Orthologs Set ID: EOG4003GN

Orthology Database
Gene Symbol(s)

Phylogenetic Tree:

Transcript Architecture:

Species Transcript ID Positions
Callithrix jacchus 41963 136, 229, 2097
Gorilla gorilla 2948 229
Homo sapiens 23308 15, 229
Homo sapiens 96461 229
Mus musculus 33441 15, 136, 229
Oryctolagus cuniculus 23296
Otolemur garnettii 6927 15, 229, 702, 1851, 1854, 1860, 1869, 1911
Pan troglodytes 10293 15, 229
Spermophilus tridecemlineatus 14889 15, 229
Tupaia belangeri 12645 21, 114, 229, 234, 289, 552, 1080, 1524, 1887, 1929
Tupaia belangeri 987

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 41963 ENSCJAT00000025407 100411556 ENSCJAG00000013074 ZNF605 calJac3
Gorilla gorilla 2948 ENSGGOT00000025137 101126128 ENSGGOG00000008782 ZNF605 gorGor3
Homo sapiens 23308 ENST00000360187 100289635 ENSG00000196458 ZNF605 hg19,GRCh37
Homo sapiens 96461 ENST00000368372 ENSG00000229631 AL603926.1 hg19,GRCh37
Mus musculus 33441 ENSMUST00000112528, NM_001163996 675812 ENSMUSG00000023284 Zfp605 mm9
Oryctolagus cuniculus 23296 ENSOCUT00000010368 ENSOCUG00000010370 ZNF605 oryCun2.0
Otolemur garnettii 6927 ENSOGAT00000006679 ENSOGAG00000006676 ZNF605 otoGar1
Pan troglodytes 10293 ENSPTRT00000021204 ENSPTRG00000005662 ZNF605 panTro2
Spermophilus tridecemlineatus 14889 ENSSTOT00000014890 speTri1
Tupaia belangeri 987 ENSTBET00000000988 ENSTBEG00000001011 tupBel1
Tupaia belangeri 12645 ENSTBET00000012646 ENSTBEG00000012643 tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 33372 ENSCJAP00000024018 100411556 ENSCJAG00000013074 ZNF605 calJac3
Gorilla gorilla 2789 ENSGGOP00000018381 101126128 ENSGGOG00000008782 ZNF605 gorGor3
Homo sapiens 68079 ENSP00000353314 100289635 ENSG00000196458 ZNF605 hg19,GRCh37
Homo sapiens 82367 ENSP00000357356 ENSG00000229631 AL603926.1 hg19,GRCh37
Mus musculus 19395 ENSMUSP00000108147 675812 ENSMUSG00000023284 Zfp605 mm9
Oryctolagus cuniculus 14847 ENSOCUP00000008931 ENSOCUG00000010370 ZNF605 oryCun2.0
Otolemur garnettii 5972 ENSOGAP00000005972 ENSOGAG00000006676 ZNF605 otoGar1
Pan troglodytes 29798 ENSPTRP00000019577 ENSPTRG00000005662 ZNF605 panTro2
Spermophilus tridecemlineatus 13341 ENSSTOP00000013338 speTri1
Tupaia belangeri 10955 ENSTBEP00000010955 ENSTBEG00000012643 tupBel1
Tupaia belangeri 879 ENSTBEP00000000859 ENSTBEG00000001011 tupBel1

multiple sequence alignment in CLUSTALW format

Mus_musculus|33441                  ATGACAGAATCAAGGATATCATTtgaggatgtggctgtagacttctcctgggaccagtgg
Oryctolagus_cuniculus|23296         ------------------------------------------------------------
Callithrix_jacchus|41963            ---------------ATATCTTTTGAGGATGTGGCTGTGGATTTCACGTTGGAGGAATGG
Gorilla_gorilla|2948                ------------------------------------------------------GGTTTT
Tupaia_belangeri|12645              ------------------GTATTTGAGGGTGTGGTTGTGGATTTCTCATTGGAGGAGTGG
Tupaia_belangeri|987                ------------------------------------------------------------

Mus_musculus|33441                  cagctgcttagccctactcaaaagagtttatacagagatgtgatgttggagaactgcagc
Oryctolagus_cuniculus|23296         ------------------------------------------------------------
Gorilla_gorilla|2948                CAAATTCTCAAACCT---------------------------------------------
Tupaia_belangeri|987                ------------------------------------------------------------

Mus_musculus|33441                  agccttgtcttcttggGTAATCAAACCACCAAACCTGATGTAACTTTCAAGCTAGATCAG
Spermophilus_tridecemlineatus|14889 NNNNNNNNNNNNNNN---------------------------------------------
Otolemur_garnettii|6927             NNNNNNNNNNNNNNN---------------------------------------------
Oryctolagus_cuniculus|23296         ---------TTTTTA---------------------------------------------
Gorilla_gorilla|2948                ------------------------------------GATGCAATTTTCAAACTGGAACAA
Pan_troglodytes|10293               AATCTGGTTTTCTTG---------------------------------------------
Homo_sapiens|96461                  AATCTGGTTTTCTTG---------------------------------------------
Homo_sapiens|23308                  AATCTGGTTTTCTTG---------------------------------------------
Tupaia_belangeri|12645              AATCTAATTTTCTTG---------------------------------------------
Tupaia_belangeri|987                ------------------------------------------------------------

Spermophilus_tridecemlineatus|14889 ------------------------------------------------NAAATTTGGCTA
Otolemur_garnettii|6927             ------------------------------------------------NAAGTCTGGCTA
Oryctolagus_cuniculus|23296         ------------------------------------------------GAAGTCTGGCTA
Pan_troglodytes|10293               ------------------------------------------------GAAGTCTGGCTA
Homo_sapiens|96461                  ------------------------------------------------GAAGTCTGGCTA
Homo_sapiens|23308                  ------------------------------------------------GAAGTCTGGCTA
Tupaia_belangeri|12645              ------------------------------------------------GAAGTCCTAAAT
Tupaia_belangeri|987                ---------------------------------------------------GTCTGGCTA
                                                                                       .*   ..::

                                    .* ..       .**.*.   *: *.****.*:**.** *. * ****** *******.:

                                    *.  .* .: .*   ** ** *....:.*** *.* : .*****.***  **** .  **

                                    *.*.*..**   *. * .***** * . *:*..**.:.* *.*** . * ***:.** * 

                                     * .*  .:***. **.  ***  ..**. ***  *   .*. * *. ***.*.:*.  .

                                       *   * ***   .. ..*    . .*:.... *.** .* .*. * . *. *.. . 

Spermophilus_tridecemlineatus|14889 AGAAGAACCAGCAGCAACGAGGCTTGTGGGACA---------------CACACGGGAGTC
                                    ****..  .*.              .    . :               *. :*.***. .

                                    *  **.** :****.****  *..  *** .* *.***.*****.**    .* ** .*.

                                    ****.*** * **.******.****.**: ** *.**..*. **.**. * **  ****.

                                    **.**. :*** .*  * ** **.....*:** *****.***...**             

                                    **. ***..*. .**** .* .*.*.***  *   *.*  :.** ******* *** ** 

                                    **. ****.** *: *            ****.**..* *:*** **.*.. * ..**: 

Mus_musculus|33441                  AACAGGCCGGCGATGAGtcacgcagtacataaaccttaccgttgcggtgattgtggggaa
                                    **.**.*.  . :*..  ** .**.** : **.** **  * ***.**** *****..* 

Mus_musculus|33441                  gttttctctcagaaattgaaacttatcattcatcgaagcacacatccaggagaaaaaccc
                                    * :***** *****. *.**.** .* .  ** *..**   .** .*******.***** 

Mus_musculus|33441                  tataaatgtagtgagtgtagaaaagctttcttttggaattcacaactcattactcatcgg
                                     .*..***** * * ***.*.**.** ** *******. *  .*.** ** **    *  

Mus_musculus|33441                  aggtcacatagagggaagaaaccttatgtatgcagtgaatgtgagaaagccttcaggagg
                                    .**:  *. * :*  *********** * .**  * *..*** ..*********** **.

Mus_musculus|33441                  aactcgcttctcattaggcatcaaaggattcacacgggagagaaaccacatagaagcagg
                                    *.***.** ***.****. ****....***** **.**:*****.**  * . .:***. 

Mus_musculus|33441                  gaatgtggtgaggccttcatcggaaaaccacaacttgctaaacatcacatgacccataca
                                    ******** **.** ** .*  ****.**.**.**    **. **** .* *  ** **.

Mus_musculus|33441                  ggagagaaG------AAATGTTATGGCTTTGAAGAAGTCTTTTTCAAGAAGTCAAAGCTA
                                    ** *:***.      .. **  . *. * *** *..* *   ** *..******.** *.

Mus_musculus|33441                  Atgagacatcaaaaaagtcacttaggggaaaaaccgaataggtgtgctgagtttggaaaa
Spermophilus_tridecemlineatus|14889 ATGCGGCATCAGAAAGTTCACTCTGGAGAGAAGCCC------------------------
Otolemur_garnettii|6927             ATGAGACATCAGAAAATTCATTTAGGAGAGAAACCC------------------------
Oryctolagus_cuniculus|23296         ATGAGACATCAAAAAGCTCATTTAGGAGAAAAATCC------------------------
Callithrix_jacchus|41963            ATAAGACATCAAAAAATTCATTTAGGAGAGAAACCA------------------------
Gorilla_gorilla|2948                ATAAGACATCAAAAAATTCACTTAGGAGAGAAACCA------------------------
Pan_troglodytes|10293               ATAAGACATCAAAAAATTCACTTAGGAGAGAAACCA------------------------
Homo_sapiens|96461                  ATAAGACATCAAAAAATTCACTTAGGAGAGAAACCA------------------------
Homo_sapiens|23308                  ATAAGACATCAAAAAATTCACTTAGGAGAGAAACCA------------------------
Tupaia_belangeri|12645              ATAAGACATCAAAAAATTCATCTAGGAGAGAAGCCC------------------------
Tupaia_belangeri|987                CTAAGACATCAAAAAATTCATCTAGGAGAGAAACCC------------------------
                                    .*..*.*****.***. ***   :**.**.**. *                         

Mus_musculus|33441                  atattccctgaaaagtcacagctcctgacacatcaaaaaagccactcaggagagagacca
Spermophilus_tridecemlineatus|14889 ------------------------------------------------------------
Otolemur_garnettii|6927             ------------------------------------------------------------
Oryctolagus_cuniculus|23296         ------------------------------------------------------------
Callithrix_jacchus|41963            ------------------------------------------------------------
Gorilla_gorilla|2948                ------------------------------------------------------------
Pan_troglodytes|10293               ------------------------------------------------------------
Homo_sapiens|96461                  ------------------------------------------------------------
Homo_sapiens|23308                  ------------------------------------------------------------
Tupaia_belangeri|12645              ------------------------------------------------------------
Tupaia_belangeri|987                ------------------------------------------------------------

Mus_musculus|33441                  tataggtgtgctgagtgtggaaaaacattccctggaaggtcatcgctcctgtcacatcaa
                                    *. .* ** .   *.*****.**.**.***  ***.*..**  .. ****.:* ** ** 

Mus_musculus|33441                  agaactcacactggggagaaaccttacaaatgcaatctgtgtggaagggccttctcccag
Tupaia_belangeri|12645              AGAACACACGCTGGGGAGAAACCC------------------------------------
                                    *****:** .* ** *****.**                                     

Mus_musculus|33441                  aggtcaagcataatatcacaccagagaacacacacgggtgagaagcccttcaaatgtggt
Tupaia_belangeri|12645              ---------------------------------------------------GACTGCAGT
                                                                                       .* **  * 

Mus_musculus|33441                  gactgtgggaaagccttcactgagaagtcgaacctccttcatcacaagagaactcacact
                                    ** ** .****..* ****  *..***** *. ** . *** **  ***.*** ** ***

Mus_musculus|33441                  ggggaaaagccctttggatgcagtgactgcgggaaagccttcgcatggaagccacatctc
                                    **.**.*..***** * .** * *** ** .*.**.** ** **.****** **** ** 

Mus_musculus|33441                  cttcagcatcagagaattcacacgggggagaaaccctttgagtgcagtgagtgtgggaag
Homo_sapiens|96461                  CTTAGGCATCAGAGAATT------------------------------------------
                                    ** ..*** ***.*.**                                           

Mus_musculus|33441                  gcatttgttcaaaaggtgcaactcattaagcatcagagacaccatacaggagagaagatc
Homo_sapiens|96461                  ------------------------------------------------------------

Mus_musculus|33441                  tataaatgcagtagctgtgaaaaagctttttttgagaagacacagcttacgatccatcag
Otolemur_garnettii|6927             GGTGCCTGTGCTCAACCAGCTAAGGCA------------------CCAACCATACACCAA
Homo_sapiens|96461                  ------------------------------------------------------------

Mus_musculus|33441                  aaaatccatacgggagagagaccttatacttgtggtgaatgtgggagatctttcactaga
Otolemur_garnettii|6927             ------------------------------------------------------------
Homo_sapiens|96461                  ------------------------------------------------------------

Mus_musculus|33441                  aactcacatctaatgaggcataagccaattcatacaagagataagtgctataggtgtagt
Otolemur_garnettii|6927             ------------------------------------------------------------
Homo_sapiens|96461                  ------------------------------------------------------------

Otolemur_garnettii|6927             ------------------------------------------------------------
Homo_sapiens|96461                  ------------------------------------------------------------

Mus_musculus|33441                  ATAAAGGCCGTA------------------------------------------------
Spermophilus_tridecemlineatus|14889 GAACCA------------------------------------------------------
Otolemur_garnettii|6927             ------------------------------------------------------------
Oryctolagus_cuniculus|23296         ------------------------------------------------------------
Gorilla_gorilla|2948                ATA---------------------------------------------------------
Pan_troglodytes|10293               ATA---------------------------------------------------------
Homo_sapiens|96461                  ------------------------------------------------------------
Homo_sapiens|23308                  ATA---------------------------------------------------------
Tupaia_belangeri|12645              ATA---------------------------------------------------------
Tupaia_belangeri|987                ACA---------------------------------------------------------

Mus_musculus|33441                  ---------------------TAA
Spermophilus_tridecemlineatus|14889 ------------------------
Otolemur_garnettii|6927             ------------------------
Oryctolagus_cuniculus|23296         ------------------------
Callithrix_jacchus|41963            GCTACATATTGGATGACTCATTGA
Gorilla_gorilla|2948                ---------------------TAA
Pan_troglodytes|10293               ---------------------TAA
Homo_sapiens|96461                  ------------------------
Homo_sapiens|23308                  ---------------------TAA
Tupaia_belangeri|12645              ---------------------TAG
Tupaia_belangeri|987                ---------------------TAG

multiple sequence alignment in CLUSTALW format

Spermophilus_tridecemlineatus|13341 MIESQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---------------
Otolemur_garnettii|5972             MSESEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---------------
Oryctolagus_cuniculus|14847         -------------------------------------------FL---------------
Gorilla_gorilla|2789                ------------------GFQILKP---------------------------DAIFKLEQ
Pan_troglodytes|29798               MIQSQISFEDVAVDFTLEEWQLLNPTQKNLYRDVMLENYSNLVFL---------------
Homo_sapiens|82367                  IMLFQISFEDVAVDFTLEEWQLLNPTQKNLYRDVMLENYSNLVFL---------------
Homo_sapiens|68079                  MIQSQISFEDVAVDFTLEEWQLLNPTQKNLYRDVMLENYSNLVFL---------------
Tupaia_belangeri|10955              ------VFEGVVVDFSLEEWQLLNPVQKNVYRDVMLEN-SNLIFL---------------
Tupaia_belangeri|879                ------------------------------------------------------------

Spermophilus_tridecemlineatus|13341 ----------------XIWLDSDSKICHQDNQDKLKSMEKGHGCDVLGKIFNSSMNFVHL
Otolemur_garnettii|5972             ----------------XVWLDNKCKMLHQDDQDTLKSMESDCEYDVLGRIFNSSMNFVHL
Oryctolagus_cuniculus|14847         ----------------EVWLDNDSKIWHQDNQDKLKSMERGHQYDVLEKIFNSSINFVPL
Pan_troglodytes|29798               ----------------EVWLDN-PKMWLRDNQDNLKSMERGHKYDVFGKIFNSSINIVHV
Homo_sapiens|82367                  ----------------EVWLDN-PKMWLRDNQDNLKSMERGHKYDVFGKIFNSSINIVHV
Homo_sapiens|68079                  ----------------EVWLDN-PKMWLRDNQDNLKSMERGHKYDVFGKIFNSSINIVHV
Tupaia_belangeri|10955              ----------------EVLNDN-CKMWQQDNQEKLKSMERDHEY-VLGKIFNISINLVNL
Tupaia_belangeri|879                -----------------VWLNDNCKMWQQDNQEKLKSMERGHDY-VLGEIFNSSINLVNL
                                                     :  :.  ::  :*:*:. * ** .    *: .: : *:* * :

                                     :* : **   * **  ::.:: * .   .*  :..*::   :*     .  :     . 

                                    *: .            ::*  **:**.: *::**** :*:*.*  ***  *.  **:*:*

                                    ** *::**::****.*    *  .:*. :** : :** ***:**:.    **::**..  

                                    :*  ::*:: *** *.:**:.****:**: *:  *.****  *:.* *****. :***  

                                    *   .**** *  * *** *.***:*:*:*******: . ******: **** *::: **

Spermophilus_tridecemlineatus|13341 GEKSHRCRDCEEAFFKKSELMRHQKVHSGEKP----------------------------
Otolemur_garnettii|5972             GEKNYQCSDCDAAFFKKSELMRHQKIHLGEKP----------------------------
Oryctolagus_cuniculus|14847         GEKNYRCSDCEEAFFRKSELMRHQKAHLGEKS----------------------------
Callithrix_jacchus|33372            GVKNYQCSDCEEAFFKKSELIRHQKIHLGEKP----------------------------
Gorilla_gorilla|2789                GEKNYRCSDCEEAFFKKSELIRHQKIHLGEKP----------------------------
Pan_troglodytes|29798               GEKNYRCSDCEEAFFKKSELIRHQKIHLGEKP----------------------------
Homo_sapiens|82367                  GEKNYRCSDCEEAFFKKSELIRHQKIHLGEKP----------------------------
Homo_sapiens|68079                  GEKNYRCSDCEEAFFKKSELIRHQKIHLGEKP----------------------------
Tupaia_belangeri|10955              GEKNYQCSDCEEA-FKKSELIRHQKIHLGEKP----------------------------
Tupaia_belangeri|879                GEKNYQCSDCEEAFFKKSELLRHQKIHLGEKP----------------------------
                                    * *  :* . : . *:**:*:**** * ***.                            

Tupaia_belangeri|10955              CRCIECGKTFFGKSQFLTHQRTHAGEKP-----------------------------DCS
                                      * :***** *:*.:*:*:***:****                             .* 

Homo_sapiens|82367                  ECRKTFSEKSSLIHHQRTHTGEKPFECSECRKAFAWKPQLLRHQRI--------------
                                    :* *:*: **.* **::*****:** *::* ******.:**:** *              

Otolemur_garnettii|5972             AFVQKVQLIKHQRNHIIKHGGACAQPAKA------PTIHQ--------------------
Homo_sapiens|82367                  ------------------------------------------------------------

Mus_musculus|19395                  NSHLMRHKPIHTRDKCYRCSQCGSIFNKKSHLIRHQKDHIIKAV----------------
Spermophilus_tridecemlineatus|13341 KSHLMRHQRSHTAGRGCARSECGSSFSSRLQLTLHQKDHAEP------------------
Otolemur_garnettii|5972             ------------------------------------------------------------
Oryctolagus_cuniculus|14847         KPHLMRHQRIHTGDNYYGCSECGTAFNKKSQLMIHQRNH---------------------
Gorilla_gorilla|2789                KSHLMRHQRIHTGDKYYGCNECGTTFNRKSQLMIHQRNHII-------------------
Pan_troglodytes|29798               KSHLMRHQRIHTGDKYYGCNECGTTFNRKSQLMIHQRNHII-------------------
Homo_sapiens|82367                  ------------------------------------------------------------
Homo_sapiens|68079                  KSHLMRHQRIHTGDKYYGCNECGTTFNRKSQLMIHQRNHII-------------------
Tupaia_belangeri|10955              KSHLMRHQRIHTEDKYYGCSERGTTFNRKSQLLRHQRNDAI-------------------
Tupaia_belangeri|879                KSHLVRHQRIHTEDKYYGCNECGTTFNRKSQLLMHQRNHVT-------------------

Mus_musculus|19395                  -------
Spermophilus_tridecemlineatus|13341 -------
Otolemur_garnettii|5972             -------
Oryctolagus_cuniculus|14847         -------
Callithrix_jacchus|33372            ATYWMTH
Gorilla_gorilla|2789                -------
Pan_troglodytes|29798               -------
Homo_sapiens|82367                  -------
Homo_sapiens|68079                  -------
Tupaia_belangeri|10955              -------
Tupaia_belangeri|879                -------