Orthologs Set ID: EOG4003GM


Orthology Database
OrthoDB4
Gene Symbol(s)
PCDHB16

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 33875 1038
Callithrix jacchus 38
Dipodomys ordii 1053 822, 876, 919, 1475, 1506
Homo sapiens 70361
Mus musculus 18690
Ochotona princeps 7796 1439, 1472, 1483, 1518, 1539, 1548, 1563, 1572, 1580, 1593, 1614
Pan troglodytes 30237
Rattus norvegicus 16114
Spermophilus tridecemlineatus 9761
Tarsius syrichta 7209

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 38 ENSCJAT00000063686 100895392 ENSCJAG00000035341 LOC100895392 calJac3
Callithrix jacchus 33875 ENSCJAT00000062252 103789574 ENSCJAG00000005254 calJac3
Dipodomys ordii 1053 ENSDORT00000000639 ENSDORG00000000639 dipOrd1
Homo sapiens 70361 ENST00000361016 57717 ENSG00000196963 PCDHB16 hg19,GRCh37
Mus musculus 18690 ENSMUST00000053856 93888 ENSMUSG00000046387 mm9
Ochotona princeps 7796 ENSOPRT00000004673 101525755 ENSOPRG00000004673 PCDHB15 OchPri2.0
Pan troglodytes 30237 ENSPTRT00000032078 462133 ENSPTRG00000017338 PCDHB16 panTro2
Rattus norvegicus 16114 ENSRNOT00000040998 ENSRNOG00000039471 Pcdhb17 rn4
Spermophilus tridecemlineatus 9761 ENSSTOT00000009762 ENSSTOG00000009771 speTri1
Tarsius syrichta 7209 ENSTSYT00000013431 103268775 ENSTSYG00000013439 tarSyr1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 25689 ENSCJAP00000049425 103789574 ENSCJAG00000005254 calJac3
Callithrix jacchus 43619 ENSCJAP00000047272 100895392 ENSCJAG00000035341 LOC100895392 calJac3
Dipodomys ordii 981 ENSDORP00000000594 ENSDORG00000000639 dipOrd1
Homo sapiens 62602 ENSP00000354293 57717 ENSG00000196963 PCDHB16 hg19,GRCh37
Mus musculus 53068 ENSMUSP00000055072 93888 ENSMUSG00000046387 mm9
Ochotona princeps 6796 ENSOPRP00000004304 101525755 ENSOPRG00000004673 PCDHB15 OchPri2.0
Pan troglodytes 34076 ENSPTRP00000029637 462133 ENSPTRG00000017338 PCDHB16 panTro2
Rattus norvegicus 32646 ENSRNOP00000039238 ENSRNOG00000039471 Pcdhb17 rn4
Spermophilus tridecemlineatus 8765 ENSSTOP00000008755 ENSSTOG00000009771 speTri1
Tarsius syrichta 6606 ENSTSYP00000012321 103268775 ENSTSYG00000013439 tarSyr1

multiple sequence alignment in CLUSTALW format


Ochotona_princeps|7796             ATGGAGGCTGGAGGGGAGCCCATTCCTAAACAAAGGCAAGTCGTGATTCTGTTTCTTTTC
Mus_musculus|18690                 ATGGAGACTGCATGGATGTGCAATCTGAGACAAAGGCAAGTCCTGGCTTTCTTTGTTTTG
Rattus_norvegicus|16114            ATGGAGGCTGCATGGATGCGCAATCTGAGACAAAGGCAAGTCCTGGCTTTCTTTGTTTTG
Dipodomys_ordii|1053               ATGGAGATTGGATGGATACCAAATCAGAGACAAAGGCAAGTCTTAATTTTCTTTGTTTTA
Spermophilus_tridecemlineatus|9761 ATGGAGATTGAATGGCTGCCAAATCAGAGACAAAGGCAAGTCTTACTTTTCTTTGTTTTG
Tarsius_syrichta|7209              ATGGAGAGAGGACAGATGCGCCATCGGAGACAGAGGCAAGTCCTGGTTTTCTTTGTTTTG
Homo_sapiens|70361                 ATGGAGATTGGATGGATGCACAATCGGAGACAAAGGCAAGTCCTTGTTTTCTTTGTTTTG
Pan_troglodytes|30237              ATGGAGATTGGATGGATGCACAATCGGAGACAAAGGCAAGTCCTTGTTTTCTTTGTTTTG
Callithrix_jacchus|38              ATGGAGACTGGATGGATGCACAATCGGAGACACAGGCAAGTCCTTGTTTTCTTTGTTTTG
Callithrix_jacchus|33875           ATGGAGACTGGATGGATGCACAATCGGAGACAAAGGCAAGTCCTTGTTTTCTTTGTTTTG
                                   ******. :* * .* :.  ..:**  *.*** ********* *   * * *** **** 

Ochotona_princeps|7796             CTGGGAGTAGCTTGGGGAGACCAGGGGCCCCACCGCTATTCTGTGATGGAGGAAACGGAG
Mus_musculus|18690                 CTGCATGTGTCAGGGGCAGGGGCAGAACTGGGCCCCTATTCCATAGAGGAAGAAACAGAG
Rattus_norvegicus|16114            CTGAGTGTGTCTGGGGCAGGGGCAGAACTGGGTCCCTATTTCATAGAGGAAGAAACAGAG
Dipodomys_ordii|1053               TTGAGCATGTCTGGGGCGGACACAGAGCTGGGGCCCTATTTCGTGGTGGAAGAAATGGAG
Spermophilus_tridecemlineatus|9761 CTGAGCTTGTCTGGGGCAGGCGCCGAGTTGGGACCATATGTAGTAGTGGAAGAAATGGAG
Tarsius_syrichta|7209              CTGGGCATGTCTGGGGCGGGCACCGAGTTGGGGCCTTATTCCATGGTGGAGGAAATGGAG
Homo_sapiens|70361                 CTGAGCTTGTCTGGGGCGGGCGCCGAGTTGGGGTCCTATTCCGTAGTGGAAGAAACGGAG
Pan_troglodytes|30237              CTGAGCTTGTCTGGGGCGGGCGCCGAGTTGGGGTCCTATTCCGTAGTGGAAGAAACGGAG
Callithrix_jacchus|38              CTGAGCTTGTCTGGGGCGGGCGCCGAGTTGGGGCCCTATTCCACTGTGGAAGAAACCGAG
Callithrix_jacchus|33875           CTGAGCTTGTCTGGGGCGGGCGCCGAGTTGGGGCCCTATTCCACTGTGGAAGAAACCGAG
                                    ** .  *. *: *** .*.  . *..    .    ***   .  .:***.****  ***

Ochotona_princeps|7796             AAAGGCGCTTTTGTGGCTGACCTCGCCCAGGGCCTGGGGTTGGCGGTGGGGGAGCTAGCA
Mus_musculus|18690                 AGGGGCTCCTTTGTGGCAAATCTTGGGAAAGATCTGGGGGTGGACCTGGCAGAGATATCC
Rattus_norvegicus|16114            AGGGGCTCCTTTGTGGCAAATCTTGGGAAAGATCTGGGGGTGGAGCTGGCAGAGATATCC
Dipodomys_ordii|1053               AAAGGCTCCTTCGTAGCCAATCTAGGAAAAGACCTGGGGCTGGAATTGCCACAGTTGTCC
Spermophilus_tridecemlineatus|9761 AAAGGTTCCTTAGTGGCAAATCTAGTGAAAGACCTAGGGCTGGAGTTGGCAGAGATGTCC
Tarsius_syrichta|7209              AGGGGCTCTTTCGTGGCAGATCTAGGAAAAGACCTGGAGTTGGGATTGACGGAGCTGTCC
Homo_sapiens|70361                 AGAGGCTCTTTTGTGGCAAATCTAGGAAAAGACCTGGGGTTGGGGTTGACAGAGATGTCC
Pan_troglodytes|30237              AGAGGCTCTTTTGTGGCAAATCTAGGAAAAGACCTGGGGTTGGGGTTGACAGAGATGTCC
Callithrix_jacchus|38              AGAGGCTCTTTTGTGGCAAACCTAGGGAAAGACCTGGGTTTGGGGTTGACAGAGATGTCC
Callithrix_jacchus|33875           AGAGGCTCTTTTGTGGCAAACCTAGGGAAAGACCTGGGTTTGGGGTTGACAGAGATGTCC
                                   *..**  * ** **.** .* ** *  .*.*. **.*.  ***   **  . ** *. *.

Ochotona_princeps|7796             GCGCGGGGAGCTCGGGTGGTCTCTGAGGACAACGAACCACGTTTGCAGCTTGATTTACAA
Mus_musculus|18690                 AATCGCAGGGCTCGGATCATTTCCCAAGAAAACAAAGAGCATTTGCAGCTCAACCTTCAA
Rattus_norvegicus|16114            AGCCGGAGGGCTCGGATCATTTCCCAGGAAAACAAAGAGCATTTGCAGCTCAACGTTCAA
Dipodomys_ordii|1053               ACCCGCCGGGCCAGAGTAATTTCCCAGGGAAATAAAGAGCATTTGCAGCTCAAGGTACAG
Spermophilus_tridecemlineatus|9761 ACCAGAGGGGCCCGGATCATTTCCCAAGGAAACAAAGAGTATTTGCAGCTCAAGGTTCAA
Tarsius_syrichta|7209              TCCCATGGGGCCCGGATCATTTCCCAGGGGAACAAAGAGCCTTTGCAGCTCAAGGTTCAA
Homo_sapiens|70361                 ACCCGCAAGGCCAGGATCATTTCCCAGGGGAACAAACAGCATTTGCAGCTCAAGGCTCAA
Pan_troglodytes|30237              ACCCGCAAGGCCAGGATCATTTCCCAGGGGAACAAACAGCATTTGCAGCTCAAGGCTCAA
Callithrix_jacchus|38              AGCCGCGGGACCAGGATCATTTCCCAGGGGAACAAACAGCATTTGCAGCTCAAGGTTCAA
Callithrix_jacchus|33875           AGCCGCGGGGCCAGGATCATTTCCCAGGGGAACAAACAGCATTTGCAGCTCAAAATTCAA
                                      ..  ...* .*..* .* **  *.*. ** .** ..  ********* .*   :**.

Ochotona_princeps|7796             ACGGGTCAGTTAATAGTAAACGGACAATTGGACCGGGAGGAGTTGTGTGGTCCCACCGAG
Mus_musculus|18690                 TCTGGAGATCTGCTCATAAATGAGAAACTGGACCGAGAGGAGCTATGTGGCCCCATTGAG
Rattus_norvegicus|16114            TCTGGAGATTTGCTCATAAATGAGAGACTGGACCGAGAGGAGCTGTGTGGCCCCATTGAG
Dipodomys_ordii|1053               ACTGGAGATTTGCTCATAAATGAGAAAATAGATCGCGAGGAGCTATGCGGTACCACGGAG
Spermophilus_tridecemlineatus|9761 ACTGGGGATTTGCTCATAAATGAGAAATTAGATAGAGAGGAGCTATGTGGGCCCACTGAG
Tarsius_syrichta|7209              ACTGGCGATTTGCTCATAAACGAGAAGCTAGATCGAGAGGAGCTATGTGGCCCCACTGAG
Homo_sapiens|70361                 ACTGGGGATTTGCTCATAAATGAGAAGCTAGATCGAGAGGAGCTATGCGGTCCCACTGAG
Pan_troglodytes|30237              ACTGGGGATTTGCTCATAAATGAGAAGCTAGATCGAGAGGAGCTATGCGGTCCCACTGAG
Callithrix_jacchus|38              ACTGGAGATTTGCTCATAAATGAGAAGCTAGATCGAGAGGAGCTATGCGGTCCCATTGAG
Callithrix_jacchus|33875           ACTGGGGATTTGCTCATAAATGAGAAGCTAGATCGAGAGGAGCTATGCGGTCCCATTGAG
                                   :* **  *  *..*..**** *..... *.** .* ****** *.** ** .***  ***

Ochotona_princeps|7796             CACTGTGTACTGAGTTTCCAAGTGGTCGTGAACAAGCCAGTGGAAGTATTTCCAGTTGAA
Mus_musculus|18690                 CCGTGTGTTCTACACTTCCAAGTGTTAATGGAAAACCCTTTAGAGGTATTTCAGGCTGAA
Rattus_norvegicus|16114            CCTTGTGTTCTGCATTTCCAAGTGTTAATGGAAAACCCTTTAGAGATATTTCAGGCTGAA
Dipodomys_ordii|1053               CCTTGCATACTATATTTCCAAGTGTTGATGGAAATGCCCTTAGAGATATTTCAGGCTGAA
Spermophilus_tridecemlineatus|9761 CCTTGTATACTAAATTTCCAAGTGTTAATGGAAAAACCCTTAGAGATATTTCAGGCTGAA
Tarsius_syrichta|7209              CCTTGCGTACTACATTTCCAAGTGTTAATGGAAAAACCCTTAGAAATATTTCAGGCTGAA
Homo_sapiens|70361                 CCTTGCATACTACATTTCCAAGTGTTAATGGAAAACCCTTTAGAAATATTTCAGGCTGAA
Pan_troglodytes|30237              CCTTGCATACTACATTTCCAAGTGTTAATGGAAAACCCTTTAGAAATATTTCAGGCTGAA
Callithrix_jacchus|38              CCTTGTATACTACATTTCCAAGTGTTAATGGAAAAACCCTTAGAAATATTTCAGGCTGAA
Callithrix_jacchus|33875           CCTTGTATACTACATTTCCAAGTGTTAATGGAAAAACCCTTAGAAATATTTCAGGCTGAA
                                   *. ** .*:**. . ********* * .**.*.*: **  *.**..******..* ****

Ochotona_princeps|7796             CTCCTGCTAGGAGATGTAAATGATCACTCTCCTGAGTTTCCTGAGCCAGAAATGACCCTG
Mus_musculus|18690                 CTGAGGGTGATGGACATAAATGACTATTCTCCGGTGTTCAGTGAAAGAGAAATGATACTG
Rattus_norvegicus|16114            CTGAGGGTGACGGACATAAACGACTATTCTCCAGTGTTCAGTGAAAGAGAAATGATACTG
Dipodomys_ordii|1053               CTGAGAGTGAAAGACATAAATGATAATTCTCCCGTGTTCACTGAAAAAGAAATGGTTTTT
Spermophilus_tridecemlineatus|9761 CTGAAGGTGAAAGACATAAATGATCATTCTCCTGTGTTCCCAGAAAGAGAAATACTTCTT
Tarsius_syrichta|7209              CTGAGGGTGAGAGACATAAATGACCATTCTCCTGTGTTCACGGAAAGAGAAACGATTCTA
Homo_sapiens|70361                 CTGAGGGTGATAGATATAAATGACCATTCTCCCATGTTCACTGAAAAGGAAATGATTCTA
Pan_troglodytes|30237              CTGAGGGTGATAGATATAAATGACCATTCTCCCATGTTCACTGAAAAGGAAATGCTTCTA
Callithrix_jacchus|38              CTGAGGGTGATAGATACAAATGACCATTCTCCCGTGTTCACTGAAAAGGAAGTGGTTCTA
Callithrix_jacchus|33875           CTGAGGGTGATAGATATAAATGACCATTCTCCCGTGTTCACTGAAAAGGAAATGGTTCTA
                                   ** . . *.. .** . *** **  * ***** .:*** .  **.. .***. .    * 

Ochotona_princeps|7796             AAAATCCCAGAGAACAGCCTCCCTGGGACCGTGTTTCCTCTGAAAAGAGCCGAGGATATG
Mus_musculus|18690                 AGAATACTAGAAAACAGTGCTCTGGGAGATACATTTCCTTTAAATAATGCTCTGGACTCA
Rattus_norvegicus|16114            AGGATACCAGAAAACAGTGCTCGGGGAAATACATTCCCTTTAAACAATGCTCTGGACTCA
Dipodomys_ordii|1053               AAAATACCAGAAAATAGCCCACTAGGAAATACATTCCTTCTTAATAATGCTCTGGACTTG
Spermophilus_tridecemlineatus|9761 AAAATACTGGAAAACAGCCCCCTAGGAAATGTGTTCCCTCTGAATAATGCTCTGGACTTG
Tarsius_syrichta|7209              AAAATACCAGAAAACAGTCCTCTAGGAAATGCATTCCCTCTGAATAATGCTGTGGACTTG
Homo_sapiens|70361                 AAAATACCGGAAAACAGTCCTCTAGGAACTGAGTTCCCTCTGAATCATGCTTTGGACTTG
Pan_troglodytes|30237              AAAATACCGGAAAACAGTCCTCTAGGAACTGAGTTCCCACTGTCTCATGCTTTGGACTTG
Callithrix_jacchus|38              AAACTACCGGAAAATACTCCTCTAGGAACTGAGTTCCCCCTGAATCATGCTGTGGACATG
Callithrix_jacchus|33875           AAAATACCGGAAAACAGTCCTCTAGGAATTACGTTCCCCCTGAATTATGCTGTGGACTTA
                                   *...*.* .**.** *     *  **..  . .** *   * :.  .:**  :*** : .

Ochotona_princeps|7796             GACGCGGGCAGCAACGGCGTCCAGAGCTACAGCATTAGCCCCAACACTCCTTTTCACGTC
Mus_musculus|18690                 GACGTAGCAATCAACAATATCCAGACCTATAGGCTCAGCTCAAACTCTCATTTCCTGGTT
Rattus_norvegicus|16114            GACGTAGATATCAACAATATCCAGACCTATAGGCTCAGCTCAAACTCTCATTTCCTGGTT
Dipodomys_ordii|1053               GACGTAGGAAACAATAATGTTCAGAAGTATAACATCAGTCCCAACTCTCACTTCCATGTT
Spermophilus_tridecemlineatus|9761 GATGTTGGAAACAATAATGTTCAGAACTATCAAATCAGCCCCAACTCCCATTTCCGCGTT
Tarsius_syrichta|7209              GACGTAGGTACCAATAATGTTCAGAACTATAAAATCAGTCCCAACCCCCATTTCCGCGTT
Homo_sapiens|70361                 GACGTAGGAAGCAATAATGTTCAAAACTATAAAATCAGCCCAAGCTCTCATTTCCGGGTT
Pan_troglodytes|30237              GACGTAGGAAGCAATAATGTTCAAAACTATAAAATCAGCCCAAGCTCTCATTTCCGGGTT
Callithrix_jacchus|38              GACGTAGGAAGTAATAATGTTCAAAACTATAAAATCAGCCCAAATTCCCATTTCCGGGTT
Callithrix_jacchus|33875           GACTTGGGAAGCAATAATGTTCAAAACTATAAAATTAGTCCAAGCTCCCATTTCCGGGTT
                                   **    *  *  ** .. .* **.*  ** .. .* **  *.*.  * *. ** *  ** 

Ochotona_princeps|7796             TCCACACGCCCCCGAAGCGACGGCAGGACATACCCGGAGCTGGTGTTGGACAGAGAGCTG
Mus_musculus|18690                 GTAACCCGCAACCGCAGTGATGGCAGGAAGTACCCAGAGCTGGTGCTGGAGAAAGAACTG
Rattus_norvegicus|16114            GTAACCCGCAACCGCAGTGATGGCAGGAAGTACCCAGAGCTGGTGCTGGAGAAAGAACTG
Dipodomys_ordii|1053               CTAACCCGTAATCGCAGCGATGGTAGGAAATACCCAGAGCTGGTGCTGGAAAAAGAGCTA
Spermophilus_tridecemlineatus|9761 CTTACCTATGAACGCAACAACGGCAAGAAATATCCTCAACTGGTTTTGGAAAAAGAGCTG
Tarsius_syrichta|7209              CTGACCCGAGAACGCAGTGACGGCAGGAAATACCCTGAACTGGTGTTAGATAAAGAGCTG
Homo_sapiens|70361                 CTAATCCATGAATTCAGAGATGGCAGGAAATACCCTGAGCTAGTGTTGGATAAAGAGCTG
Pan_troglodytes|30237              CTAATCCATGAATTCAGAGATGGCAGGAAATATCCTGAGCTAATGTTGGATAAAGAGCTG
Callithrix_jacchus|38              CTAACCAGAGAACGCAATGATGGCAGGAAATATCCTGAGCTAGTGTTGGATAAAGAGCTG
Callithrix_jacchus|33875           CTAACCCGTGAACTCAGAGATGGCAGGAAATATCCTGAGCTAGTGTTGGATAAAGAGCTG
                                      * . .  .   .*. .* ** *.**..** **  *.**..*  *.** *.***.**.

Ochotona_princeps|7796             GATCGCGAGGAGCAGGCGGAGCTGTTGCTGACACTCACAGCGCGAGATGGCGGCTCTCCA
Mus_musculus|18690                 GATCGAGAGGAGGAACCTGAGCTGAGGTTAACTCTGACAGCTTTGGATGGTGGCGCTCCT
Rattus_norvegicus|16114            GATCGAGAGGAGGAACCTGAGCTGAGGTTAACGCTGACAGCTTTGGATGGTGGCTCTCCT
Dipodomys_ordii|1053               GATCGGGAGCAGGAGCCTGAAGTAAGACTAACCTTGACAGCGTTGGATGGCGGCTCCCCA
Spermophilus_tridecemlineatus|9761 GATCGAGAGGAAGAGCCTGAACTAAGATTAACCCTGACAGCTCTGGATGGCGGCTCTCCT
Tarsius_syrichta|7209              GATCGGGAGCGGGAGCCTGAACTAAGACTAACCCTAACAGCACTGGATGGCGGCTCTCCA
Homo_sapiens|70361                 GATCGGGAGGAGGAGCCTCAACTAAGATTAACCCTGACAGCGCTGGATGGTGGCTCTCCA
Pan_troglodytes|30237              GATCGGGAGGAGGAGCCTCAACTAAGATTAACCCTGACAGCGCTGGATGGTGGCTCTCCA
Callithrix_jacchus|38              GATCGGGAGGAGGAGCCTCAACTGAGATTAACCCTGACAGCGCTGGATGGGGGTTCTCCG
Callithrix_jacchus|33875           GATCGGGAGGAGGAGCCTCAACTGAGATTAACCCTGACAGCGCTGGATGGGGGTTCTCCA
                                   ***** *** .. *. *  *. *.: . *.**  * *****   .***** **  * ** 

Ochotona_princeps|7796             CCCCGCTCCGGCACTGCACACATCCGCGTTCTGGTCATGGACGTGAATGATAACGCCCCC
Mus_musculus|18690                 CCCCGGTCTGGGACGGCACAGGTTCTCATTGAAGTAGTGGACATCAACGATAATGCACCC
Rattus_norvegicus|16114            CCCCGGTCTGGGACGACACAGGTCCTCATTGAAGTAGTGGACACCAACGATAATGCACCC
Dipodomys_ordii|1053               CCTCGGTCTGGGACCTCACAGGTCCGCATTGAAATAGTAGACATCAATGACAATGCCCCT
Spermophilus_tridecemlineatus|9761 CCGCTGTCTGGAACCACACAGGTCCTTATTGAAGTGTTGGACATCAACGATAATGCCCCT
Tarsius_syrichta|7209              CCCAGGTCTGGGACCGTCCAAGTCTGTGTTGAAGTGGTGGACACCAACGATAACGCCCCT
Homo_sapiens|70361                 CCGCGATCTGGAACTGCTCAGGTCCGTATTGAAGTGGTGGACATCAATGATAACGCTCCT
Pan_troglodytes|30237              CCGCGATCTGGAACTGCTCAGGTCCGTATTGAAGTGGTGGACATCAATGATAACGCTCCT
Callithrix_jacchus|38              CCGCGATCTGGAACCACCCAGGTCCGCATTGAAGTGGTGGACAGCAACGATAACGCACCT
Callithrix_jacchus|33875           CCGCGATCTGGAACCACCCAGGTCCGCATTGAAGTGGTGGACAGCAACGATAACGCACCT
                                   ** .  ** ** **    ** .*    .** :..*  *.***.  ** ** ** ** ** 

Ochotona_princeps|7796             GAGTTCACGCAGACTCTCTACGAGGTGCAGGTGCCAGAAGACAGCCCGAAGGGCTCCATC
Mus_musculus|18690                 AAGTTTCAGCAGCCAACATACCGAGTGCAAATTCCCGAGAACAGTCCCACCGGTTCTCTG
Rattus_norvegicus|16114            GAGTTTCAGCAGCCAACATACCAAGTGCAAACTCCCGAGAACAGTCCAACCGGCTCTCTG
Dipodomys_ordii|1053               GAATTTCATCACCCTATCTACTGGGTGCAGGTTCCTGATAATAGCTCACTAAGCTCTTTG
Spermophilus_tridecemlineatus|9761 GAGTTTCAGCAGCCAATCTACAAGGTGCAAATTCCTGAGAACAGCCCGGTAGGTTCTCTG
Tarsius_syrichta|7209              GAGTTTCAGCAACCGCTCTACAGAGTGCAGATTCCCGAGAGCAGCCCCACTGGCTCCCTG
Homo_sapiens|70361                 GAGTTTGAGCAGCCCATCTACAAAGTGCAGATTCCAGAGAACAGTCCTCTTGGCTCCCTG
Pan_troglodytes|30237              GAGTTTGAGCAGCCCATCTACAAAGTGCAGATTCCAGAGAACAGCCCCCTTGGCTCCCTG
Callithrix_jacchus|38              GAGTTTGAGCAGCCCATCTACAAAGTGCAGATTCCAGAGAACAGCCCCCTTGGCTCCCTG
Callithrix_jacchus|33875           GAGTTTGAGCAGCCCATCTACAAAGTGCAGATTCCAGAGAACAGCCCCCTTGGCTCCCTG
                                   .*.**  . ** .* . .*** ..*****..  ** ** .. **  *    .* **  * 

Ochotona_princeps|7796             GTGGTCCAGGTCACCGCCAGGGATTTAGACGCGGGGATTTACGGAGAGACATCCTACGCC
Mus_musculus|18690                 GTACTCACAGTCTCAGCCAATGACTTGGACAGTGGAGATTATGGAAAAGTATTGTATGCA
Rattus_norvegicus|16114            GTACTCACAGTCTCAGCCAATGACTTAGACAGTGGAGACTATGGGAAAGTCTTGTACGCA
Dipodomys_ordii|1053               GTGGTCACAGTCTCCGCCAGGGACATAAACTGGGGATCCTATGCA---ATAGTGTACACA
Spermophilus_tridecemlineatus|9761 GTAGTCACTGTCTCCGCCACTGATTTAGACGGTGGCGTCTATGGAAAAATAATATATATG
Tarsius_syrichta|7209              GTTGTCACAGTCTCCGCCAGGGATTTAGACAGCGGAGTCAACAGTAAAATATCCTACACA
Homo_sapiens|70361                 GTTGCCACCGTCTCCGCCAGGGATTTAGACGGCGGAGCCAATGGAAAAATATCATACACA
Pan_troglodytes|30237              GTTGCCACCGTCTCCGCCAGGGATTTAGACGGCGGAGCCAATGGAAAAATATCATACACA
Callithrix_jacchus|38              GTTGCCACCGTCTCCGCCAGGGATTTAGACAGCGGAGCCAATGGGAAAATATCATACACA
Callithrix_jacchus|33875           GTTGCCACCGTCTCCGCCAGGGATTTAGACAGCGGAGCCAATGGGAGAATATCATACACA
                                   **   *.. ***:*.****  ** :*..**   **    :* .     . .   ** .  

Ochotona_princeps|7796             CTTATTTATAGCTCGCAGGACATACGCAAAACCTTTGAGTTGAACAGCCTTTCAGGAAAA
Mus_musculus|18690                 CTTTCTCAGCCTTCAGAAGATATTAGCAAAACGTTAGAAGTAAACCCTGTAACCGGGGAG
Rattus_norvegicus|16114            CTTTCGCAACCCTCAGAAGATATTAGCAAAACATTCGAGGTAAACCCTGTAACCGGGGAA
Dipodomys_ordii|1053               CTCGCCCACTCTTCTGAAGAAACTAACTTTATTATA---GTTAATCCTATGACAGGAGAA
Spermophilus_tridecemlineatus|9761 CTCTTTCAGGCTTCAGAAGATGTTAGCAAAACTTTGGAGCTAAATCCTATGACAGGAGAA
Tarsius_syrichta|7209              CTCTTCCAGCCTTCGGAAGAAATCAGCAAAACCTTGGAGGTAAATTCTATGACAGGAGAA
Homo_sapiens|70361                 CTCTTTCAGCCTTCGGAGGATATTAGTAAAACTTTGGAGGTAAATCCTATGACAGGGGAA
Pan_troglodytes|30237              CTCTTTCAGCCTTCGGAGGATATTAGTAAAACTTTGGAGGTAAATCCTATGACAGGGGAA
Callithrix_jacchus|38              CTCTTTCAACCTTCGGAGGATATCAGTAAGACTTTGGAGGTAAATCCTATGACAGGAGAA
Callithrix_jacchus|33875           CTCTTTCAGCCTTCAGAGGATACTAGTAAGACTTTGGAGGTAAATCCTATGACAGGAGAA
                                   **     *    **  *.** .  .. :: *  :*     * **     * :*.**..*.

Ochotona_princeps|7796             GTTCGACTCATCAGAAAGCTAGATTTTGAGACAGTCTCTTCATACGAGTTTGACATAGAG
Mus_musculus|18690                 ATTCGGCTACGAAAAGAGGTGGATTTTGAAACTATTCCCTCTTATGAAGTGGATATCAAG
Rattus_norvegicus|16114            ATTCGCCTACGAAAAGAGGTGAATTTTGAAACTATTCCTTCGTATGAAGTGGTTATCAAG
Dipodomys_ordii|1053               ATTCGGCTGAAGAAACAAGTAGATTTTGAAACAGTAAAGTTTTATGAAATGGACATAGAG
Spermophilus_tridecemlineatus|9761 ATTCGACTTAGAAAACAAGTAGATTTTGAAACAGTCCCGTTTTATGAAGTGGACATCAAG
Tarsius_syrichta|7209              ATTCGGCTGAGAAAACCAGTCGATTTTGAAACAGTCCAATCTTATGAAGTGGACATCAAA
Homo_sapiens|70361                 GTTCGACTGAGAAAGCAAGTAGATTTCGAAATGGTTACGTCTTATGAAGTGCGCATCAAA
Pan_troglodytes|30237              GTTCGACTGAGAAAACAAGTAGATTTCGAAATGGTTACGTCTTATGAAGTGCGCATCAAA
Callithrix_jacchus|38              ATTCGACTGAGAAAACAATTAGATTTTGAAACGACTATGTCTTATGAAGTGGACATCAAG
Callithrix_jacchus|33875           ATTCGACTGAGAAAACAATTAGATTTTGAAACGACTATGTCTTATGAAGTAGACATCAAG
                                   .**** ** .  *.. .. * .**** **.*  .     *  ** **. *    **..*.

Ochotona_princeps|7796             GCATCTGATGGAGGGGGGCTTTCAGGAAAATGCTCTGTCTCCATTAAGGTGCTGGACGTT
Mus_musculus|18690                 GCCACGGATGGGGGAGGTCTCTCAGGAAAATGCACGCTGTTACTGAAGGTGGTGGACGTG
Rattus_norvegicus|16114            GCCACGGACGGGGGAGGTCTCTCAGGAAAATGCACTCTGTTACTGCAGGTGGTGGACGTG
Dipodomys_ordii|1053               GCCACAGATGGGGGTGGTCTTTCAGGAAAATGCACCCTTGTCCTACAGGTTGTGGACATA
Spermophilus_tridecemlineatus|9761 GCTATAGACGGAGGAGGTCTTTGGGGAAAATGCACTCTTCTCCTGCAGGTAGTGGATGTA
Tarsius_syrichta|7209              GCCACGGATGGGGGAGGTCTTTCAGGAAAATGCACTCTTCTTCTGCAGCTAGTGGACGTG
Homo_sapiens|70361                 GCCACAGATGGGGGAGGTCTTTCAGGAAAGTGCACTCTTCTCCTGCAGGTGGTGGACGTG
Pan_troglodytes|30237              GCCACAGATGGGGGAGGTCTTTCAGGAAAGTGCACTCTTCTCCTGCAGGTGGTGGACGTG
Callithrix_jacchus|38              GCCACAGATGGGGGAGGTCTTTCAGGAAAGTGTACTCTTCTCCTGCAAGTGGTGGACGTG
Callithrix_jacchus|33875           GCCACAGATGGGGGAGGTCTTTCAGGAAAGTGTACTCTTCTCCTGCAAGTGGTGGACGTG
                                   ** :  ** **.** ** ** * .*****.** :*  *    .* .*. *  **** .* 

Ochotona_princeps|7796             AACGACAATCCTCCGGAAATAACTATCTCATCGCTTACTAGCTCTGTTCCTGAAAACTTT
Mus_musculus|18690                 AATGACAATGCCCCAGAAGTGATGCTATCTGCTCTTACCAGCCCAGTCCCAGAAAACTCC
Rattus_norvegicus|16114            AATGACAATGCCCCAGAAGTGATGCTATCTGCGCTAACCAACCCAGTCCCAGAAAATTCC
Dipodomys_ordii|1053               AATGACAACCCACCAGAAGTGACCATGTCCGCAATTACAAACCCGGTCCCAGAAAACTCC
Spermophilus_tridecemlineatus|9761 AATGATAACCATCCCGAAGTGTCCATGTCTGCACTCACCAGTCCCATCCCGGAGAACTCC
Tarsius_syrichta|7209              AACGATAATCCCCCAGAAGTGACCACGTCTGCACTCACCAGCCCCATTCCAGAGAACTCG
Homo_sapiens|70361                 AATGACAATCCCCCACAGGTGACCATGTCTGCACTCACCAGCCCCATCCCAGAGAACTCG
Pan_troglodytes|30237              AATGACAATCCCCCACAGTTGACCATGTCTGCACTCACCAGCCCCATCCCAGAGAACTCG
Callithrix_jacchus|38              AATGACAATCCTCCACAGGTGACCATGTCTGCACTCACCAGCCCCATCCCAGAGAACTCG
Callithrix_jacchus|33875           AATGACAATCCTCCACAGGTGACCATGTCTGCACTCACCAGCCCCATCCCAGAGAACTCG
                                   ** ** **  . **  *. *.:  .  **  * .* ** *.  * .* ** **.** *  

Ochotona_princeps|7796             CCGGAGACAGAAGTGGCGCTGTTTAGGATTCGAGACAGAGACTCTGGGGACAATGGGAGG
Mus_musculus|18690                 CCGGACGAGGTAGTTGCTGTTTTCAGTGTTAAAGATCCTGATTCAGCGAACAATGGAAAA
Rattus_norvegicus|16114            CCCGATGAGGTAGTGGCTGTTTTCAGTGTTAGAGATCCTGACTCTGGGAACAACGGAAAA
Dipodomys_ordii|1053               CCAGATACGGTAGTTGCGGTTTTCAGTGTTTCAGATTCTGACTCAGGAACCAATGGGAAG
Spermophilus_tridecemlineatus|9761 CCGGAGATGGTGGTTGCTGTTTTCAGAGTTTCAGATCCTGACTCTGGGAACAATGGAAAG
Tarsius_syrichta|7209              CCTGAGACAGTAGTTGCTGTTTTCAGTGTCTCAGATCCTGACTCCGGAAACAATGGGAAG
Homo_sapiens|70361                 CCTGAGATAGTAGTTGCTGTTTTCAGCGTTTCAGATCCTGACTCCGGAAACAATGGGAAG
Pan_troglodytes|30237              CCTGAGATAGTAGTTGCTGTTTTCAGCGTTTCAGATCCTGACTCCGGAAACAATGGGAAG
Callithrix_jacchus|38              CCTGAGATTGTAGTTGCTGTTTTCAGCGTTTCAGATCCCGACTCCGGGAACAATGGGAAG
Callithrix_jacchus|33875           CCTGAGATTGTAGTTGCTGTTTTCAGCGTTTCAGATCCCGACTCCGGGAACAATGGGAAG
                                   ** ** .  *:.** **  * ** ** .*   ***    ** ** * ...*** **.*..

Ochotona_princeps|7796             ATGATTTTCTCCATCCAGAACGATGTACCTTTCAAGCTGAAACCCACCTTGGACAACTTC
Mus_musculus|18690                 ATGATTGCCTCCATCGAAGAAGATCTTCCCTTTCTTCTAAAATCTTCAGGGAAGAACTTT
Rattus_norvegicus|16114            GTGATTGCATCCATCGAGGAAGACCTGCCCTTTCTTCTAAAATCTTCAGGAAAGAACTTT
Dipodomys_ordii|1053               ATGGTTTCTTCCATTCCAGAAGATCTTCCCTTTCTTCTAAAATCTTCAGGAAAGAACTTC
Spermophilus_tridecemlineatus|9761 ACGATTTGCTCCATTCGGGAAGACATGCCCTTTCTTCTAAAACCTTCAGGCAAGAACTTT
Tarsius_syrichta|7209              ACGATTCCCTCCATCCAGGAAGATATTCCTTTTCTTCTAAAACCTTCCGTGAAAAACTTT
Homo_sapiens|70361                 ACGATTTCCTCCATCCAGGAAGACCTTCCCTTTCTTCTAAAACCTTCAGTCAAGAACTTT
Pan_troglodytes|30237              ACGATTTCCTCCATCCAGGAAGACCTTCCCTTTCTTCTAAAACCTTCAGTCAAGAACTTT
Callithrix_jacchus|38              ACGATTTCCTCCATCCAGGAAGACCTTCCCTTTCTTCTAAAACCCTCAGTCAAGAACTTT
Callithrix_jacchus|33875           ACGATTTCCTCCATCCAGGAAGACCTTCCCTTTCTTCTAAAACCCTCAGTCAAGAACTTT
                                   . *.**   *****   ..*.**  * ** ** .: **.*** * :*.   .* ***** 

Ochotona_princeps|7796             ATCACCCTGGTAACGGACGGACCTCTCGACAGGGAGGCCAAGGCCCACTACACCATCACC
Mus_musculus|18690                 TACACTTTAGTGACCAAGAGAGCACTTGACAGGGAAGAAAGAGAGAAATACAACATCACC
Rattus_norvegicus|16114            TACACTTTAGTAACCAAGGGAGCACTTGACAGGGAAGAAAGAGAGCAATTGAACATCACC
Dipodomys_ordii|1053               TACACCTTGGTAACAGAAAGAGCACTAGACAGAGAAGAAAGAGATGAATACAACATCACC
Spermophilus_tridecemlineatus|9761 TACACCTTGAAAACAAAGAGAGCACTAGACAGAGAAGAAAGAGAGGAATACAACGTGACC
Tarsius_syrichta|7209              TACACCTTGGTAACAGAGAGAGCACTCGACAGAGAAGCAAGATCCGAGTACAACGTCACC
Homo_sapiens|70361                 TACACCTTGGTAACGGAGAGAGCACTCGACAGAGAAGCAAGAGCTGAATATAATATCACC
Pan_troglodytes|30237              TACACCTTGGTAACGGAGAGAGCACTCGACAGAGAAGCAAGAGCTGAATATAATATCACC
Callithrix_jacchus|38              TACACCTTGGTAACGGAGAGAGCACTAGACAGAGAAGCAAAAGCTGAATATAACATCACT
Callithrix_jacchus|33875           TACACCTTGGTAACGGAGAGAGCACTCGACAGAGAAGCAAAACCTGAATATAACATCACC
                                   ::***  *..:.** .* .** *:** *****.**.*..*.. .  * *: *. .* ** 

Ochotona_princeps|7796             ATCACAGTCTCAGACCTGGGCACGCCCAGGCTGCAGAGCCAGCACAACGTGACAGTGCAC
Mus_musculus|18690                 ATCACTGTCTCTGACCTGGGCACACCCAGGCTCACAACCCAGCACACCATAACAGTGCAG
Rattus_norvegicus|16114            ATCACAGTCACTGACCTGGGCATACCCAGGCTCACCACCCAACACACCATAACAGTGCAG
Dipodomys_ordii|1053               ATCACCGTCTCCGACTTGGGGACTCCCAGGCTGCAAACCCAGCACACCATCACCCTGCAG
Spermophilus_tridecemlineatus|9761 ATCACTGTTACAGATATGGGGACACCCAGATTGAAAACACAGCTTAACATAACAGTGCAG
Tarsius_syrichta|7209              ATCACCGCCACCGACCTGGGGACTCCCGCGCTGAAGACCCAGCACCACGTCACCGTGCGG
Homo_sapiens|70361                 CTCACCGTCACAGATATGGGGACTCCAAGGCTGAAAACGGAGCACAACATAACAGTGCAG
Pan_troglodytes|30237              CTCACCGTCACAGATATGGGGACTCCAAGGCTGAAAACGGAGCACAACATAACAGTGCAG
Callithrix_jacchus|38              GTCACAGTCACAGATATGGGGACTCCAAGGCTGCAAACGGAGTACAGCGTAACAGTGCAG
Callithrix_jacchus|33875           GTCACAGTCACAGATATGGGGACTCCAAGGCTGCAAACGGAGTACAACGTAACAGTGCAG
                                    **** *  :* **  **** *  **.. . * .. *   *. : . *.* **. ***. 

Ochotona_princeps|7796             GTGTCCGACGTCAACGACAACGCGCCCACCTTCAGCCAGGCCCTGTACACCCTGTTCGTG
Mus_musculus|18690                 GTCTCTGACACCAATGACAACGCCCCCGCCTTCAACCAAACCTCATACACCCTGTTCGTC
Rattus_norvegicus|16114            GTGGCAGACATCAACGACAATGCCCCCTCCTTCACCCAAACCTCCTACACCATGTTTGTC
Dipodomys_ordii|1053               GTGTCCGACATGAACGACAACGCCCCCGAATTCACGCAGTCGTCCTACACCCTGTGGGTC
Spermophilus_tridecemlineatus|9761 GTATCAGACATCAACGACAACGCCCCTGCCTTCAGACAAACCTCCTATACGCTGTTAGTG
Tarsius_syrichta|7209              GTCTCCGACGTCAACGACAACGCCCCCGCCTTCACCCGGGCCGTCTACACCCTGCTGGTC
Homo_sapiens|70361                 ATATCAGATGTCAATGATAACGCCCCCACTTTCACCCAAACCTCCTACACCCTGTTCGTC
Pan_troglodytes|30237              ATATCAGATGTCAACGATAACGCCCCCGCTTTCACCCAAACCTCCTACACCCTGTTCGTC
Callithrix_jacchus|38              ATATCGGATGTCAATGACAATGTCCCCGCCTTCACCCAAACCTCCTACACCCTGTTCGTC
Callithrix_jacchus|33875           ATATCGGATGTCAATGACAACGCCCCCACCTTCACACAATCCTCCTACACCCTGTTTGTT
                                   .*  * ** .  ** ** ** *  **  . ****  *.. *    ** ** .**   ** 

Ochotona_princeps|7796             CTGGAGAACAACAGCCCCGCGCTGCACATCGGCAGCGTGAGCGCCAGCGACAGGGACGCG
Mus_musculus|18690                 CGCGAGAACAACAGCCCCGCCATGCACATAGGCACCATCAGTGCCACAGACTCTGACGCT
Rattus_norvegicus|16114            CGCGAGAACAACAGCCCCGCCCTGCACATAGGCACCATCAGCGCCACAGACTCAGACTCA
Dipodomys_ordii|1053               CGCGAGAACAACAGCCCCGCCCTGCACATTGGCACCATCAGCGCCACAGACAGAGACTCG
Spermophilus_tridecemlineatus|9761 CGCGAGAACAACCAGCCCGCCCTGCACATAGGCAGTGTCAGCGCCACAGACAGAGACTCA
Tarsius_syrichta|7209              CGCGAGAACAACCGCCCCGCCCTGCACATCGGCAGCGTCAGCGCCACCGACGCGGACGCG
Homo_sapiens|70361                 CGCGAGAACAACAGCCCCGCCCTGCACATCGGCAGCGTCAGCGCCACAGACAGAGACTCA
Pan_troglodytes|30237              CGCGAGAACAACAGCCCCGCCCTGCACATCGGCAGTGTCAGCGCCACAGACAGAGACTCG
Callithrix_jacchus|38              AGGGAGAACAACAGCCCCGCCCTGCACATCGGCAGCGTCAGCGCCACAGACAGAGACTCA
Callithrix_jacchus|33875           CGGGAGAACAACAGCCCCGCCCTGCACATCGGCAGCGTCAGCGCCACAGACAGAGACTCA
                                   .  *********.. ***** .******* ****  .* ** **** .***   *** * 

Ochotona_princeps|7796             GGCGCCAACGCCCAGATCACCTACTCGCTGCTGCAGCCGCAGGGGCTGCAGGTGAACGTG
Mus_musculus|18690                 GGCTCCAATTCCCACATCAGCTACTCGCTGTTGCCTTCCCACGACCCGCAGCTGGCCCTG
Rattus_norvegicus|16114            GGATCCAATGCCCACATCACCTACTCGCTGCTACCGCCCCAAGACCCACAGCTGGCCCTC
Dipodomys_ordii|1053               GGCAGCAACGCCCAGCTGACCTACTCGCTGCTGCCGCCCGCAGCCCGGCGCCGACGCGGC
Spermophilus_tridecemlineatus|9761 GGCACCAATGCCCAGATCACCTACTCGCTGCTGCCAAACCAGGACCCAAACCTACCCCTC
Tarsius_syrichta|7209              GGCGCCAACGCCCAGGTCACCTACTCGCTGCTGCCGCCCCCCGACCCGCGGCTGGCGCCG
Homo_sapiens|70361                 GGCACCAACGCCCAGGTCACCTACTCGCTGCTGCCGCCCCAGGACCCGCACCTGCCCCTC
Pan_troglodytes|30237              GGCACCAACGCCCAGGTCACCTACTCGCTGCTGCCGCCCCAGGACCCGCACCTGCCCCTC
Callithrix_jacchus|38              GGCACCAACGCACAGGTCACCTACTCGCTGCTGCCGCCCCAGGACACGCACTTGGCCCTC
Callithrix_jacchus|33875           GGCACCAACGCACAGGTCACCTACTCGCTGCTGCCGCCCCAGGACCCGCACCTGCCCCTC
                                   **.  ***  *.**  * * ********** *.*.  .  . *  . ...   .      

Ochotona_princeps|7796             GGCGCGCTGTTGTCCCTGAACGCGGCGAGCGGCCAGCTGTTCGCGCTGCCGCTCTCAATC
Mus_musculus|18690                 GACTCGCTCATCTCCATCAACGCAGACAATGGGCAGCTGTTCGCGCTCAGGGCGCTGGAC
Rattus_norvegicus|16114            GACTCCCTCATCTCCATCAATGTAGACAACGGGCAGCTGTTCGCGCTCAGGGCGCTAGAC
Dipodomys_ordii|1053               GGCGGCCTGGTGTCCATCAACGCGGACAGCGGGCAGCTGTTCGCCCTGAGGGCGCTGGAC
Spermophilus_tridecemlineatus|9761 GCCTCGCTGGTCTCCATCAACGGAGACAATGGGCAGCTGTTCGCGCTGAGGGCGCTGGAC
Tarsius_syrichta|7209              GCCGCCCTGGTGTCCGCGAACGCCGACCGCGGCCGGCTGTTCGCGCTGCGCTCGCTGGAC
Homo_sapiens|70361                 GCCTCCCTGGTCTCCATCAACGCAGACAACGGCCACCTGTTCGCCCTCAGGTCGCTGGAC
Pan_troglodytes|30237              GCCTCCCTGGTCTCCATCAACGCAGACAACGGCCACCTGTTCGCCCTCAGGTCCCTGGAC
Callithrix_jacchus|38              GCCTCTCTGGTCTCCATCAACGCGGACAACGGACACCTGTTCGCCCTCCGGTCGCTGGAC
Callithrix_jacchus|33875           GCCTCCCTGGTCTCCATCAACGCGGACAACGGACACCTGTTCGCCCTCCGGTCCCTGGAC
                                   * *   **  * ***   ** *  *. .. ** *. ******** ** .       ..:*

Ochotona_princeps|7796             TACGAGACCCTTCGCGCTTTCGAGTTCGGCGTGGCCGTCCGAAACGGCGGGTTCCCTGTT
Mus_musculus|18690                 TATGAGGCCCTGCAGGCCTTTGAGTTCCACGTGGGTGCAATAGACCAAGGCTCACCTGCG
Rattus_norvegicus|16114            TATGAGGCTCTGCAGGGCTTCGAGTTCCATGTGGGCGCCACAGACCAAGGCTCGCCCGCG
Dipodomys_ordii|1053               TATGAGGCCCTGCAGGCGTTCGAGGTGCGCGTGCGCGCCGCCGACCGCGGCTCGCCCCCG
Spermophilus_tridecemlineatus|9761 TTCGAGGCCCTGCAGTCATTCGAGTTCCACGTGGGCGCCACAGACCAAGGCGCGCCTGCG
Tarsius_syrichta|7209              TACGAGGCCCTGCGCGCCTTCGAGCTCCGCGTGGGCGCCGCC------------------
Homo_sapiens|70361                 TACGAGGCCCTGCGGGAGTTCGAGTTCCGCGTGAGCGCCACAGACCGCGGCTCCCCGGCT
Pan_troglodytes|30237              TACGAGGCCCTGCAGGCTTTCGAGTTCCGCGTGGGCGCCACAGACCGCGGGTCCCCGGCT
Callithrix_jacchus|38              TACGAGGCCCTGCAGGCGTTCGAGTTCCGCGTGGGCGCCACAGACCGCGGCTCCCCGGCG
Callithrix_jacchus|33875           TACGAGGCCCTGCAGGCGTTCGAGTTCCGCGTGGGCGCCACAGATCGCGGCTCCCCGGCG
                                   *: ***.* ** *.    ** *** *  . ***   * .  .                  

Ochotona_princeps|7796             CTGAGCTGCAAAGCG---------------------------------------------
Mus_musculus|18690                 CTCAGCAGCCAAGCGCTGGTGCGCGTGGTGGTGCTGGACGACAATGACAATGCGCCCTTC
Rattus_norvegicus|16114            CTCAGCAGCCAGGCTCTGGTGCACGTGGTGGTGTTGGACGACAATGACAATGCGCCCTTC
Dipodomys_ordii|1053               CTCAGCAGCCAGGCGCTGGTGCGCGTGCAGGTGCTGGACGCCAACGACAACTCGCCCTTC
Spermophilus_tridecemlineatus|9761 CTCAGCAGCCAGGCGCTGGTGCGAGTGGTGGTGCTGGACGACAATGACAACCCGCCCTTC
Tarsius_syrichta|7209              ------------------------------------------------------------
Homo_sapiens|70361                 TTGAGCAGCGAGGCGCTGGTGCGCGTGCTGGTGCTGGACGCCAACGACAACTCGCCCTTC
Pan_troglodytes|30237              TTGAGCAGCGAGGCGGTGGTGCACGTGCTGGTGCTGGACGCCAACGACAACTCGCCCTTC
Callithrix_jacchus|38              CTGAGCAGCGAGGCGCTGGTGCGCGTGCTGGTGCTGGACGCCAACGACAACTCGCCCTTC
Callithrix_jacchus|33875           CTGAGCAGCGAGGCGCTGGTGCGCGTGCTGGTGCTGGACGCCAACGACAACTCGCCCTTC
                                                                                               

Ochotona_princeps|7796             ------------------------------------------------------------
Mus_musculus|18690                 GTGCTCTACCCGATGCAGAACTCCTCTGCGCCTTGCACAGAACTGCTGCCCAGGGCGGCG
Rattus_norvegicus|16114            GTGCTCTACCCGCTGCAAAACGCCTCTGCACCCTTCACTGAGCTGCTGCCCAGGGCGGCA
Dipodomys_ordii|1053               GTGCTGTACCCGCTGCAGAACGCGTCTGCGCCCTGCACCGAGCTGCTGCCCAGGGCGGCC
Spermophilus_tridecemlineatus|9761 GTGCTGTACCCAATGCAGAACGCCTCTGCGCCCTGCACCGAGCTGGTGCCCAGGGCGGCA
Tarsius_syrichta|7209              ------------------------------------------------------------
Homo_sapiens|70361                 GTGCTGTACCCGCTGCAGAACGGCTCCGCGCCCTGCACTGAGCTGGTGCCCCGGGCGGCC
Pan_troglodytes|30237              GTGCTGTACCCGCTGCAGAACGGCTCCGCGCCCTGCACCGAGCTGGTGCCCCGGGCGGCC
Callithrix_jacchus|38              GTGCTGTACCCGCTGCAGAACGGCTCCGCGCCCTGCACCGAGCTGGTGCCCCGGGTGGCC
Callithrix_jacchus|33875           GTGCTGTACCCGCTGCAGAACGGCTCCGCGCCCTGCACCGAGCTGGTGCCCCGGGCGGCC
                                                                                               

Ochotona_princeps|7796             ------------------------------------------------------------
Mus_musculus|18690                 GAACCCGGATACCTGGTCACCAAGGTGGTGGCTGTGGATCGCGACTCTGGCCAGAATGCC
Rattus_norvegicus|16114            GAGCCTGGATACCTGGTTACCAAGGTGGTAGCTGTGGACCGCGACTCTGGCCAGAATGCC
Dipodomys_ordii|1053               GAGCCGGGCTACCTGGTGAGCAAGGTGGTGGCGGTGGACCGCGACTCGGGCCAGAACGCC
Spermophilus_tridecemlineatus|9761 GAGCAGGGCTACCTGGTCACCAAGGTGGTGGCGGTGGATGGAGACTCGGGCCAGAACGCC
Tarsius_syrichta|7209              ------------------------------------------------------------
Homo_sapiens|70361                 GAGCCGGGCTACCTGGTGACCAAGGTGGTGGCGGTGGACGGCGACTCGGGCCAGAATGCC
Pan_troglodytes|30237              GAGCCGGGCTATCTGGTGACCAAGGTGGTGGCGGTGGACGGCGACTCGGGCCAGAACGCC
Callithrix_jacchus|38              GAGCCGGGCTACCTGGTGACCAAGGTGGTGGCGGTGGACGGCGACTCGGGCCAGAACGCC
Callithrix_jacchus|33875           GAGCCGGGCTACCTGGTGACCAAGGTGGTGGCGGTGGACGGCGACTCGGGCCAGAACGCC
                                                                                               

Ochotona_princeps|7796             ------------------------------------------------------------
Mus_musculus|18690                 TGGCTGTCATTCCAACTTCTCAAGGCTACGGAGCCCGGGCTGTTCAGCGTGTGGGCGCAC
Rattus_norvegicus|16114            TGGCTGTCATTCCAGCTGCTCAAGGCCACGGAGCCCGGGCTGTTCAACGTATGGGCGCAC
Dipodomys_ordii|1053               TGGCTGTCGTTCCAGCTGCTCAAGGCCACGGAGCCCGGGCTGTTCAGCGTGTGGCCGCAC
Spermophilus_tridecemlineatus|9761 TGGCTGTCATACCAGCTGCTCAAGGCCACGGAGCCAGGGCTGTTTGGCGTGTGGGCCCAC
Tarsius_syrichta|7209              ------------------------------------------------------------
Homo_sapiens|70361                 TGGCTGTCGTACCAGCTGCTCAAGGCCACGGAGCCCGGGCTGTTCGGTGTGTGGGCGCAC
Pan_troglodytes|30237              TGGCTGTCGTACCAGCTGCTCAAGGCCACGGAGCCCGGGCTGTTCGGTGTGTGGGCGCAC
Callithrix_jacchus|38              TGGCTGTCGTTCCAGCTGCTCAAGGCCACGGAGCCCGGGCTGTTCGGCGTGTGGGCGCAC
Callithrix_jacchus|33875           TGGCTGTCGTTCCAGCTGCTCAAGGCCACGGAGCCCGGGCTGTTCGGCGTGTGGGCGCAC
                                                                                               

Ochotona_princeps|7796             ------------------------------------------------------------
Mus_musculus|18690                 AATGGCGAGGTACGCACTACCAGACTGCTGAGCGAGCGCGATGTGCCCAAGCACAGGCTG
Rattus_norvegicus|16114            AATGGCGAGGTACGCACCTCCAGGCTGCTGAGCGAGCGCGACGCACCCAAGCACAAGCTG
Dipodomys_ordii|1053               AATGGCGAGGTGCGCACCGCCAGGCTGCTGAGCGAGCGCGACGCGCCCAAGCACAGGCTG
Spermophilus_tridecemlineatus|9761 AATGGCGAGGTGCGCACCACCAGGCTGCTGAGCGAGCGCGACGCGGCCAGGCACAGGCTG
Tarsius_syrichta|7209              ------------------------------------------------------------
Homo_sapiens|70361                 AATGGCGAGGTGCGCACCGCCAGGCTGCTGAGCGAGCGCGACGCAGCCAAGCAGAGGCTG
Pan_troglodytes|30237              AATGGCGAGGTGCGCACCGCCAGGCTGCTGAGCGAGCGCGACGCGGCCAAGCACAGGCTG
Callithrix_jacchus|38              AATGGCGAGGTGCGCACCGCCAGGCTGCTGAGCGAGCGCGACGCGGCCAAGCACAGGCTG
Callithrix_jacchus|33875           AATGGCGAGGTGCGCACCGCCAGGCTGCTGAGCGAGCGCGACGCGGCCAAGCACAGGCTG
                                                                                               

Ochotona_princeps|7796             ------------------------------------------------------------
Mus_musculus|18690                 GTCCTGCTGGTCAAGGACAATGGCGATCCTCCGCGCTCTGCCAGCGTCACGCTGCACGTG
Rattus_norvegicus|16114            CTGCTGTTGGTCAAGGACAATGGAGATCCTCCACGCTCTGCCAGTGTTACTCTGCACGTG
Dipodomys_ordii|1053               CTGCTGCTGGTCAAGGACAATGGCGAGCCGCCGCGCTCGGCCAGCGTCACGCTGCACGTG
Spermophilus_tridecemlineatus|9761 GTGGTGCTGGTCAAGGACAATGGCGAGCCTCCGCTGTCTGCCAGCGTCACGCTGCACGTG
Tarsius_syrichta|7209              ------------------------------------------------------------
Homo_sapiens|70361                 GTGGTGCTGGTCAAGGACAATGGCGAGCCTCCGCGCTCGGCCACCGCCACGCTGCACGTG
Pan_troglodytes|30237              GTGGTGCTGGTGAAGGACAATGGCGAGCCTCCGCGCTCGGCCACCGCCACGCTGCACGTG
Callithrix_jacchus|38              CTGGTGCTGGTCAAGGACAATGGCGAGCCTCCGCGCTCCGCCACCGCCACGCTGCACGTG
Callithrix_jacchus|33875           CTGGTGCTGGTCAAGGACAATGGCGAGCCTCCGCGCTCGGCCACCGCCACGCTGCACGTG
                                                                                               

Ochotona_princeps|7796             ------------------------------------------------------------
Mus_musculus|18690                 CTAGTGGTGGATGGCTTCTCTCAGCCCTACCTGCCTCTGCCAGAGGTGGCGCGCAATCCC
Rattus_norvegicus|16114            CTAGTGGTGGATGCCTTCTCTCAGCCCTACCTGCCTCTGCCAGAGGTGGCGCACGACCCT
Dipodomys_ordii|1053               CTGCTGGTGGATGGCTTCTCGCAGCCCTACCTGCCGCTGCCCGACGCGGAGGCGCCCGAG
Spermophilus_tridecemlineatus|9761 CTGCTAGTGGATGGCTTCTCCCAGCCCTACCTGCCGCTCCCGGAAGTGGCG---CCTGAG
Tarsius_syrichta|7209              ------------------------------------------------------------
Homo_sapiens|70361                 CTCCTGGTGGACGGCTTCTCCCAGCCCTTCCTGCCGCTCCCAGAGGCGGCC---CCCGGC
Pan_troglodytes|30237              CTCCTGGTGGACGGCTTCTCCCAGCCCTTCCTGCCGCTCCCAGAGGCGGCC---CCCGGC
Callithrix_jacchus|38              CTCCTGGTGGACGGCTTCTCCCAGCCCTACCTGCCGCTCCCGGAGGCGGCC---CCGGCC
Callithrix_jacchus|33875           CTCCTGGTGGACGGCTTCTCCCAGCCCTACCTGCCGCTCCCGGAGGCGGCC---CCGGCC
                                                                                               

Ochotona_princeps|7796             ------------------------------------------------------------
Mus_musculus|18690                 GCGCACGATGAGGACGCTCTAACACTGTATCTGGTCATAGCCTTGGCATCTGTGTCTTCT
Rattus_norvegicus|16114            GCACAAGAAGAAGATGCGCTAACACTCTACCTGGTCATAGCTTTGGCATCTGTGTCTTCT
Dipodomys_ordii|1053               CGCGCGCAGCCCGACCGCCTCACTGCCTACTTGGTCATCGCGCTGGCGGCCGTGTCTTCT
Spermophilus_tridecemlineatus|9761 CGCGCCCAGGGGGACTCACTCACTGTCTATTTGGTCATTGCTTTGGCCTCTGTGTCATCG
Tarsius_syrichta|7209              ------------------------------------------------------------
Homo_sapiens|70361                 CAGACCCAGGCCAACTCGCTCACTGTCTACCTGGTGGTGGCGTTGGCCTCGGTGTCGTCG
Pan_troglodytes|30237              CAGACCCAGGCCAACTCGCTCACTGTCTACCTGGTGGTGGCGTTGGCCTCGGTGTCGTCG
Callithrix_jacchus|38              CAGGCCCAGGCCGACTCGCTCACCGTCTACCTGGTGGTGGCGTTGGCCTCGGTGTCGTCG
Callithrix_jacchus|33875           CAGGCCCAGGCCGACTCGCTCACCGTCTACCTGGTGGTGGCGTTGGCCTCGGTGTCGTCG
                                                                                               

Ochotona_princeps|7796             ------------------------------------------------------------
Mus_musculus|18690                 CTCTTCCTCTTGTCTGTGCTGCTGTTTGTGGGGGTGAGGCTGTGCAGGAGGGCCAGGTCG
Rattus_norvegicus|16114            CTCTTCCTCTTGTCTGTGCTGCTGTTCGTGGGGGTGAGGCTCTGCAGGAGGGCCAGGGCA
Dipodomys_ordii|1053               CTCTTCCTCTTGTCTCTGCTGCTCTTCGTGGCCGCCAGGCTGTGCAGGAGGAGCAGGGCG
Spermophilus_tridecemlineatus|9761 CTCTTCCTCTTCTCTGTGCTAGTGTTCGTGGCGGTGAGGTTGTGCAGGAGGAGCAGGGCG
Tarsius_syrichta|7209              ------------------------------------------------------------
Homo_sapiens|70361                 CTCTTCCTCTTTTCGGTGCTCCTGTTCGTGGCGGTGCGGCTGTGCAGGAGGAGCAGGGCG
Pan_troglodytes|30237              CTCTTCCTCTTTTCGGTGCTCCTGTTCGTGGCGGTGCAGCTGTGCAGGAGGAGCAAGGCG
Callithrix_jacchus|38              CTCTTCCTGTTCTCGGTGCTCCTGTTCGTGGCGGTGCGACTGTGCAGGAGGAGCAGGGCG
Callithrix_jacchus|33875           CTCTTCCTGTTCTCGGTGCTCCTGTTCGTGGCGGTGCGGCTGTGCAGGAGGAGCAGGGCG
                                                                                               

Ochotona_princeps|7796             ------------------------------------------------------------
Mus_musculus|18690                 GCCTCTCTGAGTGGTTATTCCGTGCCTGAGGGCCACATTCCTGGCCATCTGGTGGATGTC
Rattus_norvegicus|16114            GCCTCTCTGAGTGCCTATTCTGTGCCTCAAGGCCACTTTCCTGGCCAGCTGGTGGATGTC
Dipodomys_ordii|1053               CGCTCGCTGGCCGGCTGCGCGCTGCCCGATGGCCCCTTGCCTGGACACCTGCTGGACGTG
Spermophilus_tridecemlineatus|9761 GCATCGCTAGGTGTGTGTTCTGTGCCTGAAGGCCACTTTCCGGGCCACCTGGTGGATGTC
Tarsius_syrichta|7209              ------------------------------------------------------------
Homo_sapiens|70361                 GCCTCGGTGGGCCGCTGCTCGATGCCTGAGGGCCCCTTTCCAGGGCGTCTGGTGGACGTA
Pan_troglodytes|30237              GCCTCGGTGGGCCGCTGCTCGGTGCCTGAGGGCCCCTTTCCAGGGCGTCTGGTGGACGTG
Callithrix_jacchus|38              GCCTCTGTGGGTGGCTGCTCGGTGCCCGAGGGCCCGTTTCCAGGGCATCTGGTGGACGTG
Callithrix_jacchus|33875           GCCTCTGTGGGTGGCTGCTCGGTGCCCGAGGGCCCGTTTCCAGGGCATCTGATGGACGTG
                                                                                               

Ochotona_princeps|7796             ------------------------------------------------------------
Mus_musculus|18690                 AGAGGTGTGGGGACCCTGTCCCAGAGCTACCAGTATGATGTATGTCTGATGGGCGATTCT
Rattus_norvegicus|16114            AGAGGTATGGGGACCCTGTCCCAGAGCTACCAGTATGATGTATGTCTGATGGGGGATTCT
Dipodomys_ordii|1053               AGTGGCACGGGGACCCTGGCCCACAGCTACCAGTATGAGGTGTGTCTGCAGGGA---GGT
Spermophilus_tridecemlineatus|9761 GCCAGCACTGGCACTATGTCCCAGAGTTACCAACAAGAGGTGTGTCTGAAGGGA---GGT
Tarsius_syrichta|7209              ------------------------------------------------------------
Homo_sapiens|70361                 AGCGGCACCGGGACCCTGTCCCAGAGCTACCAATACGAGGTGTGTCTGACAGGA---GGC
Pan_troglodytes|30237              AGCGGCACCGGGACCCTGTCCCAGAGCTACCAATACGAGGTGTGTCTGACAGGA---GGC
Callithrix_jacchus|38              AGCGGCACCGGAACCCTGTCTCAGAGCTACCAGTACGAGGTGTGTCTGGCGGGA---GCT
Callithrix_jacchus|33875           AGCGGCACCGGGACCCTGTCCCAGAGCTACCAGTACGAGGTGTATCTGACAGGA---GGT
                                                                                               

Ochotona_princeps|7796             ------------------------------------------------------------
Mus_musculus|18690                 TCTGGGACCAGTGAGTTTAACTTCTTAAAGCCAGTTTTCCCTAGCTCTCTAGACCAGTGC
Rattus_norvegicus|16114            TCTGGGACCAGCGAATTTAACTTCTTAAAGCCAGTTCTGCCTAGCTCTCTGCACCAGTGC
Dipodomys_ordii|1053               GCTGGCACTAATGAGTTCAAATTCCTGAAGCCTATCATCCCCAATCTCCAGCCCCAG---
Spermophilus_tridecemlineatus|9761 TCTGTGACCAGCGAGTTTAAGTTCTTGAAGCCAATTATCCCCATCCTCCAGCCCCAG---
Tarsius_syrichta|7209              ------------------------------------------------------------
Homo_sapiens|70361                 TCAGAAACAAGTGAGTTCAAGTTCCTGAAGCCGATTATCCCCAACTTCTCTCCT------
Pan_troglodytes|30237              TCAGAAACAAGTGAGTTCAAGTTCCTGAAGCCGATTATCCCCAACTTCTCTCCT------
Callithrix_jacchus|38              TCTGGGACCAATGAGTTCAAGTTTCTGAAACCAATACTACCCAATATTCAGGACCAATCC
Callithrix_jacchus|33875           TCTGGGACAAACGAGTTCAAATTCCTGAAGCCGATTATCCCCAACTTCTCGTCT------
                                                                                               

Ochotona_princeps|7796             ------------------------------------------------------------
Mus_musculus|18690                 TCTGGTAAAGAAATAGAGGAAAATTCCTCACTCCACAATAGTTTTGGATTTCATCAT---
Rattus_norvegicus|16114            TCTGGGAAAGAAATAGAGGGAAATTCCACACTCCAGAATAGTTTTGGGTTTCATCAT---
Dipodomys_ordii|1053               ------------------------------------------------------------
Spermophilus_tridecemlineatus|9761 ------------------------------------------------------------
Tarsius_syrichta|7209              ------------------------------------------------------------
Homo_sapiens|70361                 ------------------------------------------------------------
Pan_troglodytes|30237              ------------------------------------------------------------
Callithrix_jacchus|38              CCTGTGCCAGAAATGAAGGAAAACTCTAACTTTAGGAATGACTTTGGTTTCAGCATTCAA
Callithrix_jacchus|33875           ------------------------------------------------------------
                                                                                               

Ochotona_princeps|7796             ---
Mus_musculus|18690                 TAA
Rattus_norvegicus|16114            TAA
Dipodomys_ordii|1053               ---
Spermophilus_tridecemlineatus|9761 ---
Tarsius_syrichta|7209              ---
Homo_sapiens|70361                 TAG
Pan_troglodytes|30237              TAG
Callithrix_jacchus|38              ---
Callithrix_jacchus|33875           TAG
                                      

multiple sequence alignment in CLUSTALW format


Ochotona_princeps|6796             MEAGGEPIPKQRQVVILFLFLGVAWGDQGPHRYSVMEETEKGAFVADLAQGLGLAVGELA
Mus_musculus|53068                 METAWMCNLRQRQVLAFFVLLHVSGAGAELGPYSIEEETERGSFVANLGKDLGVDLAEIS
Rattus_norvegicus|32646            MEAAWMRNLRQRQVLAFFVLLSVSGAGAELGPYFIEEETERGSFVANLGKDLGVELAEIS
Dipodomys_ordii|981                MEIGWIPNQRQRQVLIFFVLLSMSGADTELGPYFVVEEMEKGSFVANLGKDLGLELPQLS
Spermophilus_tridecemlineatus|8765 MEIEWLPNQRQRQVLLFFVLLSLSGAGAELGPYVVVEEMEKGSLVANLVKDLGLELAEMS
Tarsius_syrichta|6606              MERGQMRHRRQRQVLVFFVLLGMSGAGTELGPYSMVEEMERGSFVADLGKDLELGLTELS
Homo_sapiens|62602                 MEIGWMHNRRQRQVLVFFVLLSLSGAGAELGSYSVVEETERGSFVANLGKDLGLGLTEMS
Pan_troglodytes|34076              MEIGWMHNRRQRQVLVFFVLLSLSGAGAELGSYSVVEETERGSFVANLGKDLGLGLTEMS
Callithrix_jacchus|43619           METGWMHNRRHRQVLVFFVLLSLSGAGAELGPYSTVEETERGSFVANLGKDLGLGLTEMS
Callithrix_jacchus|25689           METGWMHNRRQRQVLVFFVLLSLSGAGAELGPYSTVEETERGSFVANLGKDLGLGLTEMS
                                   **       ::***: :*::* :: ..     *   ** *:*::**:* :.* : : :::

Ochotona_princeps|6796             ARGARVVSEDNEPRLQLDLQTGQLIVNGQLDREELCGPTEHCVLSFQVVVNKPVEVFPVE
Mus_musculus|53068                 NRRARIISQENKEHLQLNLQSGDLLINEKLDREELCGPIEPCVLHFQVLMENPLEVFQAE
Rattus_norvegicus|32646            SRRARIISQENKEHLQLNVQSGDLLINERLDREELCGPIEPCVLHFQVLMENPLEIFQAE
Dipodomys_ordii|981                TRRARVISQGNKEHLQLKVQTGDLLINEKIDREELCGTTEPCILYFQVLMEMPLEIFQAE
Spermophilus_tridecemlineatus|8765 TRGARIISQGNKEYLQLKVQTGDLLINEKLDREELCGPTEPCILNFQVLMEKPLEIFQAE
Tarsius_syrichta|6606              SHGARIISQGNKEPLQLKVQTGDLLINEKLDREELCGPTEPCVLHFQVLMEKPLEIFQAE
Homo_sapiens|62602                 TRKARIISQGNKQHLQLKAQTGDLLINEKLDREELCGPTEPCILHFQVLMENPLEIFQAE
Pan_troglodytes|34076              TRKARIISQGNKQHLQLKAQTGDLLINEKLDREELCGPTEPCILHFQVLMENPLEIFQAE
Callithrix_jacchus|43619           SRGTRIISQGNKQHLQLKVQTGDLLINEKLDREELCGPIEPCILHFQVLMEKPLEIFQAE
Callithrix_jacchus|25689           SRGARIISQGNKQHLQLKIQTGDLLINEKLDREELCGPIEPCILHFQVLMEKPLEIFQAE
                                    : :*::*: *:  ***. *:*:*::* ::*******. * *:* ***::: *:*:* .*

Ochotona_princeps|6796             LLLGDVNDHSPEFPEPEMTLKIPENSLPGTVFPLKRAEDMDAGSNGVQSYSISPNTPFHV
Mus_musculus|53068                 LRVMDINDYSPVFSEREMILRILENSALGDTFPLNNALDSDVAINNIQTYRLSSNSHFLV
Rattus_norvegicus|32646            LRVTDINDYSPVFSEREMILRIPENSARGNTFPLNNALDSDVDINNIQTYRLSSNSHFLV
Dipodomys_ordii|981                LRVKDINDNSPVFTEKEMVFKIPENSPLGNTFLLNNALDLDVGNNNVQKYNISPNSHFHV
Spermophilus_tridecemlineatus|8765 LKVKDINDHSPVFPEREILLKILENSPLGNVFPLNNALDLDVGNNNVQNYQISPNSHFRV
Tarsius_syrichta|6606              LRVRDINDHSPVFTERETILKIPENSPLGNAFPLNNAVDLDVGTNNVQNYKISPNPHFRV
Homo_sapiens|62602                 LRVIDINDHSPMFTEKEMILKIPENSPLGTEFPLNHALDLDVGSNNVQNYKISPSSHFRV
Pan_troglodytes|34076              LRVIDINDHSPMFTEKEMLLKIPENSPLGTEFPLSHALDLDVGSNNVQNYKISPSSHFRV
Callithrix_jacchus|43619           LRVIDTNDHSPVFTEKEVVLKLPENTPLGTEFPLNHAVDMDVGSNNVQNYKISPNSHFRV
Callithrix_jacchus|25689           LRVIDINDHSPVFTEKEMVLKIPENSPLGITFPLNYAVDLDLGSNNVQNYKISPSSHFRV
                                   * : * ** ** *.* *  ::: **:  *  * *. * * *   *.:*.* :*... * *

Ochotona_princeps|6796             STRPRSDGRTYPELVLDRELDREEQAELLLTLTARDGGSPPRSGTAHIRVLVMDVNDNAP
Mus_musculus|53068                 VTRNRSDGRKYPELVLEKELDREEEPELRLTLTALDGGAPPRSGTAQVLIEVVDINDNAP
Rattus_norvegicus|32646            VTRNRSDGRKYPELVLEKELDREEEPELRLTLTALDGGSPPRSGTTQVLIEVVDTNDNAP
Dipodomys_ordii|981                LTRNRSDGRKYPELVLEKELDREQEPEVRLTLTALDGGSPPRSGTSQVRIEIVDINDNAP
Spermophilus_tridecemlineatus|8765 LTYERNNGKKYPQLVLEKELDREEEPELRLTLTALDGGSPPLSGTTQVLIEVLDINDNAP
Tarsius_syrichta|6606              LTRERSDGRKYPELVLDKELDREREPELRLTLTALDGGSPPRSGTVQVCVEVVDTNDNAP
Homo_sapiens|62602                 LIHEFRDGRKYPELVLDKELDREEEPQLRLTLTALDGGSPPRSGTAQVRIEVVDINDNAP
Pan_troglodytes|34076              LIHEFRDGRKYPELMLDKELDREEEPQLRLTLTALDGGSPPRSGTAQVRIEVVDINDNAP
Callithrix_jacchus|43619           LTRERNDGRKYPELVLDKELDREEEPQLRLTLTALDGGSPPRSGTTQVRIEVVDSNDNAP
Callithrix_jacchus|25689           LTRELRDGRKYPELVLDKELDREEEPQLRLTLTALDGGSPPRSGTTQVRIEVVDSNDNAP
                                         :*:.**:*:*::*****.:.:: ***** ***:** *** :: : ::* *****

Ochotona_princeps|6796             EFTQTLYEVQVPEDSPKGSIVVQVTARDLDAGIYGETSYALIYSSQDIRKTFELNSLSGK
Mus_musculus|53068                 KFQQPTYRVQIPENSPTGSLVLTVSANDLDSGDYGKVLYALSQPSEDISKTLEVNPVTGE
Rattus_norvegicus|32646            EFQQPTYQVQTPENSPTGSLVLTVSANDLDSGDYGKVLYALSQPSEDISKTFEVNPVTGE
Dipodomys_ordii|981                EFHHPIYWVQVPDNSSLSSLVVTVSARDINWGSYA-IVYTLAHSSEETNFII-VNPMTGE
Spermophilus_tridecemlineatus|8765 EFQQPIYKVQIPENSPVGSLVVTVSATDLDGGVYGKIIYMLFQASEDVSKTLELNPMTGE
Tarsius_syrichta|6606              EFQQPLYRVQIPESSPTGSLVVTVSARDLDSGVNSKISYTLFQPSEEISKTLEVNSMTGE
Homo_sapiens|62602                 EFEQPIYKVQIPENSPLGSLVATVSARDLDGGANGKISYTLFQPSEDISKTLEVNPMTGE
Pan_troglodytes|34076              EFEQPIYKVQIPENSPLGSLVATVSARDLDGGANGKISYTLFQPSEDISKTLEVNPMTGE
Callithrix_jacchus|43619           EFEQPIYKVQIPENSPLGSLVATVSARDLDSGANGKISYTLFQPSEDISKTLEVNPMTGE
Callithrix_jacchus|25689           EFEQPIYKVQIPENSPLGSLVATVSARDLDSGANGRISYTLFQPSEDTSKTLEVNPMTGE
                                   :* :. * ** *:.*. .*:*  *:* *:: *  .   * *  .*::    : :*.::*:

Ochotona_princeps|6796             VRLIRKLDFETVSSYEFDIEASDGGGLSGKCSVSIKVLDVNDNPPEITISSLTSSVPENF
Mus_musculus|53068                 IRLRKEVDFETIPSYEVDIKATDGGGLSGKCTLLLKVVDVNDNAPEVMLSALTSPVPENS
Rattus_norvegicus|32646            IRLRKEVNFETIPSYEVVIKATDGGGLSGKCTLLLQVVDVNDNAPEVMLSALTNPVPENS
Dipodomys_ordii|981                IRLKKQVDFETVKFYEMDIEATDGGGLSGKCTLVLQVVDINDNPPEVTMSAITNPVPENS
Spermophilus_tridecemlineatus|8765 IRLRKQVDFETVPFYEVDIKAIDGGGLWGKCTLLLQVVDVNDNHPEVSMSALTSPIPENS
Tarsius_syrichta|6606              IRLRKPVDFETVQSYEVDIKATDGGGLSGKCTLLLQLVDVNDNPPEVTTSALTSPIPENS
Homo_sapiens|62602                 VRLRKQVDFEMVTSYEVRIKATDGGGLSGKCTLLLQVVDVNDNPPQVTMSALTSPIPENS
Pan_troglodytes|34076              VRLRKQVDFEMVTSYEVRIKATDGGGLSGKCTLLLQVVDVNDNPPQLTMSALTSPIPENS
Callithrix_jacchus|43619           IRLRKQLDFETTMSYEVDIKATDGGGLSGKCTLLLQVVDVNDNPPQVTMSALTSPIPENS
Callithrix_jacchus|25689           IRLRKQLDFETTMSYEVDIKATDGGGLSGKCTLLLQVVDVNDNPPQVTMSALTSPIPENS
                                   :** : ::**    **. *:* ***** ***:: ::::*:*** *::  *::*..:*** 

Ochotona_princeps|6796             PETEVALFRIRDRDSGDNGRMIFSIQNDVPFKLKPTLDNFITLVTDGPLDREAKAHYTIT
Mus_musculus|53068                 PDEVVAVFSVKDPDSANNGKMIASIEEDLPFLLKSSGKNFYTLVTKRALDREEREKYNIT
Rattus_norvegicus|32646            PDEVVAVFSVRDPDSGNNGKVIASIEEDLPFLLKSSGKNFYTLVTKGALDREEREQLNIT
Dipodomys_ordii|981                PDTVVAVFSVSDSDSGTNGKMVSSIPEDLPFLLKSSGKNFYTLVTERALDREERDEYNIT
Spermophilus_tridecemlineatus|8765 PEMVVAVFRVSDPDSGNNGKTICSIREDMPFLLKPSGKNFYTLKTKRALDREEREEYNVT
Tarsius_syrichta|6606              PETVVAVFSVSDPDSGNNGKTIPSIQEDIPFLLKPSVKNFYTLVTERALDREARSEYNVT
Homo_sapiens|62602                 PEIVVAVFSVSDPDSGNNGKTISSIQEDLPFLLKPSVKNFYTLVTERALDREARAEYNIT
Pan_troglodytes|34076              PEIVVAVFSVSDPDSGNNGKTISSIQEDLPFLLKPSVKNFYTLVTERALDREARAEYNIT
Callithrix_jacchus|43619           PEIVVAVFSVSDPDSGNNGKTISSIQEDLPFLLKPSVKNFYTLVTERALDREAKAEYNIT
Callithrix_jacchus|25689           PEIVVAVFSVSDPDSGNNGKTISSIQEDLPFLLKPSVKNFYTLVTERALDREAKPEYNIT
                                   *:  **:* : * **. **: : ** :*:** **.: .** ** *. .**** : . .:*

Ochotona_princeps|6796             ITVSDLGTPRLQSQHNVTVHVSDVNDNAPTFSQALYTLFVLENNSPALHIGSVSASDRDA
Mus_musculus|53068                 ITVSDLGTPRLTTQHTITVQVSDTNDNAPAFNQTSYTLFVRENNSPAMHIGTISATDSDA
Rattus_norvegicus|32646            ITVTDLGIPRLTTQHTITVQVADINDNAPSFTQTSYTMFVRENNSPALHIGTISATDSDS
Dipodomys_ordii|981                ITVSDLGTPRLQTQHTITLQVSDMNDNAPEFTQSSYTLWVRENNSPALHIGTISATDRDS
Spermophilus_tridecemlineatus|8765 ITVTDMGTPRLKTQLNITVQVSDINDNAPAFRQTSYTLLVRENNQPALHIGSVSATDRDS
Tarsius_syrichta|6606              ITATDLGTPALKTQHHVTVRVSDVNDNAPAFTRAVYTLLVRENNRPALHIGSVSATDADA
Homo_sapiens|62602                 LTVTDMGTPRLKTEHNITVQISDVNDNAPTFTQTSYTLFVRENNSPALHIGSVSATDRDS
Pan_troglodytes|34076              LTVTDMGTPRLKTEHNITVQISDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDS
Callithrix_jacchus|43619           VTVTDMGTPRLQTEYSVTVQISDVNDNVPAFTQTSYTLFVRENNSPALHIGSVSATDRDS
Callithrix_jacchus|25689           VTVTDMGTPRLQTEYNVTVQISDVNDNAPTFTQSSYTLFVRENNSPALHIGSVSATDRDS
                                   :*.:*:* * * ::  :*::::* ***.* * :: **: * *** **:***::**:* *:

Ochotona_princeps|6796             GANAQITYSLLQPQGLQVNVGALLSLNAASGQLFALPLSIYETLRAFEFGVAVRNGGFPV
Mus_musculus|53068                 GSNSHISYSLLPSHDPQLALDSLISINADNGQLFALRALDYEALQAFEFHVGAIDQGSPA
Rattus_norvegicus|32646            GSNAHITYSLLPPQDPQLALDSLISINVDNGQLFALRALDYEALQGFEFHVGATDQGSPA
Dipodomys_ordii|981                GSNAQLTYSLLPPAARRRRGGGLVSINADSGQLFALRALDYEALQAFEVRVRAADRGSPP
Spermophilus_tridecemlineatus|8765 GTNAQITYSLLPNQDPNLPLASLVSINGDNGQLFALRALDFEALQSFEFHVGATDQGAPA
Tarsius_syrichta|6606              GANAQVTYSLLPPPDPRLAPAALVSANADRGRLFALRSLDYEALRAFELRVGAA------
Homo_sapiens|62602                 GTNAQVTYSLLPPQDPHLPLASLVSINADNGHLFALRSLDYEALREFEFRVSATDRGSPA
Pan_troglodytes|34076              GTNAQVTYSLLPPQDPHLPLASLVSINADNGHLFALRSLDYEALQAFEFRVGATDRGSPA
Callithrix_jacchus|43619           GTNAQVTYSLLPPQDTHLALASLVSINADNGHLFALRSLDYEALQAFEFRVGATDRGSPA
Callithrix_jacchus|25689           GTNAQVTYSLLPPQDPHLPLASLVSINADNGHLFALRSLDYEALQAFEFRVGATDRGSPA
                                   *:*::::****     .    .*:* *   *:****    :*:*: **. * .       

Ochotona_princeps|6796             LSCKA-------------------------------------------------------
Mus_musculus|53068                 LSSQALVRVVVLDDNDNAPFVLYPMQNSSAPCTELLPRAAEPGYLVTKVVAVDRDSGQNA
Rattus_norvegicus|32646            LSSQALVHVVVLDDNDNAPFVLYPLQNASAPFTELLPRAAEPGYLVTKVVAVDRDSGQNA
Dipodomys_ordii|981                LSSQALVRVQVLDANDNSPFVLYPLQNASAPCTELLPRAAEPGYLVSKVVAVDRDSGQNA
Spermophilus_tridecemlineatus|8765 LSSQALVRVVVLDDNDNPPFVLYPMQNASAPCTELVPRAAEQGYLVTKVVAVDGDSGQNA
Tarsius_syrichta|6606              ------------------------------------------------------------
Homo_sapiens|62602                 LSSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNA
Pan_troglodytes|34076              LSSEAVVHVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNA
Callithrix_jacchus|43619           LSSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRVAEPGYLVTKVVAVDGDSGQNA
Callithrix_jacchus|25689           LSSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNA
                                                                                               

Ochotona_princeps|6796             ------------------------------------------------------------
Mus_musculus|53068                 WLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDVPKHRLVLLVKDNGDPPRSASVTLHV
Rattus_norvegicus|32646            WLSFQLLKATEPGLFNVWAHNGEVRTSRLLSERDAPKHKLLLLVKDNGDPPRSASVTLHV
Dipodomys_ordii|981                WLSFQLLKATEPGLFSVWPHNGEVRTARLLSERDAPKHRLLLLVKDNGEPPRSASVTLHV
Spermophilus_tridecemlineatus|8765 WLSYQLLKATEPGLFGVWAHNGEVRTTRLLSERDAARHRLVVLVKDNGEPPLSASVTLHV
Tarsius_syrichta|6606              ------------------------------------------------------------
Homo_sapiens|62602                 WLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKQRLVVLVKDNGEPPRSATATLHV
Pan_troglodytes|34076              WLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKHRLVVLVKDNGEPPRSATATLHV
Callithrix_jacchus|43619           WLSFQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKHRLLVLVKDNGEPPRSATATLHV
Callithrix_jacchus|25689           WLSFQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKHRLLVLVKDNGEPPRSATATLHV
                                                                                               

Ochotona_princeps|6796             ------------------------------------------------------------
Mus_musculus|53068                 LVVDGFSQPYLPLPEVARNPAHDEDALTLYLVIALASVSSLFLLSVLLFVGVRLCRRARS
Rattus_norvegicus|32646            LVVDAFSQPYLPLPEVAHDPAQEEDALTLYLVIALASVSSLFLLSVLLFVGVRLCRRARA
Dipodomys_ordii|981                LLVDGFSQPYLPLPDAEAPERAQPDRLTAYLVIALAAVSSLFLLSLLLFVAARLCRRSRA
Spermophilus_tridecemlineatus|8765 LLVDGFSQPYLPLPEVA-PERAQGDSLTVYLVIALASVSSLFLFSVLVFVAVRLCRRSRA
Tarsius_syrichta|6606              ------------------------------------------------------------
Homo_sapiens|62602                 LLVDGFSQPFLPLPEAA-PGQTQANSLTVYLVVALASVSSLFLFSVLLFVAVRLCRRSRA
Pan_troglodytes|34076              LLVDGFSQPFLPLPEAA-PGQTQANSLTVYLVVALASVSSLFLFSVLLFVAVQLCRRSKA
Callithrix_jacchus|43619           LLVDGFSQPYLPLPEAA-PAQAQADSLTVYLVVALASVSSLFLFSVLLFVAVRLCRRSRA
Callithrix_jacchus|25689           LLVDGFSQPYLPLPEAA-PAQAQADSLTVYLVVALASVSSLFLFSVLLFVAVRLCRRSRA
                                                                                               

Ochotona_princeps|6796             ------------------------------------------------------------
Mus_musculus|53068                 ASLSGYSVPEGHIPGHLVDVRGVGTLSQSYQYDVCLMGDSSGTSEFNFLKPVFPSSLDQC
Rattus_norvegicus|32646            ASLSAYSVPQGHFPGQLVDVRGMGTLSQSYQYDVCLMGDSSGTSEFNFLKPVLPSSLHQC
Dipodomys_ordii|981                RSLAGCALPDGPLPGHLLDVSGTGTLAHSYQYEVCLQG-GAGTNEFKFLKPIIPNLQPQ-
Spermophilus_tridecemlineatus|8765 ASLGVCSVPEGHFPGHLVDVASTGTMSQSYQQEVCLKG-GSVTSEFKFLKPIIPILQPQ-
Tarsius_syrichta|6606              ------------------------------------------------------------
Homo_sapiens|62602                 ASVGRCSMPEGPFPGRLVDVSGTGTLSQSYQYEVCLTG-GSETSEFKFLKPIIPNFSP--
Pan_troglodytes|34076              ASVGRCSVPEGPFPGRLVDVSGTGTLSQSYQYEVCLTG-GSETSEFKFLKPIIPNFSP--
Callithrix_jacchus|43619           ASVGGCSVPEGPFPGHLVDVSGTGTLSQSYQYEVCLAG-ASGTNEFKFLKPILPNIQDQS
Callithrix_jacchus|25689           ASVGGCSVPEGPFPGHLMDVSGTGTLSQSYQYEVYLTG-GSGTNEFKFLKPIIPNFSS--
                                                                                               

Ochotona_princeps|6796             --------------------
Mus_musculus|53068                 SGKEIEENSSLHNSFGFHH-
Rattus_norvegicus|32646            SGKEIEGNSTLQNSFGFHH-
Dipodomys_ordii|981                --------------------
Spermophilus_tridecemlineatus|8765 --------------------
Tarsius_syrichta|6606              --------------------
Homo_sapiens|62602                 --------------------
Pan_troglodytes|34076              --------------------
Callithrix_jacchus|43619           PVPEMKENSNFRNDFGFSIQ
Callithrix_jacchus|25689           --------------------