAGCTGACCCAGGCAGAAAGGCCGGAGGCT
Dipodomys_ordii|7247               AACCGGAGCCCGGTGGACTCGTACACCGTGGAGCTGACGCTGGCAGAGACTCCGGAGGCC
Ochotona_princeps|17067            AGCCTGAACCCCGTGGACTCGTATACGGTGGAGCTGACCCAGGGGGAGACGCCGGAAGCC
Oryctolagus_cuniculus|21668        AGCCTGAACCCCGTGGACTCGTACACAGTGGAGCTGACCCAGGCGGAGGCGCCGCAAGCC
Tupaia_belangeri|1933              AACCTGAATCCGGTGGACTCGTACACAGTGGAGCTAATCCAGGCAGATACGCCAGAAGCC
Mus_musculus|39351                 AACCTGAATCCGGTGGACTCCTACACGGTGGAGCTAATCCAGGCAGAGACGCCAGAAGCC
Rattus_norvegicus|2275             AACCTGAATCCCGTGGACTCCTACACAGTGGAGCTAATCCAGGCAGAGACGCCAGAAGCC
Cavia_porcellus|1754               AACCTGAATCCCGTGGACTCCTACACGGTGGAGCTGACCCAAGTGGAAGAACCAGCAGCC
Microcebus_murinus|18467           AACCTGAACCCCGTGGACTCCTACACCGTGGAGCTGACCCGTGCAGAGGGGCCAGAGGCC
Callithrix_jacchus|19976           AACCTGAATCCTGTGGACTCGTACACCGTGGAGCTGACCCAGGCTGAAAGTCCAGAAGCC
Pan_troglodytes|13352              AACCTGAATCCTGTGGACTCGTACACTGTGGAGCTGACCCAGGCTGAAAGTCCAGAAGCC
Gorilla_gorilla|9312               AACCTGAATCCTGTGGACTCGTACACTGTGGAGCTGACCCAGGCTGAAAGTCCAGAAGCC
Homo_sapiens|29686                 AACCTGAATCCTGTGGACTCGTACACTGTGGAGCTGACCCAGGCTGAAAGTCCAGAAGCC
                                        .      ....  .  .      ... . .       .  .           .  

Spermophilus_tridecemlineatus|8770 TTGGGAGTAACTGAGTCTGTTGTGGGCATCCCAACCTGTGAGACCCTGATACAGCTACAG
Tarsius_syrichta|8135              NNNNNNNNNNNNNNGTCCATCGTGGGAATTCCGACCTGTGAGGCCCTGTTGCAGCTGCAG
Otolemur_garnettii|4081            GCAGGTGTAACTGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|7247               TCGGGCGTGACCGAGTCGGTCGTGGGCATCCCAACCTGCGAGTCCCTGATACAGCTGCTG
Ochotona_princeps|17067            TCGGGTGTCACTGAGTCAATCGTGGGCATCCCGACCTGCGAGGCCCTGGTGCGGCTGCAA
Oryctolagus_cuniculus|21668        TGGGGCGTCACAGAGTCCATCGTGGGCATCCCTACCTGCGAGGCCCTGGTGCAGCTGCAA
Tupaia_belangeri|1933              TCGGGTGTGACAGAGTCTGTTTGTGGCATCCCA---TATGAAGCCCTGGTCCAGCTGCAG
Mus_musculus|39351                 TCGGGGGTAACTGAATCTGTCGTAGGCATCCCAACCTGTGAATCCCTGATACAGCTGCAG
Rattus_norvegicus|2275             TCGGGGGTAACTGAATCTGTTGTAGGCATCCCAACCTGTGAATCCCTGATACAGCTACAG
Cavia_porcellus|1754               TCAGGGGTCACCGAGTCTGTGGTGGGCATCCCAATCTGTGAGTCACTGATACAGCTGCAG
Microcebus_murinus|18467           CCCGGCGTGACTGAGTCCGTCGTGGGCATCCCGACCTGCGAGTCCCTGGTGCAGCTGCAG
Callithrix_jacchus|19976           TCAGGTGTAACTGAGTCTGTTGTGGGCATCCCAACCTGTGAATCTCTGGTGCAGCTGCAG
Pan_troglodytes|13352              TCGGGTGTAACTGAGTCTGTTGTGGGCATCCCGACCTGCGAGTCCGTGGTGCAGCTGCAG
Gorilla_gorilla|9312               TCGGGTGTAACTGAGTCTGTTGTGGGTATCCCGACCTGCGAGTCCGTGGTGCAGCTGCAG
Homo_sapiens|29686                 TCGGGTGTAACTGAGTCTGTTGTGGGCATCCCGACCTGCGAGTCCGTGGTGCAGCTGCAG
                                      .. ..    .  .   .    ..  .       .  .      .. .   . .    

Spermophilus_tridecemlineatus|8770 CCCAGGCAGTGCTATACCATCTACGTGAGAGCCCTCAATGTTGGGGGTCCCAGCGCCAGG
Tarsius_syrichta|8135              CCCGGGCAGAGTTACGTGATCTATGTGCGAGCCCTCAATGTGGGGGGCCCCAGTGCAAGG
Otolemur_garnettii|4081            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|7247               CCCGGGCAGCGCTACATCATCTACGTGCGTGCCCTGAACGTGGGAGGCTCCAGCGCCAGG
Ochotona_princeps|17067            CCCAAGCAGAGCTACACCATTTATGTGCGAGCCCTCAACATGGGGGGCCTGAGCACGAGG
Oryctolagus_cuniculus|21668        CCCAGGCAGAACTACACGATCTACGTGCGCGCCCTCAATGTCGGGGGCCCCAGCGCAAGG
Tupaia_belangeri|1933              CCCGGGCAGAGCTTCACGGTCTACGTG---GCCTTCAGCGTGGGAGGCCTCAGTGCCAGG
Mus_musculus|39351                 CCTAGACACAGCTATACCATCTATGTGCGAGCCCTCAACGTGGGAGGCACCAGTGCCAGA
Rattus_norvegicus|2275             CCTAGACACAGCTACACGATCTACGTTCGAGCCCTGAATGTGGGGGGCACCAGTGCCAGA
Cavia_porcellus|1754               CCCGGGCAGAGCTACACGATCTGCGTCCGAGCCCTCAACGTGGGGGGTCCCAGTGCCAGA
Microcebus_murinus|18467           CCCGGGCAAAGCTACCTGATCTACGTGCGGGCCCTCAACGTGGGCGGCCCCAGCGCCAGG
Callithrix_jacchus|19976           CCGGGACAGAGCTACGTTATCTATGTGCGAGCCCTCAACACGGGAGGCCCCAGCACGAGG
Pan_troglodytes|13352              CCGGGGCGGAGCTACATTATCTATGTGCGAGCCCTCAACATGGGGGGCCCCAGCGTGAGG
Gorilla_gorilla|9312               CCGGGGCGGAGCTACATTATCTATGTGAGAGCCCTCAACATGGGGGGCCCCAGCGTGAGG
Homo_sapiens|29686                 CCGGGGCGGAGCTACATTATCTATGTGCGAGCCCTCAATATGGGGGGCCCCAGCGTGAGG
                                               .      . .  ..    .   .       .. ..     .     . 

Spermophilus_tridecemlineatus|8770 AGTGATCCTGCTACAGTCCACACCACAGGTCTNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|8135              AGTGAGCCTGCCACAGTCCATACCACAGGAAGCTACTTTCACCTGAACAAGGACACCTGT
Otolemur_garnettii|4081            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|7247               AGCCAGCCTGCCACGGTCCACACGACAGGCACCGTCTTCCACCTGAACAAGGACACCTGC
Ochotona_princeps|17067            AGCAAGCCGGCCACGGTCCACACCACAGGGAGCTACTTTCACCTTGACAAGGACACCTGC
Oryctolagus_cuniculus|21668        AGCGAGCCGGCTACGGTCCACACCACAGGAAGCTACTTCCACCTGAACAAGGACACCTGC
Tupaia_belangeri|1933              AGGAATCCTGTTCCGGTCCACACCTCAGGTCTCTACTTTCACCTAAACAAGGACACCTGC
Mus_musculus|39351                 AGTGAGCCTGCTACAGTGCACACCACAGGAAGCTACTTCCAATTGAACAAAGACACCTGC
Rattus_norvegicus|2275             AGCAAGCCTGCTACAGTACACACCACAGGAAGCTACTTCCAACTGAACAAGGACACCTGC
Cavia_porcellus|1754               AGCACTCCGGCTACGGTCCGCACCACAGGAAGCTACTTTCCCTTGAACAAGGCCACCTGC
Microcebus_murinus|18467           AGCCGGCCTGCGACAGTCCATACCACAGGTCTCTACTTCCACCTAAACAAGCACACCTGC
Callithrix_jacchus|19976           AGCGAGCCTGCTACAGTCCATACCATAGGAAGCTACTTTCGCCTAAACAAGGACACCTGC
Pan_troglodytes|13352              AGCGAGCCAGCTACAGTCCACACCATAGGAAGCTACTTTCGCCTAAACAAGGACACCTGC
Gorilla_gorilla|9312               AGCGAGCCAGCTACAGTCCACACCATAGGAAGCTACTTTCGCCTAAACAAGGACACCTGC
Homo_sapiens|29686                 AGCGAGCCAGCTACAGTCCACACCATAGGAAGCTACTTTCGCCTAAACAAGGACACTTGC
                                    .       .     ..          ..       ..     .             .. 

Spermophilus_tridecemlineatus|8770 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNN
Tarsius_syrichta|8135              CATCCCTGGCTGACCATTTCTGAAGATGGGCTTACAGTCACACGAAGCCAA---AGGAAA
Otolemur_garnettii|4081            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNN
Dipodomys_ordii|7247               CACCCCGCGCTGACCATTTCTGAGGACGGGTTGACGGTGCTTCGAAACGAA---AGGAAA
Ochotona_princeps|17067            CACCCTTGCCTGACCATTTCTGAAGACGGATTTACACTCACGCGAAGTGAA---AGGAAA
Oryctolagus_cuniculus|21668        CACCCCTGGCTGACCATTTCTGAAGACGGTTTTACAGTCATGCGAAGCGAA---AGGAAA
Tupaia_belangeri|1933              CATCCATGGCTGACCATTTCTGAAGACGGGTTTACAGTCGTAAGAAGAGAA---GGGAAA
Mus_musculus|39351                 CATCCCTGGCTGACCATTTCTGAAGATGGGTTTACGGTAGTTCGAAGTGAG---AAGAAA
Rattus_norvegicus|2275             CACCCCTGGCTGACCATTTCTGAAGACGGGTTTACCGTGGTTCGAAGTGAGAAGAAGAGA
Cavia_porcellus|1754               CACCCATGGCTGACCATTTCAGAAGATGGATTTACGGTGATCCGGAGTGAG---AGGAAA
Microcebus_murinus|18467           CACCCCTGGCTGACCGTTTCTGAAGACGGGTTTACAATTGTCCGGAGCCAA---AGGAAA
Callithrix_jacchus|19976           CATCCCTGGCTGACAATTTCTCAAGATGGACTTACAATCCTACGAAGTGAA---AGGAGT
Pan_troglodytes|13352              CATCCCTGGCTGACCATTTCTGAAGACGGACTTACGGTTGTACGAAGTGAA---AGGAGA
Gorilla_gorilla|9312               CATCCCTGGCTGACCATTTCTGAAGACGGACTTACGGTTGTACGAAGTGAA---AGGAGA
Homo_sapiens|29686                 CATCCCTGGCTGACCATTTCTGAAGACGGACTTACGGCTGTACGAAGTGAA---AGGAGA
                                             ..    ...     .  ..  .           .            .   

Spermophilus_tridecemlineatus|8770 NNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNG------TGTGTT
Tarsius_syrichta|8135              ATTTCTGTAAAGGAGTCG---CTGTCCAGCCATACCCGCTTTACCAGG------TGTGTT
Otolemur_garnettii|4081            NNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNG------TGTACT
Dipodomys_ordii|7247               ACCCCAGCTCGGGAGCCA---CCGCCCAGCCGGAGCCGCTTCAGCAGG------TGTGCT
Ochotona_princeps|17067            GCCTCCACCAGGGAGGTGGCAGCCAGCAGCAACGTTCGGTTCACCAGG------TGTGTT
Oryctolagus_cuniculus|21668        ACCCCCATGAGGGAGCCA---CTGGCCAGCAACACTCGGTTTACCAGG------TGCGTT
Tupaia_belangeri|1933              GCCTGGGTGAAGGAGCTG---CCACCCGACAGCACCCGATTTACCAGG------TGTGCT
Mus_musculus|39351                 AGTTTCAGAAAGGAGCTG---CCGCCGAGCAAGACGCAATTTACCAGG------TGTGTT
Rattus_norvegicus|2275             AGTTTCAGAAGGGAGCTG---CCACCCAGCAAGGCGCAGTTTACCAGG------TGCGTT
Cavia_porcellus|1754               AACCTCACCCAGGAGCTG---CAGCCCCAGCAGACCCAGTTCACCAGG------TGTGTT
Microcebus_murinus|18467           ACGCCCGAGAGGGAGCCA---CCACCCAGCGACACCCGGTTTACCAGG------TGTGTT
Callithrix_jacchus|19976           ACCCCCACCAAGGAGCCA---CCACCCAGTGACACCCACTTCACCAGAACCAGGTGTGTT
Pan_troglodytes|13352              ACCCCCGCCAGGGAGCTG---TCACCCAGCGACACTCACTTCACCAGG------TGTGTT
Gorilla_gorilla|9312               ACCCCTGCCAGGGAGCTG---TCACCCAGCGACACTCACTTCACCAGG------TGTGTT
Homo_sapiens|29686                 ACCCCCGCCAGGGAGCTG---TCACCCAGCGACACTCACTTCACCAGG------TGTGTT
                                              .. .                        ..     ..      ** . *

Spermophilus_tridecemlineatus|8770 GCTGTCATGGGAAATCTAATTCCAGTCCGAGGGCACCACTACTGGGAGGTGGAGGTGGAT
Tarsius_syrichta|8135              GCTGTCATGGGAAATCTAATTCCTGTCCGAGGGCGCCATTACTGGGAGGTGGAGGTGGAC
Otolemur_garnettii|4081            GAC---ATGGGAAATCTGATCATGGTTCGA------TGCTATTACGACGTGGAGGTGCAT
Dipodomys_ordii|7247               GCTGTCATGGGAAATCTAATCCCCGTCCGAGGCCGCCATTACTGGGAGGTGGAGGTGGAT
Ochotona_princeps|17067            GCAGTCCTGGGGAACCTGATCCCGATCCGAGGACGCCACTACTGGGAGGTGGAGGTGGGC
Oryctolagus_cuniculus|21668        GCTGTCCTGGGAAACCTGATTCCAGTCCGAGGACGCCACTACTGGGAGGTGGAGGTGGAT
Tupaia_belangeri|1933              GCTGTCATGGGAAGTCTGATTCCAGTGCGAGGGCGCCATTACTGGGAGGTGGAAGTGGAC
Mus_musculus|39351                 GCTGTCATGGGGAATCTGATTCCGGTCCGAGGGCGCCATTACTGGGAAGTGGAGGTGGCT
Rattus_norvegicus|2275             GCTGTCATGGGAAATCTAATTCCGGTCCGAGGACGCCATTACTGGGAGGTGGAGGTGGAT
Cavia_porcellus|1754               GCCATCATGGGAAATCTAATTCCGGTTCGAGGGCGCCATTACTGGGAGATAGAAATGGAT
Microcebus_murinus|18467           GCTGTCATGGGAAATCTAATTCCAGTCCGAGGGCGCCATTACTGGGAGGTGGAGGTGGAT
Callithrix_jacchus|19976           GCTGTCATGGGAAATCTAATTCCAGTCCGAGGGCACCATTATTGGGAGGTGGAGGTGGAT
Pan_troglodytes|13352              GCTGTCATGGGAAATCTAATTCCAGTCCGAGGGCACCATTACTGGGAGGTGGAGGTGGAT
Gorilla_gorilla|9312               GCTGTCATGGGAAATCTAATTCCAGTCCGAGGGCACCATTACTGGGAGGTGGAGGTGGAT
Homo_sapiens|29686                 GCTGTCATGGGAAATCTAATTCCAGTCCGAGGGCACCATTACTGGGAGGTGGAGGTGGAT
                                   *.    .****.*. **.** .  .* ***       . ** *. ** .*.**..**   

Spermophilus_tridecemlineatus|8770 GAGTGTTTGGACTACACAGTGGGTGTGGCCTTTGAAGATGTCCCTAAGCAGGAAGACTTG
Tarsius_syrichta|8135              GAGCATTTGGACTACACAGTTGGTGTGGCCTTTGAAGATGTACCGAAACAGGAGGACCTG
Otolemur_garnettii|4081            GAG---TTGGACTACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|7247               GAACACTCTGACTACACCGTGGGCGTGGCCGCTGAGGACATCCCCAGACAGGAGGACCTC
Ochotona_princeps|17067            GAGAGATTGGACTACATGGTCGGTGTGGCCTTTGAGGAAGTCCCCAGGCACGAGGACCTG
Oryctolagus_cuniculus|21668        GAGTGCCTGGACTACACCATCGGCGTGGCCTTTGAAGAGGTGCCTAGACACGAGGACCTG
Tupaia_belangeri|1933              GAGCGTGTGGACTACACGGTTGGTGTGGCCTTTGAAGATGTCCCCAAACACGAGGACCTG
Mus_musculus|39351                 GAGCATTTGGACTACACTGTGGGTGTGGCCTGTGAAGATGTCCCTAAGCAGGAAGACCTG
Rattus_norvegicus|2275             GAGCATTTGGACTACACTGTTGGTGTGGCCTGTGAAGATGTCCCTAAACAGGAAGACCTG
Cavia_porcellus|1754               GAACATTTGGACTACACGGTTGGTGTCGCCTTTGAAGATGTCCCTAAGCAGGAGGATCTG
Microcebus_murinus|18467           GAGCGTTTGGACTACACAGTTGGTGTGGCCTTTGAAGATGTCCCTAAACAGGAGGACCTG
Callithrix_jacchus|19976           GAGCATTTGGACTACACAGTTGGTGTGGCCTTTGAAGATGTCCCTAAACAGGAGGATCTG
Pan_troglodytes|13352              GAGCATTTGGACTACAGAGTTGGTGTGGCCTTTGCAGATGCCCCTAAACAGGAGGATCTG
Gorilla_gorilla|9312               GAGCATTTGGACTACACAGTTGGTGTGGCCTTTGCAGATGTCCCTAAACAGGAGGATCTG
Homo_sapiens|29686                 GAGCATTTGGACTACAGAGTTGGTGTGGCCTTTGCAGATGTCCGTAAACAGGAGGATCTG
                                   **.      ******    . .. .. .    ..  .              .  .   . 

Spermophilus_tridecemlineatus|8770 GGAGCAAACTGCTACTCCTGGTGCATGAGGCACACATTTGCATCATCA------------
Tarsius_syrichta|8135              GGAGCAAACTGCTTCTCCTGGTGCATGAGGCACACATTTGCATCTTCAAGGCATAAGTAT
Otolemur_garnettii|4081            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCATAAGTAT
Dipodomys_ordii|7247               GGGGCAAGCCCGCAGGCCTGGTGCCTGAGGCACACATTCTCCTCATCCAGGCACAAATAT
Ochotona_princeps|17067            GGTGCAAACCGCCTCTCTTGGTGTATGCGGCACACGTACGCATCCTTGAGGCATAAGTAT
Oryctolagus_cuniculus|21668        GGCGCCAACCGCCTCTCCTGGTGCCTGAGGCACACATTCGCCTCATCAAGGCACAAGTAT
Tupaia_belangeri|1933              GGAGCGACCCGCCTCTCCTGGTGCATGAGGCACACATTTGCTTCATCGAGGCATAAGTAC
Mus_musculus|39351                 GGAGCAAACTCCTTGTCCTGGTGCATGAGGCATACATTTGTTTCCAAAAGGCACCGGTAT
Rattus_norvegicus|2275             GGAGCAAACCGCTTGTCCTGGTGCATGAGGCATACATTTGCCTCCACAAGGCACCGGTAT
Cavia_porcellus|1754               GGTGCAAATGGCTTCTCCTGGTGCATGAGGCACACATTTGCTTCATCAAGGCATAAGTAT
Microcebus_murinus|18467           GGAGCAAACAGCCTTTCCTGGTGCATGAGGCACACATTTGCATCATCAAGGCATAAGTAT
Callithrix_jacchus|19976           GGAGCAAACTGCCTCTCCTGGTGCATGAGGCACACATTTGCATCATCAAGGCATAAGTAT
Pan_troglodytes|13352              GGAGCAAATTGCCTCTCCTGGTGCATGAGGCACACATTTGCATCATCAAGGCATAAGTAT
Gorilla_gorilla|9312               GGAGCAAATTGCCTCTCCTGGTGCATGAGGCACACATTTGCATCATCAAGGCATAAGTAT
Homo_sapiens|29686                 GGAGCAAATTGCCTCTCCTGGTGCATGAGGCACACATTTGCATCATCAAGGCATAAGTAT
                                   .. .              .....  .. ..      .     .                 

Spermophilus_tridecemlineatus|8770 ------------------------------------------------------------
Tarsius_syrichta|8135              GAATTTCTGCACAACAGAACAACTCCAGATATAAGAGTAACTGTTTCCCCAAAGAAGATT
Otolemur_garnettii|4081            GAATTTCTGCACAACAGAACAACTCCAGATATGAGAATAACATGTCCCCCAAAGAAGATT
Dipodomys_ordii|7247               GAATTTCTGCACAACGGGAAAACACCAGACATAAGAATAACAGTAGCACCGAAGCAGATC
Ochotona_princeps|17067            GAATTTCTACACAACAGGACAACTCCAGATCTGAGAATTACAGTGCCCCCGAAGACGGTT
Oryctolagus_cuniculus|21668        GAATTTCTGCACAACAAGACAAGCCCAGATACGAGAATAACAGTTCCCCCGAGGAGGATC
Tupaia_belangeri|1933              GAATTTCTGCACAACAGGACATCTCCAGATATACGAATAACAGTTTCCCCAAAGAAGATT
Mus_musculus|39351                 GAGTTTCTGCACAACAAGATGACTCCAGACATCAGGATCACAGTTGCTCCGAGGAAGATT
Rattus_norvegicus|2275             GAGTTTCTGCACAATGGGACAACTCCAGACATAAGGATCACAGTTGCTCCAAAGAAGATC
Cavia_porcellus|1754               GAATTTCTGCACAACAGGACAACTCCAGATATAAGAATAACTGTTCCTCCAAAGAAGATT
Microcebus_murinus|18467           GAATTTCTGCACAACAGAACAACTCCAGATATAAGAATAACAGTTCCGCCAAAGAAGATT
Callithrix_jacchus|19976           GAATTTCTACACAACAGAACAACTCCAGATATAAGAATAACAGTTCCTCCAAAGAAGATT
Pan_troglodytes|13352              GAATTTCTGCACAACAGAACAACTCCAGATATAAGAATAACAGTTCCACCAAAGAAGATT
Gorilla_gorilla|9312               GAATTTCTGCACAACAGAACAACTCCAGATATAAGAATAACAGTTCCACCAAAGAAGATT
Homo_sapiens|29686                 GAATTTCTGCACAACAGAACAACTCCAGATATAAGAATAACAGTTCCACCAAAGAAGATT
                                                                                               

Spermophilus_tridecemlineatus|8770 ------------------------------------------------------------
Tarsius_syrichta|8135              GGCATTCTGTTAGACTATGAAAATTCCAAGTTGTCATTTTTCAACGTGGACATTTCTCAG
Otolemur_garnettii|4081            GGCATTCTATTAGACTATGAAAATTCAAAGTTGTCATTTTTCAATGTGGACATTTCTCAG
Dipodomys_ordii|7247               GGTGTCCTGTTAGATTACGAGAAGTCGAAGCTGTCCTTCTTCAACGCGGACAACTCTCAG
Ochotona_princeps|17067            GGCATCCTACTGGACTACGAAAATTCCAGGTTGTCCTTTTTCAATGCAGACATTGCTCAG
Oryctolagus_cuniculus|21668        GGCGTGCTGCTGGACTACGCAAACTCCAGGCTGTCGTTCTTCAACGTGGACATTTCTCAG
Tupaia_belangeri|1933              GGCGTTCTATTAGACTATGAAAATTCAAAGTTGTCATTTTTCAATGTGGACATCTCTCAG
Mus_musculus|39351                 GGCGTGCTGCTGGACTATGAGAACGCCAAGCTGTCCTTTTTCAATGTGGACATTGCTCAG
Rattus_norvegicus|2275             GGCGTCCTGCTAGACTATGAGGACTCCAAGCTGTCCTTTTTCAACGTGGACATTGCTCAG
Cavia_porcellus|1754               GGCATCCTATTAGACTATGAGAATTCAAAGTTGTCATTTTTCAACGTGGACATTGCTCAG
Microcebus_murinus|18467           GGCATTCTGTTAGACTATGAAAATTCAAAGTTGTCATTTTTCAATGTGGACATTTCTCAG
Callithrix_jacchus|19976           GGCATTCTATTAGACTATGAAAATTCAAAGTTGTCGTTTTTCAACGTGGAACTTTCTCAG
Pan_troglodytes|13352              GGCATTTTATTAGACTATGAACATTCAAAGTTGTCATTTTTC------------------
Gorilla_gorilla|9312               GGCATTCTATTAGACTATGAACATTCAAAGTTGTCATTTTTCAATGTGGATCTTTCTCAG
Homo_sapiens|29686                 GGCATTCTATTAGACTATGAACATTCAAAGTTGTCATTTTTCAATGTGGACCTTTCTCAG
                                                                                               

Spermophilus_tridecemlineatus|8770 ------------------------------------------------------------
Tarsius_syrichta|8135              CATCTATACTCGTTCAGCTGTCAGCTTCACCAATTTGTGCATCCCTGTTTTTCTCTGGAA
Otolemur_garnettii|4081            CATCTGTACACATTCAGCTGTCAGCTTTACCAATTTGTACATCCCTGTTTTTCTTTGGAA
Dipodomys_ordii|7247               CACCTGTACACCTACAGCTGTCAGCTTCACCGGTTTGTGCACCCCTGTTTTTCTTTGGAA
Ochotona_princeps|17067            CACCTCTACTCATTCAGCTGTGAGCTCCGCCAATTTGTACACCCCTGCTTTTCTTTGGAG
Oryctolagus_cuniculus|21668        CACCTACACTCGTTCAGCTGTGAGCTTCACCGACTCGTGCATCCTTGCTTCTCTCTGGAG
Tupaia_belangeri|1933              CATCTACACACATTCAGTTGTCAGCTGCACCAATTTGTGCACCCCTGTTTTTCTCTGGAA
Mus_musculus|39351                 CACCTGTACACATTTAGCTGTCAGCTCCACCAGTTTGTGCATCCCTGCTTTTCCCTGGAA
Rattus_norvegicus|2275             CACCTGTACACGTTTAGCTGCCCACTCCACCAATTTGTGCATCCCTGCTTTTCCTTGGAA
Cavia_porcellus|1754               CATCTATACACGTTCAGTTGTCAGCTTCAACAATTTGTGCACCCCTGTTTTTCTCTGGAA
Microcebus_murinus|18467           CATCTATACACATTCAAATGTCAGCTTCACCAATTGGTACATCCCTGTTTTTCTTTGGAA
Callithrix_jacchus|19976           CATCTATACACATTTAGTTGTCAGCCTCACAAATTTGTGCATCCCTGTTTTTCTTTGGAA
Pan_troglodytes|13352              ------------------------------------------------------------
Gorilla_gorilla|9312               CATCTATATACATTTAGTTGTCAGCTTCACGAATTTGTGCATCCCTGTTTTTCTTTGGAA
Homo_sapiens|29686                 CATCTATATACATTTAGTTGTCAGCTTCACGAATTTGTGCATCCCTGTTTTTCTTTGGAA
                                                                                               

Spermophilus_tridecemlineatus|8770 ------------------------------------------------------------
Tarsius_syrichta|8135              AAGTCTGGGTGTCTAAATATACATAATGGCATTTCAATGCCAAAGCATGTCACTTTCTAT
Otolemur_garnettii|4081            AACCCTGGGTGTCTAAAGATACATAATGGTATTTCCATGCCAAAGTCTATCACTTTC---
Dipodomys_ordii|7247               AAGCCGGGGTGTCTAAAGATACGTAATGGCATTTCAACACCCAGGCATGCCTCTTTCTGC
Ochotona_princeps|17067            AAGCCTGGGTGTCTAAAGATACACAACGGTATCCCAATACCTAGGCATGTCACTTTC---
Oryctolagus_cuniculus|21668        AAGCCGGGGTGCCTGAAGATCCGTAATGGCATCCCAATGCCGAAGCATGTCACGTTCTAC
Tupaia_belangeri|1933              AAGCCTGGGACTCTAAAGATACATAATGGCATTTCGATGCCAAAGCAGGCCACTTTCTAT
Mus_musculus|39351                 AAGTCTGGATGCCTAAAGATCTGCAATGGCATTTCAATGCCAAAGCATGTCACTTTCTTT
Rattus_norvegicus|2275             AAGTCTGGAGGCCTAAAGATCTGCAATGGCATATCAGCGCCAAAGCACGTCACTTTCTTT
Cavia_porcellus|1754               AAGCCTGGGTGTCTGAAGATACATAATGGCATTTCAATGCCAATGCATGCCACTTTCTAC
Microcebus_murinus|18467           AAGCCCGGGTGTCTAAAGATACATAATGGCATTTCAATGCCAAAGCATGTCACTTTC---
Callithrix_jacchus|19976           AAGCCTGGGTGTCTAAAGATACGTAATGGCATTTCGATGCCAAAACATGTCACTTTCTAT
Pan_troglodytes|13352              ------------------------------------------------------------
Gorilla_gorilla|9312               AAGCCTGGGTGTCTAAAGGTACATAATGGCATTTCAATGCCAAAACATGTCACTTTCTAT
Homo_sapiens|29686                 AAGCCTGGGTGTCTAAAGGTACATAATGGCATTTCAATGCCAAAACATGTCACTTTCTAT
                                                                                               

Spermophilus_tridecemlineatus|8770 ---
Tarsius_syrichta|8135              TAG
Otolemur_garnettii|4081            ---
Dipodomys_ordii|7247               TAG
Ochotona_princeps|17067            ---
Oryctolagus_cuniculus|21668        ---
Tupaia_belangeri|1933              TAG
Mus_musculus|39351                 TAG
Rattus_norvegicus|2275             TAG
Cavia_porcellus|1754               ---
Microcebus_murinus|18467           ---
Callithrix_jacchus|19976           TAG
Pan_troglodytes|13352              ---
Gorilla_gorilla|9312               TAG
Homo_sapiens|29686                 TAG
                                      

multiple sequence alignment in CLUSTALW format


Spermophilus_tridecemlineatus|7861 MEEEAGEEPGLDRSTAPKDFHFYNMDLYDSEDRMQIIPQENTRMRREVVQAEMTKDPRGA
Tarsius_syrichta|7444              MEEEAGEEPGLDRSA-PKDFHFYHMDLYDSEDRLQIFPEENTRMRREVVQAEKTSEPRGA
Otolemur_garnettii|3508            MEGEAGEELGPDKSA-PKDFHFYHMDLYDTEDRLHIFPEENIRMQRDGIQAEVSSEPRGE
Dipodomys_ordii|6809               ------------------------------------------------------------
Ochotona_princeps|14877            -EADAGEEPGLDSHTAPTDFNFYHMDLYDPDNRLLLLPEESPGTRREVIQAERTFEARGA
Oryctolagus_cuniculus|97           --EDAGEEPGLGRCTAPTDFHFYHMDLYDSDSRLQVLPEESTGVRREAVQAERTYEPRGA
Tupaia_belangeri|1685              MEEEGGEEAGMDRSAVAKDFHFYHMDLYDSEDRLQIFPEENMRMRRDVAPADMTSKPSGA
Mus_musculus|12037                 ------------------------MDLYDSEDRLQLFPGDSSRIRREVTQA---------
Rattus_norvegicus|27958            MEEEAGEEPGLGRSTAPRDFHFYHMDLYDSEDRLQLFPGESSRTRREVTQA---------
Cavia_porcellus|1366               ------------------------------------------------------------
Microcebus_murinus|15666           MEEEAGEEPGLDRSS-PRDFYFYHTDLYDPEDRLQIFPKQNVRTRREVVQAERSHEPRGT
Callithrix_jacchus|12403           MEEESGEELGLDRST-PKDFHFYHMDLYDSEDRLQLFPEENTRRRKEVVQAERANESTGA
Pan_troglodytes|18792              MEEESGEELGLDRST-PKDFHFYHMDLYDSEDRLHLFPEENTRMRK-VVQAEMANESRGA
Gorilla_gorilla|7960               MEEESGEELGLDRST-PKDFHFYHMDLYDSEDRLHLFPEENTRMRK-VVQAEMANESRGA
Homo_sapiens|20709                 MEEESGEELGLDRST-PKDFHFYHMDLYDSEDRLHLFPEENTRMRK-VVQAEMANESRGA
                                                                                               

Spermophilus_tridecemlineatus|7861 GERKIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tarsius_syrichta|7444              GDAKAQRDLQEEVDELAHLYGLEDDNDLGDEFVDENMTRMGVPEYPPYVMKRRDPTRGQS
Otolemur_garnettii|3508            GDGKIQRDLQEEVDELVHLYGLEDDHELGDEFVDENLFRVGVPEYPSHMMKRRDPAREQR
Dipodomys_ordii|6809               ------------------------------------------------------------
Ochotona_princeps|14877            REGQTHRHLHQEVDELVHLYGLEDDHELGDEIIDGNMPSTGIEEYPPYGVKRGDPAWEQQ
Oryctolagus_cuniculus|97           REGQAHRALHEEADELVHLYGLEDDHELGDEIMDEDTPRLGTAEYPPYGVKRGDPAWEQR
Tupaia_belangeri|1685              GEGKTQRDLQEEVDELVHLYGLEDDHELGDEFVDENMPGMGVSEYSPYAMKGRDPTREQR
Mus_musculus|12037                 ----------------------EDDRELGDEFVDEH--RLGTLGYPSYGMRRRDPGREPR
Rattus_norvegicus|27958            ----------------------EDEHELGGEFVDEH--RLGTLGYP-YGMRRRDPGREQR
Cavia_porcellus|1366               ------------------------------------------------------------
Microcebus_murinus|15666           GDGKVQRDLQEEVDELVHLYGLEDDHELGDEFVDENLPRMGASEYPPHMMKRTEPAREQR
Callithrix_jacchus|12403           GDGKAQRDLQEEVEELVHLYGLEDDHELGDEFV-ENMPRMGVSEYPPYGMKRRDPAREQR
Pan_troglodytes|18792              GDGKAQRDLQEEVDELVHLYGLEDDHELGNEFVDENIPRTGVSEYPPYMMKRRDPAREQR
Gorilla_gorilla|7960               GDGKAQRDLQEEVDELVHLYGLEDDHELGDEFVDENIPRTGVSEYPPYMMKRRDPAREQR
Homo_sapiens|20709                 GDGKAQRDLQEEVDELVHLYGLEDDHELGDEFVDENIPRTGVSEYPPYMMKRRDPAREQR
                                                                                               

Spermophilus_tridecemlineatus|7861 XXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tarsius_syrichta|7444              DWRLSGEAAEAEDLGF-GEWGSAGQCQDLREAYRYAHGRASEEYECYVIPEEEDEEEAAD
Otolemur_garnettii|3508            DWRLTGEAAEAKDLGF-RGWGSAGQCQDLREAYRYTHGRASEEYECYVIPEEEDEEEAAD
Dipodomys_ordii|6809               ------------------------------------------------------------
Ochotona_princeps|14877            DWRLGGEVAEAGDLGF-GGWGSRGQCQDLREAYQYSHGRASEEYECYVIPEEEDEEEAAD
Oryctolagus_cuniculus|97           DWRLGGEAAEAEDLGF-GGWGSRGQCQDLREAYRYTHGRASEEYECYVIPEEEDEEEAAD
Tupaia_belangeri|1685              DWRLTGEAAEANDLGF-GGWGSAGHCQDLREAYRYTHGRTSEEYECYVIPEEEDEEETAD
Mus_musculus|12037                 DW---GEAAEAEDLGYGGGQGPLDQCQDLREAYRYTHGRASEEYECYVIPEEEDEEEPAD
Rattus_norvegicus|27958            DWGLSGEAAEAEDLCY-GVQGPPDQCQDLREAYRYTHGRASEEYECYVIPEEEDEEEPAD
Cavia_porcellus|1366               ------------------------QSQALWESYRYTHGRASEEYECYVIPEEEDEEEAAD
Microcebus_murinus|15666           DWRLTGEVAEAEDLGL-GGWGSAGQCQDLREAYRYAHGRASEEYECYVIPEEEDEEEAVD
Callithrix_jacchus|12403           DWRLSGEATEAEDLGF-GGWGSAGQCQDLREVYRYTHGRASEEYECYVIPEEEDEEETAD
Pan_troglodytes|18792              DWRLSGEAAEAEDLGF-GGWGSAGQCQDLREAYRYTHGRASEEYECYVIPEEEDEEEAAD
Gorilla_gorilla|7960               DWRLSGEAAEAEDLGF-GGWGSAGQCQDLREAYRYTHGRASEEYECYVIPEEEDEEEAAD
Homo_sapiens|20709                 DWRLSGEAAEAEDLGF-GGWGSAGQCQDLREAYRYTHGRASEEYECYVIPEEEDEEEAAD
                                                                                               

Spermophilus_tridecemlineatus|7861 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEIHKNMYKLEKQIIEMENFASHL
Tarsius_syrichta|7444              IFCVTCKTPVRTFEKDFDEHKEHEVTPLSKALESAKDEIHKNMYKLEKQIIEMENFANHL
Otolemur_garnettii|3508            VFCITCKTQIRAFQKTFDEHKEHEVMPLSKALESAKDEIHKNMYKLEKQIIEMENFANHL
Dipodomys_ordii|6809               ------------------------------------DEIHRNMYRLEQQIIDMENFASHL
Ochotona_princeps|14877            VFCITCKTPVRAAE-DLVVHKEHEVTPLNQALESAKDEIHKNMCKLEKQIIDMENFASHL
Oryctolagus_cuniculus|97           VFCVTCKIPVRAVE-NLDAHKEHEVTPLNQALESAKDEIHKNMYKLEKQIIDMENFASHL
Tupaia_belangeri|1685              VFCVTCKTPIRASDTVSDEHKEHEVTPLNKALESAKDEIHKNMYKLEKQIIEMENFASHL
Mus_musculus|12037                 VFCITCKTPVRTVEKDFDTHKEHEVTPISKALEHAKDEVHKNMCKLEQQIIEMENFASHL
Rattus_norvegicus|27958            VFCVTCKTPVRTVEKDFDIHKEHEVTPINKALEHAKDEIHKNMCKLEQQIIEMENFASHL
Cavia_porcellus|1366               LFCVTCRTPIRAVEKDFGEHKEHEVTPLSKALESAKEEIHKNMYKLEQQIIEMENFASHL
Microcebus_murinus|15666           VFCVTCKTPIRAFQKVFDEHKEHEVIPLNKALESAKDEIHKNMYKLEKQILEMENFANHL
Callithrix_jacchus|12403           VFCVTCKTPIRAFQKVFDEHKEHEVIPLNEALESAKDEIHKNMYKLEKQIIDMENFANHL
Pan_troglodytes|18792              VFCVTCKTPIRAFQKVFDEHKEHEVIPLNEALESAKDEIHKNMYKLEKQIIEMENFANHL
Gorilla_gorilla|7960               VFCVTCKTPIRAFQKVFDEHKEHEVIPLNEALESAKDEIHKNMYKLEKQIIEMENFANHL
Homo_sapiens|20709                 VFCVTCKTPIRAFQKVFDEHKEHEVIPLNEALESAKDEIHKNMYKLEKQIIEMENFANHL
                                                                       :*:*:** :**:**::*****.**

Spermophilus_tridecemlineatus|7861 EEVFITVEXXXXXXXXXXXXXXXXXXXXXXXXXXXKIQ-LG-KKKEKLEALYGQLS-C-E
Tarsius_syrichta|7444              EEVFITVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Otolemur_garnettii|3508            EEVFITVE------EQNFESHYNEILETLAQKYEEKIQALGEKKKEKLETLYGQLVSCGE
Dipodomys_ordii|6809               EEVFVTVEENFGRQEQNFESHYNEILETLAQNYEENIQALGERKKEKLEALYGQLVNCGE
Ochotona_princeps|14877            EEVFITVEENFGRQEQNFESHYNEILETLAQKYEEKIQALGQKKREKLESLYGQLVSCGE
Oryctolagus_cuniculus|97           EEVFITVEENFGRQEQNFESHYNEILETLAQKYEEKIQALGQKKKEKLEALYEQLVSCGE
Tupaia_belangeri|1685              EEVFITVEENFGRQEQNFELHYNEILETLAQKYEEKIQALGEKKKEKLEALYGQLVSCGE
Mus_musculus|12037                 EEVFITVEENFGRQEQNFECHYNGILETLAQKYEEKIQALGEKKREKLEALYGQLVSCGE
Rattus_norvegicus|27958            EEVFITVEENFGRQEQNFECHYNEILETLAQKYEEKIQALGEKKKEKLEALYGQLVSCGE
Cavia_porcellus|1366               EEVFITVEENFGRQEQNFESHYNGILETLAQKYEEKIQALGEKKKEKLEALYGQLVSCGE
Microcebus_murinus|15666           EEVFITVEENFGKQEQNFESHYNEILETLAQKYEEKIQALGEKKKEKLEALYGQLISCGE
Callithrix_jacchus|12403           EEVFITVEENFGKQEQNFESHYNEILETLAQKYEEKIQALGEKKKEKVEALYEQLVSCGE
Pan_troglodytes|18792              EEVFITVEENFGKQEQNFESHYTEILETLAQKYEEKIQALGEKKKEKLEALYGQLVSCGE
Gorilla_gorilla|7960               EEVFITVEENFGKQEQNFESHYNEILETLAQKYEEKIQALGEKKKEKLEALYGQLVSCGE
Homo_sapiens|20709                 EEVFITVEENFGKQEQNFESHYNEILETLAQKYEEKIQALGEKKKEKLEALYGQLVSCGE
                                   ****:***                                                    

Spermophilus_tridecemlineatus|7861 NLDTCKELMETIEEMCHEEKVDFLKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tarsius_syrichta|7444              XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN--RLGKFLKTKTDVEISAQPDFEDQTLD
Otolemur_garnettii|3508            NLDTCKELMETIEEMCHEEKVDFIKVISMCFYTNRLGRFLKTKTDMEISAQPDFEDQTLD
Dipodomys_ordii|6809               SLETCKELMEAIEEVCHQDKANFLKVRNTAHY--RLGNFLKTQTDVEISAQPDFEDQTLD
Ochotona_princeps|14877            NLDTCRELMETIEEMCHEEKTEFVKVSN------RLGKFLKTKTDVEISTQPDFEEQTMD
Oryctolagus_cuniculus|97           NLDTCKELMETIEEMCHEEKVDFLKDAVAMAD--RLGQFLKTKTDVEISAQPDFEEQTLD
Tupaia_belangeri|1685              NLDTCKELMETIEEMCHEEKIDFIKVISISFYPNRLGKFLKTKTDVEISTHPDFEDQTLD
Mus_musculus|12037                 NLDACRELMETVEEMCHEEKVEFLKDAVAMTD--RLGKFLKTKTDVELSAQPEFEDQTLD
Rattus_norvegicus|27958            NLDACRELMETIEEMCHEEKVDFLKDAVAMTD--RLGKFLKTKTDVELSAKPEFEDQTLD
Cavia_porcellus|1366               NLDTCKELMETIEEMCHEEKVDFLKDALAMTD--RLGKFLKTKTDVEIAAQPEFEDQTLD
Microcebus_murinus|15666           NLDTCKELMETIEEMCHQEKVDFMKVIGMSFYTNRLGKFLKTKTDVEISAQPDFEDQTLD
Callithrix_jacchus|12403           NLDTCKELMETIEEMCHEEKVDFIKDAVAMADSNRLGKFLKTKTDVEISTQPDFEDQTLD
Pan_troglodytes|18792              NLDTCKELMETIEEMCHEEKVDFIKVSNETNN--RLGKFLKTKTDVEISAQPEFEDQTLD
Gorilla_gorilla|7960               NLDTCKELMETIEEMCHEEKVDFIKDAVAMADSNRLGKFLKTKTDVEISAQPEFEDQTLD
Homo_sapiens|20709                 NLDTCKELMETIEEMCHEEKVDFIKDAVAMAD--RLGKFLKTKTDVEISAQPEFEDQTLD
                                                                                               

Spermophilus_tridecemlineatus|7861 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tarsius_syrichta|7444              FSDVEQLMGSINTIPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Otolemur_garnettii|3508            FSDVEQLMGSINTIPAPSAPVINPQDPNSCMRASVRECWSLNSDDTVESYQLSYSPEQYI
Dipodomys_ordii|6809               FTEVEQLMGSMNAIPAPSAPVINRQAPNSATSSSVRVCWSLHSDDTVERYQLCYRPAQDG
Ochotona_princeps|14877            FSDVEELMGSINSVPAPSAPVINPQAPNSATGSSVRVCWSLYSDDTVESYQLSYRLVQDG
Oryctolagus_cuniculus|97           FSDVEELMGSINSIPAPSAPVINPQAPNSATGSSVRVCWSLYSDDTVESYQLSYRPVGDG
Tupaia_belangeri|1685              FSDVEQLMGSINTIPAPSAPVINPQAPNSATGSSVRVCWSLYSDDTVESYQLSYRPVRDS
Mus_musculus|12037                 FSDVEQLMDAINTIPAPSAPVINPQAPNSATGSSVRVCWSLYSDDTVESYQLSYRPVQDS
Rattus_norvegicus|27958            FSDVEQLMDSINTVPAPSAPVINPQAPNSATGSSVRVCWSLYSDDTVESYQLSYRPVQDS
Cavia_porcellus|1366               FSDVEQLMGSMNTILAPSAPVINPQAPNSATGSSVRVCWSLYADDTVESYQLSYRPVRDS
Microcebus_murinus|15666           FSDVEQLMGSINAVPAPSAPVINPQAPNSATGSSVRVCWSLYSDDTVERYQLCYRPVRDS
Callithrix_jacchus|12403           FSDVEQLMGSINTIPAPSAPVINPQTPNSATGSSVRVCWSLYSDDTVESYQLSYRPVQDS
Pan_troglodytes|18792              FSDVEQLMGSINTIPAPSAPVINPQVPNSATGSSVRVCWSLYSDDTVESYQLSYRPVQDS
Gorilla_gorilla|7960               FSDVEQLMGSINTIPAPSAPVINPQVPNSATGSSIRVCWSLYSDDTVESYQLSYRPVQDS
Homo_sapiens|20709                 FSDVEQLMGSINTIPAPSAPVINPQVPNSATGSSVRVCWSLYSDDTVESYQLSYRPVQDS
                                                                                               

Spermophilus_tridecemlineatus|7861 XXXXXXXXFTVTVKETYCSVANLEPNTQYEFWVIAQNRAGPSPSSERAVYMT--APSPPI
Tarsius_syrichta|7444              XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXX
Otolemur_garnettii|3508            SSGQNRAKFTVTIKETYCSVMKLVPNTQYEFWVTAHNRAGSSPPSEHAVYMT--APSPPI
Dipodomys_ordii|6809               SPHKDHAEFTVTVKETYCSVRNLEPNTQYEFWVIAENRAGPSPSSEVATYVT--APSPPV
Ochotona_princeps|14877            LPGKGQAESTVTVKETYCSVKNLAPNSQYEFWVTAQNRAGSSPASERAVYVT--APSPPI
Oryctolagus_cuniculus|97           SPGKDQAEFTVTVKETYCSVKNLMPNTQYEFWVTAQNRAGSSPSSERAVYMT--APSPPI
Tupaia_belangeri|1685              SPGKDQAEFTVTVKETYCSVTNLVPNTQYEFWVTAQNRTGPSPSSERAVYMT--APSPPI
Mus_musculus|12037                 SSGKDRAEFTMMVKETYCSVTNLEPNTQYEFWVIAQNRTGPSPCSEHAVYMT--APSPPS
Rattus_norvegicus|27958            SPGKDQAEFTMTVKETYCSVKNLEPNTQYEFWVIAQNRTGPSPSSEHVVYMT--APSPPS
Cavia_porcellus|1366               LPGKEQAEFTVTVKESYCSVTNLEPNTQYEFWVIAQNRAGPSPSSEHAMYMT--APSPPI
Microcebus_murinus|15666           SPGKDQAEFTVTVKETYCSVMKLVPNTQYEFWVTAHNRAGPSPPSERAVYMT--APSPPI
Callithrix_jacchus|12403           SPGKDQAEFTMTIKETYCSVTDLVPNTQYEFWVTAHNRAGLSPSSERAVYVTDLAPSPPI
Pan_troglodytes|18792              SPGKDQAEFTVTVKETYCSVTNLVPNTQYEFWVTAHNRAGPSPSSERAVYMT--APSPPI
Gorilla_gorilla|7960               SPGKDQAEFTVTVKETYCSVTNLVPNTQYEFWVTAHNRAGPSPSSERAVYMTDLAPSPPI
Homo_sapiens|20709                 SPGTDQAEFTVTVKETYCSVTNLVPNTQYEFWVTAHNRAGPSPSSERAVYMT--APSPPI
                                                                                               

Spermophilus_tridecemlineatus|7861 IKSKEIRSCEEAAFICWESGNLNPVDSYTVELTQAETPEALGVTESVVGIPTCETLIQLQ
Tarsius_syrichta|7444              XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSIVGIPTCEALLQLQ
Otolemur_garnettii|3508            IKTKEIRSCEEAALICWESGNLNPVDSYTMELTQAERPEAAGVTXXXXXXXXXXXXXXXX
Dipodomys_ordii|6809               IRCEEIRSCERAALISWESGNRSPVDSYTVELTLAETPEASGVTESVVGIPTCESLIQLL
Ochotona_princeps|14877            IKVKEIRSCEEAALICWESGSLNPVDSYTVELTQGETPEASGVTESIVGIPTCEALVRLQ
Oryctolagus_cuniculus|97           IKSKEIRSCEEAALICWESGSLNPVDSYTVELTQAEAPQAWGVTESIVGIPTCEALVQLQ
Tupaia_belangeri|1685              IKRKEIRSCEEAALICWESGNLNPVDSYTVELIQADTPEASGVTESVCGIP-YEALVQLQ
Mus_musculus|12037                 IKTEAIRSCEEAVLICWESGNLNPVDSYTVELIQAETPEASGVTESVVGIPTCESLIQLQ
Rattus_norvegicus|27958            IKTEAIRSCEEAVLICWESGNLNPVDSYTVELIQAETPEASGVTESVVGIPTCESLIQLQ
Cavia_porcellus|1366               IKTEAIRSCEEAALICWESGNLNPVDSYTVELTQVEEPAASGVTESVVGIPICESLIQLQ
Microcebus_murinus|15666           IKTQEIRSCEEAALICWESGNLNPVDSYTVELTRAEGPEAPGVTESVVGIPTCESLVQLQ
Callithrix_jacchus|12403           IKTKEIRSCEEAVLICWESGNLNPVDSYTVELTQAESPEASGVTESVVGIPTCESLVQLQ
Pan_troglodytes|18792              IKTKEIRSCEEAVLICWESGNLNPVDSYTVELTQAESPEASGVTESVVGIPTCESVVQLQ
Gorilla_gorilla|7960               IKTEEIRSCEEAVLICWESGNLNPVDSYTVELTQAESPEASGVTESVVGIPTCESVVQLQ
Homo_sapiens|20709                 IKTKEIRSCEEAVLICWESGNLNPVDSYTVELTQAESPEASGVTESVVGIPTCESVVQLQ
                                                                                               

Spermophilus_tridecemlineatus|7861 PRQCYTIYVRALNVGGPSARSDPATVHTTGLXXXXXXXXXXXXXXXXXXXXXXXXXX-XX
Tarsius_syrichta|7444              PGQSYVIYVRALNVGGPSARSEPATVHTTGSYFHLNKDTCHPWLTISEDGLTVTRSQ-RK
Otolemur_garnettii|3508            XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XX
Dipodomys_ordii|6809               PGQRYIIYVRALNVGGSSARSQPATVHTTGTVFHLNKDTCHPALTISEDGLTVLRNE-RK
Ochotona_princeps|14877            PKQSYTIYVRALNMGGLSTRSKPATVHTTGSYFHLDKDTCHPCLTISEDGFTLTRSE-RK
Oryctolagus_cuniculus|97           PRQNYTIYVRALNVGGPSARSEPATVHTTGSYFHLNKDTCHPWLTISEDGFTVMRSE-RK
Tupaia_belangeri|1685              PGQSFTVYV-AFSVGGLSARRNPVPVHTSGLYFHLNKDTCHPWLTISEDGFTVVRRE-GK
Mus_musculus|12037                 PRHSYTIYVRALNVGGTSARSEPATVHTTGSYFQLNKDTCHPWLTISEDGFTVVRSE-KK
Rattus_norvegicus|27958            PRHSYTIYVRALNVGGTSARSKPATVHTTGSYFQLNKDTCHPWLTISEDGFTVVRSEKKR
Cavia_porcellus|1366               PGQSYTICVRALNVGGPSARSTPATVRTTGSYFPLNKATCHPWLTISEDGFTVIRSE-RK
Microcebus_murinus|15666           PGQSYLIYVRALNVGGPSARSRPATVHTTGLYFHLNKHTCHPWLTVSEDGFTIVRSQ-RK
Callithrix_jacchus|12403           PGQSYVIYVRALNTGGPSTRSEPATVHTIGSYFRLNKDTCHPWLTISQDGLTILRSE-RS
Pan_troglodytes|18792              PGRSYIIYVRALNMGGPSVRSEPATVHTIGSYFRLNKDTCHPWLTISEDGLTVVRSE-RR
Gorilla_gorilla|7960               PGRSYIIYVRALNMGGPSVRSEPATVHTIGSYFRLNKDTCHPWLTISEDGLTVVRSE-RR
Homo_sapiens|20709                 PGRSYIIYVRALNMGGPSVRSEPATVHTIGSYFRLNKDTCHPWLTISEDGLTAVRSE-RR
                                                                                               

Spermophilus_tridecemlineatus|7861 XXXXXX-XXXXXXXXX--CVAVMGNLIPVRGHHYWEVEVDECLDYTVGVAFEDVPKQEDL
Tarsius_syrichta|7444              ISVKES-LSSHTRFTR--CVAVMGNLIPVRGRHYWEVEVDEHLDYTVGVAFEDVPKQEDL
Otolemur_garnettii|3508            XXXXXX-XXXXXXXXX--CTD-MGNLIMVR--CYYDVEVHE-LDYXXXXXXXXXXXXXXX
Dipodomys_ordii|6809               TPAREP-PPSRSRFSR--CAAVMGNLIPVRGRHYWEVEVDEHSDYTVGVAAEDIPRQEDL
Ochotona_princeps|14877            ASTREVAASSNVRFTR--CVAVLGNLIPIRGRHYWEVEVGERLDYMVGVAFEEVPRHEDL
Oryctolagus_cuniculus|97           TPMREP-LASNTRFTR--CVAVLGNLIPVRGRHYWEVEVDECLDYTIGVAFEEVPRHEDL
Tupaia_belangeri|1685              AWVKEL-PPDSTRFTR--CAAVMGSLIPVRGRHYWEVEVDERVDYTVGVAFEDVPKHEDL
Mus_musculus|12037                 SFRKEL-PPSKTQFTR--CVAVMGNLIPVRGRHYWEVEVAEHLDYTVGVACEDVPKQEDL
Rattus_norvegicus|27958            SFRREL-PPSKAQFTR--CVAVMGNLIPVRGRHYWEVEVDEHLDYTVGVACEDVPKQEDL
Cavia_porcellus|1366               NLTQEL-QPQQTQFTR--CVAIMGNLIPVRGRHYWEIEMDEHLDYTVGVAFEDVPKQEDL
Microcebus_murinus|15666           TPEREP-PPSDTRFTR--CVAVMGNLIPVRGRHYWEVEVDERLDYTVGVAFEDVPKQEDL
Callithrix_jacchus|12403           TPTKEP-PPSDTHFTRTRCVAVMGNLIPVRGHHYWEVEVDEHLDYTVGVAFEDVPKQEDL
Pan_troglodytes|18792              TPAREL-SPSDTHFTR--CVAVMGNLIPVRGHHYWEVEVDEHLDYRVGVAFADAPKQEDL
Gorilla_gorilla|7960               TPAREL-SPSDTHFTR--CVAVMGNLIPVRGHHYWEVEVDEHLDYTVGVAFADVPKQEDL
Homo_sapiens|20709                 TPAREL-SPSDTHFTR--CVAVMGNLIPVRGHHYWEVEVDEHLDYRVGVAFADVRKQEDL
                                                     *.  :*.** :*   *:::*: *  **               

Spermophilus_tridecemlineatus|7861 GANCYSWCMRHTFASS--------------------------------------------
Tarsius_syrichta|7444              GANCFSWCMRHTFASSRHKYEFLHNRTTPDIRVTVSPKKIGILLDYENSKLSFFNVDISQ
Otolemur_garnettii|3508            XXXXXXXXXXXXXXXXXHKYEFLHNRTTPDMRITCPPKKIGILLDYENSKLSFFNVDISQ
Dipodomys_ordii|6809               GASPQAWCLRHTFSSSRHKYEFLHNGKTPDIRITVAPKQIGVLLDYEKSKLSFFNADNSQ
Ochotona_princeps|14877            GANRLSWCMRHTYASLRHKYEFLHNRTTPDLRITVPPKTVGILLDYENSRLSFFNADIAQ
Oryctolagus_cuniculus|97           GANRLSWCLRHTFASSRHKYEFLHNKTSPDTRITVPPRRIGVLLDYANSRLSFFNVDISQ
Tupaia_belangeri|1685              GATRLSWCMRHTFASSRHKYEFLHNRTSPDIRITVSPKKIGVLLDYENSKLSFFNVDISQ
Mus_musculus|12037                 GANSLSWCMRHTFVSKRHRYEFLHNKMTPDIRITVAPRKIGVLLDYENAKLSFFNVDIAQ
Rattus_norvegicus|27958            GANRLSWCMRHTFASTRHRYEFLHNGTTPDIRITVAPKKIGVLLDYEDSKLSFFNVDIAQ
Cavia_porcellus|1366               GANGFSWCMRHTFASSRHKYEFLHNRTTPDIRITVPPKKIGILLDYENSKLSFFNVDIAQ
Microcebus_murinus|15666           GANSLSWCMRHTFASSRHKYEFLHNRTTPDIRITVPPKKIGILLDYENSKLSFFNVDISQ
Callithrix_jacchus|12403           GANCLSWCMRHTFASSRHKYEFLHNRTTPDIRITVPPKKIGILLDYENSKLSFFNVELSQ
Pan_troglodytes|18792              GANCLSWCMRHTFASSRHKYEFLHNRTTPDIRITVPPKKIGILLDYEHSKLSFF------
Gorilla_gorilla|7960               GANCLSWCMRHTFASSRHKYEFLHNRTTPDIRITVPPKKIGILLDYEHSKLSFFNVDLSQ
Homo_sapiens|20709                 GANCLSWCMRHTFASSRHKYEFLHNRTTPDIRITVPPKKIGILLDYEHSKLSFFNVDLSQ
                                                                                               

Spermophilus_tridecemlineatus|7861 ----------------------------------------
Tarsius_syrichta|7444              HLYSFSCQLHQFVHPCFSLEKSGCLNIHNGISMPKHVTFY
Otolemur_garnettii|3508            HLYTFSCQLYQFVHPCFSLENPGCLKIHNGISMPKSITF-
Dipodomys_ordii|6809               HLYTYSCQLHRFVHPCFSLEKPGCLKIRNGISTPRHASFC
Ochotona_princeps|14877            HLYSFSCELRQFVHPCFSLEKPGCLKIHNGIPIPRHVTF-
Oryctolagus_cuniculus|97           HLHSFSCELHRLVHPCFSLEKPGCLKIRNGIPMPKHVTFY
Tupaia_belangeri|1685              HLHTFSCQLHQFVHPCFSLEKPGTLKIHNGISMPKQATFY
Mus_musculus|12037                 HLYTFSCQLHQFVHPCFSLEKSGCLKICNGISMPKHVTFF
Rattus_norvegicus|27958            HLYTFSCPLHQFVHPCFSLEKSGGLKICNGISAPKHVTFF
Cavia_porcellus|1366               HLYTFSCQLQQFVHPCFSLEKPGCLKIHNGISMPMHATFY
Microcebus_murinus|15666           HLYTFKCQLHQLVHPCFSLEKPGCLKIHNGISMPKHVTF-
Callithrix_jacchus|12403           HLYTFSCQPHKFVHPCFSLEKPGCLKIRNGISMPKHVTFY
Pan_troglodytes|18792              ----------------------------------------
Gorilla_gorilla|7960               HLYTFSCQLHEFVHPCFSLEKPGCLKVHNGISMPKHVTFY
Homo_sapiens|20709                 HLYTFSCQLHEFVHPCFSLEKPGCLKVHNGISMPKHVTFY