Orthologs Set ID: EOG4003GS


Orthology Database
OrthoDB4
Gene Symbol(s)
SCARF2

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 7736 241, 343, 863, 1082, 1211, 1315, 1433, 1564, 1717, 2259, 2265, 2325
Cavia porcellus 15401 96, 182, 241, 343, 863, 1082, 1211, 1315, 1448, 1564, 1717, 1951
Dipodomys ordii 3086 175, 182, 241, 343, 863, 1082, 1211, 1315, 1433, 1564, 1717, 2257, 2264, 2323
Gorilla gorilla 7164 99, 182, 241, 343, 515, 863, 1082, 1211, 1315, 1448, 1564, 1717, 1914, 2235
Homo sapiens 57027 182, 241, 343, 863, 1082, 1211, 1315, 1448, 1564, 1717
Mus musculus 15208 182, 241, 343, 863, 1082, 1211, 1315, 1448, 1564, 1717
Pan troglodytes 22120 182, 241, 343, 863, 1082, 1211, 1315, 1433, 1564, 1716, 2010, 2037, 2260, 2265, 2325
Rattus norvegicus 8663 182, 241, 343, 863, 1082, 1211, 1315, 1448, 1564, 1717
Spermophilus tridecemlineatus 12398 241, 343, 725, 863, 1082, 1211, 1315, 1433, 1564, 1717, 2244, 2257, 2264, 2323, 2361, 2373, 2388
Tarsius syrichta 2690 241, 343, 863, 1082, 1211, 1315, 1317, 1349, 1480, 1717, 1735, 1830, 2127, 2142, 2259, 2265, 2295, 2326, 2571, 2583

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 7736 ENSCJAT00000031800 100399675 ENSCJAG00000016327 SCARF2 calJac3
Cavia porcellus 15401 ENSCPOT00000025386 100725694 ENSCPOG00000027465 SCARF2 cavPor3
Dipodomys ordii 3086 ENSDORT00000003527 ENSDORG00000003527 Scarf2 dipOrd1
Gorilla gorilla 7164 ENSGGOT00000022122 101151214 ENSGGOG00000015838 SCARF2 gorGor3
Homo sapiens 57027 ENST00000405555, NM_182895 91179 ENSG00000244486 SCARF2 hg19,GRCh37
Mus musculus 15208 ENSMUST00000012161 224024 ENSMUSG00000012017 Scarf2 mm9
Pan troglodytes 22120 ENSPTRT00000026315 ENSPTRG00000014084 SCARF2 panTro2
Rattus norvegicus 8663 ENSRNOT00000000313, NM_001105864 287949 ENSRNOG00000000288 Scarf2 rn4
Spermophilus tridecemlineatus 12398 ENSSTOT00000012399 101973560 ENSSTOG00000012396 Scarf2 speTri1
Tarsius syrichta 2690 ENSTSYT00000001498 ENSTSYG00000001490 SCARF2 tarSyr1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 68 ENSCJAP00000030091 100399675 ENSCJAG00000016327 SCARF2 calJac3
Cavia porcellus 12079 ENSCPOP00000019055 100725694 ENSCPOG00000027465 SCARF2 cavPor3
Dipodomys ordii 2879 ENSDORP00000003301 ENSDORG00000003527 Scarf2 dipOrd1
Gorilla gorilla 6366 ENSGGOP00000018147 101151214 ENSGGOG00000015838 SCARF2 gorGor3
Homo sapiens 41161 ENSP00000385589 hg19,GRCh37
Mus musculus 48491 ENSMUSP00000012161 224024 ENSMUSG00000012017 Scarf2 mm9
Pan troglodytes 1538 ENSPTRP00000024260 ENSPTRG00000014084 SCARF2 panTro2
Rattus norvegicus 23182 ENSRNOP00000000313 287949 ENSRNOG00000000288 Scarf2 rn4
Spermophilus tridecemlineatus 11108 ENSSTOP00000011109 101973560 ENSSTOG00000012396 Scarf2 speTri1
Tarsius syrichta 2462 ENSTSYP00000001394 ENSTSYG00000001490 SCARF2 tarSyr1

multiple sequence alignment in CLUSTALW format


Mus_musculus|15208                  ATGGAGGGCGCAGGGTcccggggggccgggccggcgcggcgccAGGGAGCCCGAGGG---
Rattus_norvegicus|8663              ATGGAGGGCGCAGGGTCCCGGGGGGCCGGGCCGGCGCGGCGCCAGGGAGCCCGAGGGCCG
Cavia_porcellus|15401               CCCGGATCAGGGAGCCGATGTGGAATTTCCTGCCCGGCCCGGCGCCACTCCTGCCGCCCC
Dipodomys_ordii|3086                ------------------------------------------------------------
Gorilla_gorilla|7164                ---------------------------------------------------GGCGGGCCT
Callithrix_jacchus|7736             ------------------------------------------------------------
Homo_sapiens|57027                  ATGGAGGGCGCAGGGCCCCGGGGGGCCGGGCCGGCGCGGCGCCGGGGAGCCGGGGGGCCG
Pan_troglodytes|22120               ATGGAGGGCGCAGGGCCCCGGGGGGCCGGGCCGGCGCGGCGCCGGGGAGCCGGGGGGCCG
Tarsius_syrichta|2690               ------------------------------------------------------------
Spermophilus_tridecemlineatus|12398 ------------------------------------------------------------
                                                                                                

Mus_musculus|15208                  ------------------------------CTGGGACTGCTGCTGCTGCTCTGGCTGCTG
Rattus_norvegicus|8663              CCG---------------------------------CTGCTGCTGCTGCTCTGGCTGCTG
Cavia_porcellus|15401               CCGCCCAGGCCTCGCACTCCGCTTCCGGCCGCTCTACTACTCCTGCTACTCTGGCTGCTG
Dipodomys_ordii|3086                ------------------------------------------------------------
Gorilla_gorilla|7164                CCTCCA---------AGTTCGCCCCCAAGTTTGCGAGCGCTGCTGCTGCTCTGGATGCTG
Callithrix_jacchus|7736             ------------------------------------------------------------
Homo_sapiens|57027                  CCGTCA---------CCGCTGCTGCCGTCGCTGCTGCTGCTGCTGCTGCTCTGGATGCTG
Pan_troglodytes|22120               CCGTCA---------CCGCTGCTGCCGTCGCTGCTGCTGCTGCTGCTGCTCTGGATGCTG
Tarsius_syrichta|2690               ------------------------------------------------------------
Spermophilus_tridecemlineatus|12398 ------------------------------------------------------------
                                                                                                

Mus_musculus|15208                  CCCGGTCTCGCGGCGCCCCAGGACTTGAACCCGCGAGGCCGCAACGTGTGCCGCACGCCC
Rattus_norvegicus|8663              CCCGGTCTCGCGGCGGCCCAGGACTTGAACCCGCGAGGCCGCAACGTGTGCCGCACGCCC
Cavia_porcellus|15401               CCCGGCCCCGCGGCGCCCCAGGAGCTGAACCCGCGCGGCCGAAACGTGTGCCGTGCGCCC
Dipodomys_ordii|3086                ---------------------------------CGAGGCCGCAACGTGTGCCGCGCGTCC
Gorilla_gorilla|7164                CCGGACACCGTGGCGCCTCAGGAACTGAACCCTCGCGGCCGCAACGTGTGCCGTGCTCCC
Callithrix_jacchus|7736             ------------------------------------------------------ACTCAC
Homo_sapiens|57027                  CCGGACACCGTGGCGCCTCAGGAACTGAACCCTCGCGGCCGCAACGTGTGCCGTGCTCCC
Pan_troglodytes|22120               CCGGACACCGTGGCGCCTCAGGAACTGAACCCTCGCGGCCGCAACGTGTGCCGTGCTCCC
Tarsius_syrichta|2690               ------------------------------------------------------------
Spermophilus_tridecemlineatus|12398 ------------------------------------------------------------
                                                                                                

Mus_musculus|15208                  GGTTCCCAGGTGCTCACGTGTTGCGCTGGCTGGAGGCAGCTGGGGGATGAGTGTGGGATA
Rattus_norvegicus|8663              GGTTCTCAGGTGCTCACGTGCTGCGCTGGCTGGAGGCAGCTGGGGGATGAGTGTGGGATC
Cavia_porcellus|15401               GGCTCCCAAGCGCCCACGTGCTGCGCTGGCTGGAAACAGCAGGGGGACGAGTGTGGGATC
Dipodomys_ordii|3086                GGTCCCCAGGTGTTCACGTGCTGCGCTGGCTGGAGGCAGCAGGGGGACGAGTGTGGGATC
Gorilla_gorilla|7164                GGCTCCCAGGTGCCCACGTGCTGCGCTGGCTGGAGGCAGCAAGGGGACGAGTGTGGGATT
Callithrix_jacchus|7736             AGCTCCCAGGTGCCCACGTGCTGCGCCGGCTGGAGACAGCAGGGGGACGAGTGTGGGATT
Homo_sapiens|57027                  GGCTCCCAGGTGCCCACGTGCTGCGCTGGCTGGAGGCAGCAAGGGGACGAGTGTGGGATT
Pan_troglodytes|22120               GGCTCCCAGGTGCCCACGTGCTGCGCTGGCTGGAAGCAGCAAGGGGACGAGTGTGGGATT
Tarsius_syrichta|2690               ------------------------------------------------------------
Spermophilus_tridecemlineatus|12398 ---TCTCAGGTGCCCACATGCTGCGCTGGCTGGAGGCAGCAGGGGGATGAATGTGGGATA
                                                                                                

Mus_musculus|15208                  GCGGTGTGCGAAGGCAATTCCACGTGCTCAGAAAACGAGGTGTGCGTGCGGCCAGGCGAA
Rattus_norvegicus|8663              GCGGTGTGTGAAGGCAATTCCACGTGCTCAGAAAATGAGGTGTGCGTGCGGCCAGGCGAG
Cavia_porcellus|15401               GCGGTGTGCGAAGGCAACTCTACGTGCTCAGAGAACGAGGTGTGCGTGCGGCCCGGCGAG
Dipodomys_ordii|3086                GCGGTGTGCGAAGGCAACTCCACGTGCTCAGAGAACGAGGTGTGCGTGAGGCCGGGCGAG
Gorilla_gorilla|7164                GCGGTGTGCGAAGGCAACTCCACGTGCTCAGAGAACGAGGTGTGCGTGAGGCCTGGCGAG
Callithrix_jacchus|7736             GCTGTGTGTGAAGGCAACTCCACGTGCTCGGAGAACGAGGTGTGCGTGCGGCCTGGCGAG
Homo_sapiens|57027                  GCGGTGTGCGAAGGCAACTCCACGTGCTCAGAGAACGAGGTGTGCGTGAGGCCTGGCGAG
Pan_troglodytes|22120               GCGGTGTGCGAAGGCAACTCCACGTGCTCAGAGAACGAGGTGTGCGTGAGGCCTGGCGAG
Tarsius_syrichta|2690               GCGGTGTGCGAAGGCAACTCCACGTGCTCGGAGAACGAAGTGTGCGTGCGGCCGGGCGAG
Spermophilus_tridecemlineatus|12398 GCGGTTTGTGAAGGCAATTCCACATGCTCAGAGAACGAAGTGTGCGTGCGACCCGGCGAG
                                    ** ** ** ******** ** **.*****.**.** **.*********.*.** *****.

Mus_musculus|15208                  TGCCGCTGCCGACATGGCTACTTTGGTGCCAACTGCGACACAAAGTGCCCGCGCCAGTTC
Rattus_norvegicus|8663              TGCCGCTGCCGACATGGCTACTTCGGTGCCAACTGCGACACTAAGTGCCCGCGCCAGTTC
Cavia_porcellus|15401               TGCCGCTGCCGCCACGGCTACTTCGGTGCCAACTGCGACACTAAGTGCCCGCGCCAGTTC
Dipodomys_ordii|3086                TGCCGCTGCCGCCACGGCTACTTCGGTGCCAACTGCGACACTAAATGCCCGCGCCAATTC
Gorilla_gorilla|7164                TGCCGCTGCCGCCACGGCTACTTCGGTGCCAACTGCGACACCAAGTGCCCGCGCCAGTTC
Callithrix_jacchus|7736             TGCCGCTGCCGCCACGGCTACTTCGGTGCCAACTGCGACACCAAGTGCCCGCACCAGTTT
Homo_sapiens|57027                  TGCCGCTGCCGCCACGGCTACTTCGGTGCCAACTGCGACACCAAGTGCCCGCGCCAGTTC
Pan_troglodytes|22120               TGCCGCTGCCGCCACGGCTACTTCGGTGCCAACTGCGACACCAAGTGCCCGCGCCAGTTC
Tarsius_syrichta|2690               TGCCGCTGCCGTCACGGCTACTTCGGTGCCAACTGCGACACCAAGTGCCCGCGTCAGTTC
Spermophilus_tridecemlineatus|12398 TGCCGCTGCCGCCATGGCTACTTCGGTGCCAACTGCGACACTAAGTGCCCGCGCCAGTTC
                                    *********** ** ******** ***************** **.*******. **.** 

Mus_musculus|15208                  TGGGGCCCTGACTGCAAGGAGAGGTGCAGTTGCCACCCGCACGGACAGTGCGAGGACGTG
Rattus_norvegicus|8663              TGGGGCCCCGACTGCAAGGAGAGGTGCAGTTGCCATCCGCACGGACAGTGCGAGGACGTG
Cavia_porcellus|15401               TGGGGCCCCGACTGCAAGGAGCGGTGTATCTGCCACCCGCACGGGCAGTGTGAGGACGTG
Dipodomys_ordii|3086                TGGGGTCCTGACTGCAAGGAACGGTGTAGCTGCCACCCGAACGGGCAGTGTGAGGACGTG
Gorilla_gorilla|7164                TGGGGCCCCGACTGCAAGGAGCTGTGTAGCTGCCACCCACACGGGCAGTGCGAGGACGTG
Callithrix_jacchus|7736             TGGGGCCCCGACTGCAAGGAGCTGTGTAGCTGCCACCCACACGGGCAGTGCGAGGACGTG
Homo_sapiens|57027                  TGGGGCCCCGACTGCAAGGAGCTGTGTAGCTGCCACCCACACGGGCAGTGCGAGGACGTG
Pan_troglodytes|22120               TGGGGCCCCGACTGCAAGGAGCTGTGTAGCTGCCACCCACACGGGCAGTGCGAGGATGTG
Tarsius_syrichta|2690               TGGGGCCCCGACTGCAAGGAGCTGTGTAGCTGCCACCCACACGGGCAGTGCGAGGACGTG
Spermophilus_tridecemlineatus|12398 TGGGGCCCAGACTGCAAGGAGCGATGTAGCTGCCACCCGCATGGGCAGTGTGAAGACGTG
                                    ***** ** ***********.. .** *  ***** **..* **.***** **.** ***

Mus_musculus|15208                  ACCGGACAGTGTACGTGTCACGCGCGCCGCTGGGGTGCGCGCTGCGAGCATGCTTGCCAA
Rattus_norvegicus|8663              ACCGGACAGTGTACGTGTCACGCGCGCCGCTGGGGTGCGCGCTGCGAGCATGCTTGCCAG
Cavia_porcellus|15401               ACGGGCCAGTGTACTTGCCACGCGCAGCGCTGGGGCGAACGCTGCGAGCATGCGTGCCAG
Dipodomys_ordii|3086                ACGGGCCAGTGTACGTGCCACGCGCGGCGCTGGGGCGCGCGCTGCGAGCATGCGTGCCAG
Gorilla_gorilla|7164                ACAGGCCAGTGTACTTGTCACGCGCGGCGCTGGGGCGCGCGCTGCGAGCATGCGTGCCAG
Callithrix_jacchus|7736             ACAGGCCAGTGTACTTGTCACGCGCGGCGCTGGGGCGCGCGCTGCGAGCATGCGTGCCAG
Homo_sapiens|57027                  ACAGGCCAGTGTACTTGTCACGCGCGGCGCTGGGGCGCGCGCTGCGAGCATGCGTGCCAG
Pan_troglodytes|22120               ACAGGCCAGTGTACTTGTCACGCGCGGCGCTGGGGCGCGCGCTGCGAGCATGCGTGCCAG
Tarsius_syrichta|2690               ACGGGCCAGTGTACGTGCCACGCGCGGCGCTGGGGCGTTCGCTGTGAGCATGCGTGCCAG
Spermophilus_tridecemlineatus|12398 ACTGGCCAGTGTACGTGTCACGCGCGGCGCTGGGGTGCGCGCTGCGAGCATGCGTGTCAG
                                    ** **.******** ** *******. ******** *  ***** ******** ** **.

Mus_musculus|15208                  TGCCAGCATGGCACGTGCCACCCGCGGAGCGGCGCGTGCCGGTGCGAGCCGGGCTGGTGG
Rattus_norvegicus|8663              TGCCAGCATGGCACGTGCCACCCGCGGAGCGGCGCGTGCCGGTGCGAGCCGGGCTGGTGG
Cavia_porcellus|15401               TGCCAGCATGGCACGTGCCACCCACGGAGCGGCGCTTGCCGCTGTGAGCCGGGCTGGTGG
Dipodomys_ordii|3086                TGCCAGCATGGCACGTGCCACCCGCGGACCGGCGCGTGCCGCTGCGAGCCCGGCTGGTGG
Gorilla_gorilla|7164                TGCCAGCACGGCACGTGCCACCCGCGGAGCGGCGCC------------------------
Callithrix_jacchus|7736             TGCCAGCACGGCACGTGCCACCCGCGGAGCGGCGCGTGCCGCTGCGAGCCCGGCTGGTGG
Homo_sapiens|57027                  TGCCAGCACGGCACGTGCCACCCGCGGAGCGGCGCGTGCCGCTGTGAGCCCGGCTGGTGG
Pan_troglodytes|22120               TGCCAGCACGGCACGTGCCACCCGCGGAGCGGCGCGTGCCGCTGTGAGCCCGGCTGGTGG
Tarsius_syrichta|2690               TGCCAGCACGGCGCGTGCCACCCGCGGAGCGGCACCTGCCGCTGCGAGCCTGGCTGGTGG
Spermophilus_tridecemlineatus|12398 TGCCAGCATGGCACGTGCCACCCGCGGAGCGGCGCGTGCCGGTGTGAACCCGGCTGGTGG
                                    ******** ***.**********.**** ****.*                         

Mus_musculus|15208                  GGTGCGCAATGCGCTAGCGCTTGCTATTGCAGCGCTACTTCCCGGTGCGATCCACAGACA
Rattus_norvegicus|8663              GGTGCACAATGCGCTAGCGCCTGCTACTGCAGCGCTACTTCGCGCTGCGATCCACAGACA
Cavia_porcellus|15401               GGCGCACAGTGCGCTAGAGCATGCTACTGCAGCGCCACGTCGCGCTGCGACCCGCAAACG
Dipodomys_ordii|3086                GGCCCGCAGTGCGCCAGCGCCTGCTACTGCAGCGCCACGTCGCGCTGCGACCCCCAGACC
Gorilla_gorilla|7164                ------------------------------------------------------------
Callithrix_jacchus|7736             GGTGCTCAGTGCGCCAGCGCGTGCTACTGCAGCGCCACGTCGCGCTGCGACCCACAGACC
Homo_sapiens|57027                  GGCGCGCAGTGCGCCAGCGCGTGCTACTGCAGCGCCACGTCGCGCTGCGACCCACAGACC
Pan_troglodytes|22120               GGCGCGCAGTGCGCCAGCGCGTGCTACTGCAGCGCCACGTCGCGCTGCGACCCACAGACC
Tarsius_syrichta|2690               GGCGCGCAGTGCGCCAGCGCGTGCTACTGCAGCGCCACGTCTCGCTGCGACCCGCAGACC
Spermophilus_tridecemlineatus|12398 GGCTCTCAGTGCGCTAGTGCGTGCTACTGCAGTGCCACATCGCGCTGCGACCCACAGACA
                                                                                                

Mus_musculus|15208                  GGCGCCTGCCTGTGCCACGTAGGCTGGTGGGGCCGCAGCTGTAACAACCAGTGCGCCTGC
Rattus_norvegicus|8663              GGCGCCTGCCTGTGCCACGCAGGCTGGTGGGGCCGCAGCTGCAACAACCAGTGCTCCTGC
Cavia_porcellus|15401               GGCGCCTGCCAGTGCCACGCTGGCTGGTGGGGCCGCAGTTGCAACAATCAGTGCGCCTGC
Dipodomys_ordii|3086                GGCGCCTGCCTGTGCCACGCGGGCTGGTGGGGCCGCAGCTGCAACAATCAGTGCGCCTGC
Gorilla_gorilla|7164                ------------------------------------AGCTGCAACAACCGGTGCGCCTGC
Callithrix_jacchus|7736             GGCGCCTGCCTGTGCCACGCGGGCTGGTGGGGCCGCAGCTGCAACAACCAGTGCGCCTGC
Homo_sapiens|57027                  GGCGCCTGCCTGTGCCACGCAGGCTGGTGGGGCCGCAGCTGCAACAACCAGTGCGCCTGC
Pan_troglodytes|22120               GGCGCCTGCCTGTGCCACGCAGGCTGGTGGGGCCGCAGCTGCAACAACCAGTGCGCCTGC
Tarsius_syrichta|2690               GGCGCCTGCCTGTGCCACGCAGGCTGGTGGGGGCGCAGCTGCAACAACCAGTGTGCCTGC
Spermophilus_tridecemlineatus|12398 GGAGCCTGCCTGTGCCATGCAGGCTGGTGGGGCCGCAGCTGCAACAATCAGTGCGCTTGT
                                                                        ** ** ***** *.***  * ** 

Mus_musculus|15208                  AACTCGTCGCCCTGCGAGCAGCAGAGTGGCCGCTGCCAGTGTCGCGAGCGCATGTTTGGC
Rattus_norvegicus|8663              AACTCGTCGCCCTGCGAGCAGCAGAGCGGCCGCTGCCAGTGTCGCGAGCGCACGTTCGGC
Cavia_porcellus|15401               AACTCGTCGCCCTGCGAGCAGCAGAGCGGCCGCTGCCAGTGCCGCGAGCGCACATTTGGC
Dipodomys_ordii|3086                AACTCCTCGCCCTGTGAGCAGCAGAGCGGCCGCTGCCAGTGCCGCGAGCGCACGTTTGGC
Gorilla_gorilla|7164                AACTCGTCTCCCTGCGAGCAGCAGAGCGGCCGCTGTCAGTGCCGCGAGCGTACGTTCGGC
Callithrix_jacchus|7736             AACTCGTCTCCCTGCGAGCAGCAGAGCGGCCGCTGTCAGTGCCGCGAGCGTACGTTCGGC
Homo_sapiens|57027                  AACTCGTCTCCCTGCGAGCAGCAGAGCGGCCGCTGTCAGTGCCGCGAGCGTACGTTCGGC
Pan_troglodytes|22120               AACTCGTCTCCCTGCGAGCAGCAGAGCGGTCGCTGTCAGTGCCGCGAGCGTACGTTCGGC
Tarsius_syrichta|2690               AACTCGTCGCCCTGCGAGCAGCAGAGCGGCCGCTGTCAGTGCCGCGAGCGCACATTTGGC
Spermophilus_tridecemlineatus|12398 AACTCGTCGCCCTGTGAGCAGCAGAGCGGCCGCTGCCAGTGCCGCGAACGCACGTTCGGC
                                    ***** ** ***** *********** ** ***** ***** *****.** * .** ***

Mus_musculus|15208                  GCCCGCTGTGATCGCTATTGCCAGTGCTCTCACGGTCGCTGCCACCCGGTGGACGGCACG
Rattus_norvegicus|8663              GCGCGCTGTGATCGCTATTGCCAGTGCTTCCGCGGTCGCTGCCACCCGGTGGACGGCACG
Cavia_porcellus|15401               GCGCGCTGCGAGCGTTACTGCCAGTGCTTCCGCGGCCGCTGCCACCCCGTGGACGGCACG
Dipodomys_ordii|3086                GCTCGCTGCGATCGCTACTGCCAGTGCTTCCGCGGCCGCTGCAACCCCGTGGACGGCACG
Gorilla_gorilla|7164                GCGCGCTGCGATCGCTACTGCCAGTGCTTCCGCGGCCGCTGCCACCCTGTGGACGGCACG
Callithrix_jacchus|7736             GCGCGCTGCGATCGCTACTGCCAGTGCTTCCGCGGCCGCTGCCACCCTGTGGACGGCACG
Homo_sapiens|57027                  GCGCGCTGCGATCGCTACTGCCAGTGCTTCCGCGGCCGCTGCCACCCTGTGGACGGCACG
Pan_troglodytes|22120               GCGCGCTGCGATCGCTACTGCCAGTGCTTCCGCGGCCGCTGCCACCCTGTGGACGGCACG
Tarsius_syrichta|2690               GCGCGCTGCGATCGCTACTGCCAGTGCTTCCGCGGCCGCTGCCACCCTGTGGACGGCACG
Spermophilus_tridecemlineatus|12398 GCGCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                    ** ** .. .   . .  ..   ... .     ..  . ..       ....  ..   .

Mus_musculus|15208                  TGTGCCTGCGATCCTGGCTACCGGGGCAAGTATTGTCGCGAGCCATGCCCCGCTGGATTC
Rattus_norvegicus|8663              TGCGCCTGCGACCCGGGCTACCGGGGCAAGTATTGTCGTGAGCCATGCCCCGCTGGCTTC
Cavia_porcellus|15401               TGCGCCTGCGAGCCCGGCTACCGCGGCAAGTACTGTCGCGAGCCTTGTCCTGCGGGCTTC
Dipodomys_ordii|3086                TGCGCCTGCGAGCCGGGCTACCGTGGCAAGTACTGTCGCGAGCCATGCCCCGCCGGCTTC
Gorilla_gorilla|7164                TGTGCCTGCGAGCCGGGCTACCGCGGCAAGTACTGTCGCGAGCCGTGCCCCGCCGGCTTC
Callithrix_jacchus|7736             TGTGCCTGCGAGCCGGGCTACCGCGGCAAGTACTGTCGCGAGCCGTGCCCCGCCGGCTTC
Homo_sapiens|57027                  TGTGCCTGCGAGCCGGGCTACCGCGGCAAGTACTGTCGCGAGCCGTGCCCCGCCGGCTTC
Pan_troglodytes|22120               TGTGCCTGCGAGCCGGGCTACCGCGGCAAGTACTGTCGCGAGCCGTGCCCCGCCGGCTTC
Tarsius_syrichta|2690               TGCGCCTGCGAGCCCGGCTACCGCGGCAAGTACTGTCGTGAGCCGTGCCCCGCCGGCTTC
Spermophilus_tridecemlineatus|12398 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                    .. .  .. .     .. .   . ..   ..  ... . . .   ..    .  .. .. 

Mus_musculus|15208                  TATGGCCCGGGCTGTCGCCGTCGGTGTGGCCAATGCAAAGGCCAGCAGCCGTGCACGGTA
Rattus_norvegicus|8663              TACGGCCTCGGGTGTCGCCGTCGGTGTGGCCAATGCAAAGGCCAGCAGCCGTGCACAGTA
Cavia_porcellus|15401               TATGGCCTGGGCTGTCGCCGCCGGTGCGGCCAGTGCAAAGGCCAGCAGCCGTGCACTGTA
Dipodomys_ordii|3086                TACGGCTTGGGCTGTCGCCGCCGGTGCGGCCAGTGTAAAGGCCAGCAACCGTGCACCGTC
Gorilla_gorilla|7164                TACGGCTTGGGCTGTCGCCGCCGGTGTGGCCAGTGCAAGGGCCAGCAGCCGTGCACGGTG
Callithrix_jacchus|7736             TACGGCTTGGGCTGTCGCCGCCGGTGTGGCCAGTGCAAGGGCCAGCAGCCGTGCACCGTG
Homo_sapiens|57027                  TACGGCTTGGGCTGTCGCCGCCGGTGTGGCCAGTGCAAGGGCCAGCAGCCGTGCACGGTG
Pan_troglodytes|22120               TACGGCTTGGGCTGTCGCCGCCGGTGTGGCCAGTGCAAGGGCCAGCAGCCGTGCACGGTG
Tarsius_syrichta|2690               TACGGCTTGGGCTGTCGCCGCCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|12398 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                    .  ..    .. ... .  .  .... ..    ..    ..   .     ...    .. 

Mus_musculus|15208                  GTCGAAGGCCGCTGTCTGACATGCGAGCCCGGCTGGAACGGAACCAAATGTGACCAACCC
Rattus_norvegicus|8663              GTCGAAGGCCGCTGTCTGACGTGCGAACCCGGCTGGAACGGAACCAAATGTGACCAACCC
Cavia_porcellus|15401               GCCGAGGGCCGCTGCCTGACGTGCGAACCCGGCTGGAACGGAACCAAATGTGACCAGCCA
Dipodomys_ordii|3086                GCCGAGGGCCGCTGCCTGACCTGCGAGCCAGGCTGGAACGGAACCAAATGCGACCAGCCC
Gorilla_gorilla|7164                GCCGAGGGCCGCTGCTTGACGTGCGAGCCCGGCTGGAACGGAACCAAGTGCGACCAGCCT
Callithrix_jacchus|7736             GCTGAGGGCCGCTGCCTGACGTGCGAGCCTGGCTGGAACGGAACCAAGTGCGACCAGCCT
Homo_sapiens|57027                  GCCGAGGGCCGCTGCTTGACGTGCGAGCCCGGCTGGAACGGAACCAAGTGCGACCAGCCT
Pan_troglodytes|22120               GCCGAGGGCCGCTGCTTGACGTGCGAGCCCGGCTGGAACGGAACCAAGTGCGACCAGCCT
Tarsius_syrichta|2690               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|12398 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                    .  .  ..  . ..  ..   .. .     .. ...   ..       .. .        

Mus_musculus|15208                  TGCGCCACCGGTTTCTACGGCGAAGGTTGTGGCCACCGCTGCCCACCCTGCCGCGACGGG
Rattus_norvegicus|8663              TGCGCCACTGGTTTTTATGGCGAGGGTTGTGGCCACCGCTGTCCACCCTGCCGCGATGGG
Cavia_porcellus|15401               TGTGCCGCCGGCTTTTATGGCGAGGGCTGCGGTCACCGCTGCCCGCCCTGCCGCGACGGG
Dipodomys_ordii|3086                TGCGCCACCGGCTTCTACGGGGAGGGCTGTGAACACCGCTGCCCGCCCTGTCGCGACGGG
Gorilla_gorilla|7164                TGCGCCACCGGTTTCTATGGCGAGGGCTGCAGCCACCGCTGTCCGCCATGCCGCGACGGG
Callithrix_jacchus|7736             TGCGCCACCGGTTTCTATGGCGAGGGCTGCAGCCACCGCTGTCCGCCGTGCCGCGACGGG
Homo_sapiens|57027                  TGCGCCACCGGTTTCTATGGCGAGGGCTGCAGCCACCGCTGTCCGCCATGCCGCGACGGG
Pan_troglodytes|22120               TGCGCCACCGGTTTCTATGGCGAGGGCTGCAGCCACCGCTGTCCGCCATGCCGCGACGGG
Tarsius_syrichta|2690               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|12398 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                    .. .     .. .. .  .. .  .. ..        . ..       ..  . .  ...

Mus_musculus|15208                  CATGCCTGCAACCATGTCACCGGCAAGTGTACGCACTGCAATGCGGGCTGGATCGGCGAC
Rattus_norvegicus|8663              CATGCCTGCAACCATGTCACCGGCAAGTGTACGCACTGCAATGCGGGCTGGATCGGCGAC
Cavia_porcellus|15401               CACGCCTGCAACCACGTCACCGGAAAGTGTACTCGCTGCAACGCTGGCTGGATTGGCGAC
Dipodomys_ordii|3086                CATGCCTGCAACCACGTCACTGGCAAATGCACACGCTGCAACGCGGGCTGGATTGGCGAC
Gorilla_gorilla|7164                CATGCCTGTAACCATGTCACCGGCAAGTGTACGCGCTGCAACGCGGGCTGGATCGGCGAC
Callithrix_jacchus|7736             CATGCCTGTAACCACGTCACCGGCAAGTGTACGCGCTGCAACGCGGGCTGGATCGGCGAC
Homo_sapiens|57027                  CATGCCTGTAACCATGTCACCGGCAAGTGTACGCGCTGCAACGCGGGCTGGATCGGCGAC
Pan_troglodytes|22120               CATGCCTGTAACCATGTCACCGGCAAGTGTACGCGCTGCAACGCGGGCTGGATCGGCGAC
Tarsius_syrichta|2690               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|12398 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                       .  ..       ..    ..    ..       ..    .  .. ... . .. .  

Mus_musculus|15208                  CGGTGCGAGACTAAGTGCAGTAATGGCACTTACGGTGAGGACTGTGCCTTCGTGTGCTCT
Rattus_norvegicus|8663              CGGTGCGAGACTAAGTGCAGTAATGGCACTTACGGTGAGGACTGTGCCTTCGTGTGTTCT
Cavia_porcellus|15401               CGGTGCGAGACCAAGTGCAGCAATGGCACTTACGGGGAGGACTGCGCCTTCGTGTGCGCC
Dipodomys_ordii|3086                CGGTGTGAGACCAAGTGCAGCAATGGCACTTATGGCGAGGACTGTGCGTTCGTGTGTGCG
Gorilla_gorilla|7164                CGGTGCGAGACCAAGTGTAGCAATGGCACTTACGGCGAGGACTGCGCCTTCGTGTGCGCC
Callithrix_jacchus|7736             CGGTGCGAGACCAAGTGTAGCAATGGCACTTATGGCGAGGACTGCGCCTTCGTGTGCGCT
Homo_sapiens|57027                  CGGTGCGAGACCAAGTGTAGCAATGGCACTTACGGCGAGGACTGCGCCTTCGTGTGCGCC
Pan_troglodytes|22120               CGGTGCGAGACCAAGTGTAGCAATGGCACTTACGGCGAGGACTGCGCCTTCGTGTGCGCC
Tarsius_syrichta|2690               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|12398 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                     .... . .     ...  .   ...   ..  .. . ..  .. .  .. .....    

Mus_musculus|15208                  GATTGCGGCAGCGGCCACTGTGACTTCCAGTCCGGGCGCTGCCTTTGCAGCCCTGGTGTT
Rattus_norvegicus|8663              GACTGCGGCAGCGGCCACTGTGACTTCCAGTCCGGGCGCTGCCTTTGCAGCCCTGGTGTT
Cavia_porcellus|15401               GACTGCGCCAGCGGCCACTGTGACTTCCAGTCGGGACGCTGCCTTTGCAGCCCTGGTGTC
Dipodomys_ordii|3086                GACTGCGGCAGCGGCCACTGTGACTTCCAGTCAGGGCGCTGCCTTTGCAGCCCTGGTGTC
Gorilla_gorilla|7164                GACTGCGGCAGCGGACACTGCGACTTCCAGTCGGGGCGCTGCCTGTGCAGCCCTGGCGTC
Callithrix_jacchus|7736             GACTGCGGCAGCGGCCACTGCGACTTCCAGTCGGGGCGCTGCCTATGCAGCCCTGGCGTC
Homo_sapiens|57027                  GACTGCGGCAGCGGACACTGCGACTTCCAGTCGGGGCGCTGCCTGTGCAGCCCTGGCGTC
Pan_troglodytes|22120               GACTGCGGCAGCGGACACTGCGACTTCCAGTCGGGGCGCTGCCTGTGCAGCCCTGGCGTC
Tarsius_syrichta|2690               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|12398 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                    .  .. .   . ..    .. .  ..   ..  ..  . ..  . ..  .   ... .. 

Mus_musculus|15208                  CACGGACCTCACTGTAATGTAACTTGCCCGGCCGGGCTCCACGGCGTGGACTGCGCCCAG
Rattus_norvegicus|8663              CACGGACCTCACTGTAATGTAACTTGCCCGGCCGGGCTCCATGGTGTGGACTGCGCCCAG
Cavia_porcellus|15401               CACGGACCCCACTGTAACATGACGTGTCCGATGGGGCACCACGGCGTGGACTGCGCTCAG
Dipodomys_ordii|3086                CACGGGCCTCACTGTAACGTAACATGCCCGCCAGGGCTCCACGGCGTGGACTGCGCCCAG
Gorilla_gorilla|7164                CACGGGCCCCACTGTAACGTGACGTGCCCGCCCGGACTCCACGGCGCGGACTGTGCTCAG
Callithrix_jacchus|7736             CACGGGCCCCACTGTAACGTGACGTGCCCGCTCGGACTCCACGGCGTGGACTGTGCTCAG
Homo_sapiens|57027                  CACGGGCCCCACTGTAACGTGACGTGCCCGCCCGGACTCCACGGCGCGGACTGTGCTCAG
Pan_troglodytes|22120               CACGGGCCCCACTGTAACGTGACGTGCCCGCCCGGACTCCACGGCGCGGACTGTGCTCAG
Tarsius_syrichta|2690               NNNNNNNNNNNCTGTAACGTGACTTGCCCGCCCGGGCTCCATGGCGTGGATTGCGCCCAG
Spermophilus_tridecemlineatus|12398 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                       ..       ...    .    ..   .   ..       .. . ..  .. .    .

Mus_musculus|15208                  GCCTGCAGCTGTCACGAGGAATCATGCGACCCGGTCACCGGTGCCTGCCACCTGGAGACC
Rattus_norvegicus|8663              GCCTGCAGCTGTCACGAGGAATCATGCGACCCGGTCACCGGGGCCTGCCACCTGGAGACC
Cavia_porcellus|15401               ACCTGCAGCTGCCACGAGGACTCCTGCGACCCGGTTACCGGTGCCTGCCACCTGGAGACC
Dipodomys_ordii|3086                GCCTGTAGCTGCCACGAGGACTCATGTGACCCGGTCACTGGTGCCTGCCGCTTGGAAACC
Gorilla_gorilla|7164                GCCTGCAGCTGCCACGAGGACTCGTGCGACCCGGTCACTGGTGCCTGCCACCTAGAAACC
Callithrix_jacchus|7736             GCCTGCAGCTGCCACGAGGACTCGTGCGACCCTGTCACTGGTGCCTGCCACCTAGAGACA
Homo_sapiens|57027                  GCCTGCAGCTGCCACGAGGACACGTGCGACCCGGTCACTGGTGCCTGCCACCTAGAAACC
Pan_troglodytes|22120               GCCTGCAGCTGCCACGAGGACTCGTGCGACCCGGTCACTGGTGCCTGCCACCTAGAAACC
Tarsius_syrichta|2690               GCCTGCCGCTGCCACGAGGACTCGTGCGACCCGGTCACTGGTGCCTGCCGCCTGGAAACC
Spermophilus_tridecemlineatus|12398 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                       ..  . ..    . ..     .. .     ..    .. .  ..     . .     

Mus_musculus|15208                  AATCAGCGCAAAGGTGTGATGGGCGCGGGCGCTCTGCTCACGCTGCTCCTCGGCCTGCTG
Rattus_norvegicus|8663              AATCAGCGCAAAGGTGTGATGGGCGCCGGCGCGCTGCTCACGCTGCTCCTCGGCCTGCTG
Cavia_porcellus|15401               AACCAGCGCAAGGGCGTGATGGGCGCGGGCGCGCTGCTC------------GCCCTGCTC
Dipodomys_ordii|3086                AATCAACGCAAAGGCGTGATGGGCGCGGGCGCGCTGCTCACCCTGCTCCTGGGCCTCCTG
Gorilla_gorilla|7164                AACCAGCGCAAGGGCGTGATGGGCGCCGGCGCGCTGCTCGTCCTGCTCGTCTGCCTGCTG
Callithrix_jacchus|7736             AACCAGCGCAAGGGCGTGATGGGCGCGGGCGCGCTGCTCGTCCTGCTCGTCTGCCTGCTG
Homo_sapiens|57027                  AACCAGCGCAAGGGCGTGATGGGCGCGGGCGCGCTGCTCGTCCTGCTCGTCTGCCTGCTG
Pan_troglodytes|22120               AACCAGCGCAAGGGCGTGATGGGCGCGGGCGCGCTGCTCGTCCTGCTCGTCTGCCTGCTG
Tarsius_syrichta|2690               CACCTGATAAGCGGCGTGATGGGTGGGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|12398 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                                .. ... .... .  .. .   .. .                 .  . 

Mus_musculus|15208                  CTCTCGCTGCTCGGTTGTTGCTGCGCCTGCCGGGGCAAGGACTCGGCG------------
Rattus_norvegicus|8663              CTCTCGCTGCTCGGTTGTTGCTGTGCCTGCCGGGGCAAGGACTCGGCG------------
Cavia_porcellus|15401               CTCTCGCTGCTCGGCTGCTGCTGCGCCTGCCGTGGCAAGGACCCGATC------------
Dipodomys_ordii|3086                CTCTCGCTACTTGGCTGCTGCTGCGCCTGCCGCGGCAAGGACCCCGTGAGTCGGCCCTGC
Gorilla_gorilla|7164                CTCTCGCTGCTCGGCTGCTGCTGCGCTTGCCGCGGCAAGGACCCTGCG------------
Callithrix_jacchus|7736             CTCTCGCTACTCGGCTGCTGCTGCGCTTGCCGCGGCAAGGACCCTGCGCGCAGACCCCGC
Homo_sapiens|57027                  CTCTCGCTGCTCGGCTGCTGCTGCGCTTGCCGCGGCAAGGACCCTACG------------
Pan_troglodytes|22120               CTCTCGCTGCTCGGCTGCTGCTGCGCTTGCCGCGGCAAGGACCCTGCGCGCCGACCCCGC
Tarsius_syrichta|2690               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|12398 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                     . . . .  . .. .. .. .. .  ..  . ..   ..                    

Mus_musculus|15208                  ---CGCCGGGAGCTCACCCTTGGAAGGAAGAAGGCGCCTCAACGTTTTTGTGGAAGCTTC
Rattus_norvegicus|8663              ---CGCCGGGAGCTCACCCTCGGAAGGAAGAAGGCACCTCAACGCTTTTGTGGAAGCTTC
Cavia_porcellus|15401               ---CGCCGGGAGCTCTCGCTGGGAAGGAAGAAGGCTCCGCATCGCCTGTGTGGGCGCTTC
Dipodomys_ordii|3086                CCCCGCAGGGAGCTTTCGCTTGGAAGGAAGAAGGCTCCACAACGCCTGTGTGGTCGCTTC
Gorilla_gorilla|7164                ---CGCCGGGAGCTTTCGCTTGGGAGGAAGAAGGCGCCGCACCGACTATGCGGGCGCTTC
Callithrix_jacchus|7736             CCCCACAGGGAGCTCTCGCTTGGGAGGAAGAAGGCGCCACACCGACTGTGCGGACGCTTC
Homo_sapiens|57027                  ---CGCCGGGAGCTTTCGCTTGGGAGGAAGAAGGCGCCGCACCGACTATGCGGGCGCTTC
Pan_troglodytes|22120               CCCCGCAGGGAGCTTTCGCTTGGGAGGAAGAAGGCGCCGCACCGACTATGCGGGCGCTTC
Tarsius_syrichta|2690               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|12398 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                           ... . .     . ..  ..  .  ..         .  . .. ..  . .. 

Mus_musculus|15208                  AGCCGCATCAGCATGAAGCTGCCCCGAATCCCGCTTCGCAGGCAGAAGCTGCCCAAAGTC
Rattus_norvegicus|8663              AGCCGCATCAGCATGAAGCTACCCCGAATCCCGCTTCGCAGGCAGAAGCTGCCCAAAGTC
Cavia_porcellus|15401               AGCCGCATCAGCATGAAGCTGCCCCGGATCCCGCTGCGCAGGCAGAAGTTACCCAAAGTC
Dipodomys_ordii|3086                AGCCGCATCAGCATGAAGCTGCCCCGGATCCCACTCCGCAGGCAAAAGTTGCCCAAAGTC
Gorilla_gorilla|7164                AGTCGCATCAGCATGAAGCTGCCCCGGATCCCGCTCCGGAGGCAGAAACTACCCAAAGTC
Callithrix_jacchus|7736             AGTCGCATCAGCATGAAGCTGCCCCGGATCCCGCTCCGCAGGCAGAAATTACCCAAAGTC
Homo_sapiens|57027                  AGTCGCATCAGCATGAAGCTGCCCCGGATCCCGCTCCGGAGGCAGAAACTACCCAAAGTC
Pan_troglodytes|22120               AGTCGCATCAGCATGAAGCTGCCCCGGATCCCGCTCCGGAGGCAGAAACTACCCAAAGTC
Tarsius_syrichta|2690               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|12398 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                     .  .  .  .  ..  . .     .  .     .  .  ..       .       .. 

Mus_musculus|15208                  GTAGTGGCCCATCATGACCTAGACAACACACTCAACTGCAGTTTTCTGGACCCACCCTCA
Rattus_norvegicus|8663              GTAGTGGCCCATCATGACTTAGACAACACGCTCAACTGCAGTTTCCTGGAACCACCTTCA
Cavia_porcellus|15401               GTAGTGGCCCATCACGACCTGGACAACACACTCAACTGCAGCTTCCTGGAACCACCCTCA
Dipodomys_ordii|3086                GTAGTGGCTCATCATGACCTGGACAACACACTCAACTGCAGCTTCCTGGAACCACCCTCA
Gorilla_gorilla|7164                GTAGTGGCCCACCACGACCTGGATAACACACTCAACTGCAGCTTCCTGGAGCCACCCTCA
Callithrix_jacchus|7736             GTAGTGGCCCACCACGACCTGGATAACACACTCAACTGCAGCTTCCTGGAGCCACCCTCA
Homo_sapiens|57027                  GTAGTGGCCCACCACGACCTGGATAACACACTCAACTGCAGCTTCCTGGAGCCACCCTCA
Pan_troglodytes|22120               GTAGTGGCCCACCACGACCTGGATAACACACTCAACTGCAGCTTCCTGGAGCCACCCTCA
Tarsius_syrichta|2690               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---
Spermophilus_tridecemlineatus|12398 NNNNTGGCCCATCACGACCTGGACAACACCCTCAACTGCAGCTTCCTGGAACCTCCCTCA
                                    .. ....        .   . .         .    ..  . ..  ...           

Mus_musculus|15208                  GGGCTGGAGCAGCCCTCTCCATCATGGTCCTCCAGGGCCTCCTTCTCATCATTCGACACC
Rattus_norvegicus|8663              GGGCTGGAGCAGCCCTCTCCATCATGGTCCTCCAGGGCCTCCTTCTCATCATTTGACACC
Cavia_porcellus|15401               GGGTTGGATCAGCCCTCACCATCTTGGTCCTCCCGAGCCTCTTTCTCCTCCTTTGACACC
Dipodomys_ordii|3086                GGACTGGAACAGCCTTCACCTTCATGGTCCTCCCGAGCCTCCTTCTCATCCTTCGACACC
Gorilla_gorilla|7164                GGGCTGGAGCAGCCCTCACCATCCTGGTCCTCTCGGGCCTCCTTCTCCTCGTTTGACACC
Callithrix_jacchus|7736             GGGCTGGAGCAGCCCTCGCCATCCTGGTCCTCTCGAGCCTCCTTCTCCTCGTTTGACACC
Homo_sapiens|57027                  GGGCTGGAGCAGCCCTCACCATCCTGGTCCTCTCGGGCCTCCTTCTCCTCGTTTGACACC
Pan_troglodytes|22120               GGGCTGGAGCAGCCCTCACCATCCTGGTCCTCTCGGGCCTCCTTCTCCTCGTTTGACACC
Tarsius_syrichta|2690               ------------------------------------------------------------
Spermophilus_tridecemlineatus|12398 GGACTGGAGCAGCCCTCACCATCATGGTCTTCCAGAGCCTCCTTCTCCTCCTTTGATACC
                                                                                                

Mus_musculus|15208                  ACAGATGAAGGCCCTGTGTACTGTGTGCCCCACGAGGAAGCGACTGCCGACAGCCGAGAC
Rattus_norvegicus|8663              ACAGATGAAGGCCCTGTGTACTGTGTGCCCCACGAGGAGGCGACTGCTGAGAACCGAGAC
Cavia_porcellus|15401               ACAGATGAAGGCCCTGTGTACTGTGTTCCCCATGAGGAGGCGGCAGCCGAGACCCGGGAC
Dipodomys_ordii|3086                ACAGATGAAGGCCCTGTGTACTGTGTCCCGCATGAGGAGGCCGCAACGGAGAGCCGAGAA
Gorilla_gorilla|7164                ACTGATGAAGGCCCTGTGTACTGTGTACCCCATGAGGAGGCACCAGCGGAGAGCCGGGAC
Callithrix_jacchus|7736             ACTGACGAAGGCCCTGTGTACTGTGTACCCCATGAGGAGGCACCAGCGGAGAGCCGGGAC
Homo_sapiens|57027                  ACTGATGAAGGCCCTGTGTACTGTGTACCCCATGAGGAGGCACCAGCGGAGAGCCGGGAC
Pan_troglodytes|22120               ACTGATGAAGGCCCTGTGTACTGTGTACCCCATGAG------------------------
Tarsius_syrichta|2690               ---------------------NNNNNNNNNNNNNNNNAGGCAGCAACTGAGAGCCGGGAC
Spermophilus_tridecemlineatus|12398 ACAGATGAAGGCCCTGTGTATTGTGTACCCCATGAGGAGGTTGCAGCTGACAGCCGAGAC
                                                         .....       . .                        

Mus_musculus|15208                  CTGGAAGCGACTGCCGCTCTCACTGAGGTGGCCGCTGTGTCCTTAGAGCCCACGGGCACC
Rattus_norvegicus|8663              CCAGAAGCTTCTGCCTCTCTCACTGAGGTGCCCGCTGTGTCCCTAGCGCCCATGGGCACT
Cavia_porcellus|15401               CCAGAGGCTCCCTCTGCTCCTGCAGAGGCGCCGGTGCCTTCCCCGGCGCTCTTAACCACC
Dipodomys_ordii|3086                CCAGAGGCCACAACCTTGCCTACTGACGCACCAGCGCCTTCCCCGGCGACCTTGACCACC
Gorilla_gorilla|7164                CCCGAAGTCCCCACTGTCCCTGCCGAGGCGCCGGCGCCGTCCCCTGTGCCCTTGACCACG
Callithrix_jacchus|7736             CCCGAAGTCCCCACTGTCCCTGCCGAGGCGCCGGCGCCGTCCCCCGTGCCCTTGACCACT
Homo_sapiens|57027                  CCCGAAGTCCCCACTGTCCCTGCCGAGGCGCCGGCGCCGTCCCCTGTGCCCTTGACCACG
Pan_troglodytes|22120               ------------------------------------------------------------
Tarsius_syrichta|2690               CCAGAGGTATCCCCCGTCCCTGTCGAGGCGCCGGCTCCATCCCCCGTGTCCTTGACTACG
Spermophilus_tridecemlineatus|12398 TCAGAGGCCCCCATTGCTCCTGCTGAGGCTCTGGCACCTTCTCCTGCACCCTTGAGCACT
                                                                                                

Mus_musculus|15208                  TCGACGCCCGGGGAGGAG---GCAGCGGTCCTCCCTGCATCCTCAGACAGCGAGCGCTCC
Rattus_norvegicus|8663              TCGGTGCCCGGGGATGAG---GCAGCAGCCCTCCCTGCATCCTCAGACAGCGAGCGCTCA
Cavia_porcellus|15401               CTGGCGTCGGCAGAGGAG---GCACCTCCGCTCTCTGCGTCCTCTGACAGCGAGCGGTCG
Dipodomys_ordii|3086                CGGGCGTCCGCAGAGGAAGCAGCAGCGCCCCTCCCGGCGTCCTCTGACAGCGAGCGCTCA
Gorilla_gorilla|7164                CCAGCCTCCGCCGAGGAG---GCGATGCCCCTCCCCGCGTCCTCCGACAGCGAGCGGTCG
Callithrix_jacchus|7736             CCAGCGTCCGCCGAGGAG---GCGATGCCCCTCCCCGCGTCTTCCGACAGCGAGCGGTCG
Homo_sapiens|57027                  CCAGCCTCCGCCGAGGAG---GCGATACCCCTCCCCGCGTCCTCCGACAGCGAGCGGTCG
Pan_troglodytes|22120               ------------------------------------------------------------
Tarsius_syrichta|2690               CCGGTGGCTGCCAAGGAG---GCGACACCC---CGCATGACCTCCGATAGTGAGCGGTTG
Spermophilus_tridecemlineatus|12398 CCCGCATCAACAGAGGAA---GCAACGCCCCTCCCTGCATCTTCCGACAGCGAGCGGTCA
                                                                                                

Mus_musculus|15208                  GCATCAAGCGTGGAGGGGCCGAGCGGGGCGCTGTACGCGCGTGTggcccggcgcgaggcc
Rattus_norvegicus|8663              GCATCAAGCGTGGAGGGGCCGGGCGGGGCGCTGTACGCGCGTGTGGCCCGGCGCGAGGCC
Cavia_porcellus|15401               GCGTCCAGCGTGGAGGGACCCGGCGGGGCGTTGTACGCACGCGTG---------------
Dipodomys_ordii|3086                GCGTCCAGTGTGGAGGGGCCTGGCGGGGCGCTGTACGCACGCGTAGCCCGGCGCGAGGCC
Gorilla_gorilla|7164                GCGTCCAGCGTGGAGGGGCCCGGAGGGGCTTTGTACGCGCGCGTGGCCCGACGC------
Callithrix_jacchus|7736             GCGTCCAGCGTGGAGGGGCCCGGCGGGGCTCTGTACGCGCGCGTGGCCCGACGCGAGGCC
Homo_sapiens|57027                  GCGTCCAGCGTGGAGGGGCCCGGAGGGGCTCTGTACGCGCGCGTGGCCCGACGCGAGGCC
Pan_troglodytes|22120               ------------------------------------------------------------
Tarsius_syrichta|2690               GCGTCCAGCCTGAAGGGACCCATTGGGGCTCTATTTCCGTGCATCGTCTGGCGTGAGGCC
Spermophilus_tridecemlineatus|12398 GCTTCCAGCGTGGAAGGGCCGGGCGGGGCGCTATACGCTCGTGTGGCTCGGCGCGAGGCC
                                                                                                

Mus_musculus|15208                  cggccggcccggACCCGAAATGAGGCTGGGGGCTTGTCACTGTCCCCATCGCCCGAGCGC
Rattus_norvegicus|8663              CGGCCGGCCCGGACCCGATGTGAGGCTGGGGGCTTGTCACTGTCCCCATCGCCCGAGCGC
Cavia_porcellus|15401               ------------------------------GgTTTGTCGCTGTCGCCATCGCCTGAACGC
Dipodomys_ordii|3086                CGGCCGGTCCGGGCCCGAGGTGAGGCTGGGGGCCTGTCGCTTTCGCCATCGCCCGAGCGC
Gorilla_gorilla|7164                ---------------------GAGATTGGGGGCCTGTCGCTGTCGCCATCGCCCGAGCGC
Callithrix_jacchus|7736             CGGCCGGCCCGGGCCCGAGGCGAAGTTGGGGGCCTGTCGCTGTCGCCATCGCCCGAGCGC
Homo_sapiens|57027                  CGGCCGGCCCGGGCCCGGGGCGAGATTGGGGGCCTGTCGCTGTCGCCATCGCCCGAGCGC
Pan_troglodytes|22120               ------------------------------------------------------------
Tarsius_syrichta|2690               CGGCCGGACCAGGCCGGGGGCGAGGCTGGGGGCCTGTCGCTG------TCTCTCAAGCGC
Spermophilus_tridecemlineatus|12398 CGGCCGGCCCGGGCCCGGGCCGAGGCTGGGGGCTTGTCCCTGTCGCCATCGCCCGAGCGC
                                                                                                

Mus_musculus|15208                  AGGAAGCCGCCACCACCAGACCCTGCCACCAAGCCTAAGGTGTCCTGGATCCACGGCAAG
Rattus_norvegicus|8663              AGGAAGCCACCGCCACCCGACCCTGCCACCAAGCCTAAGGTGTCCTGGATCCACGGCAAG
Cavia_porcellus|15401               AGGAAGCCGCCGCCACCGGACCCCGCTACCAAGCCCAAGGTGTCTTGGATCCATGGCAAG
Dipodomys_ordii|3086                AGGAAACCGCCGCCACCCGACCCTGCCACCAAGCCCAAAGTGTCCTGGATCCATGGCAAG
Gorilla_gorilla|7164                AGGAAACCGCCGCCACCTGACCCCGCCACCAAGCCTAAGGTGTCCTGGATCCACGGCAAG
Callithrix_jacchus|7736             AGGAAACCACCGCCACCTGACCCCGCCACCAAGCCTAAGGTGTCCTGGATCCACAGCAAG
Homo_sapiens|57027                  AGGAAACCGCCGCCACCTGACCCCGCCACCAAGCCTAAGGTGTCCTGGATCCACGGCAAG
Pan_troglodytes|22120               ---------------------CCCGCCACC---CCTAAGGTGTCCTGGATCCACGGC---
Tarsius_syrichta|2690               AGAAAGCCGCCACCTCCCGACCCCGCCACCAAGCCCAAGGTGTCCTGGATCCACGGCAAA
Spermophilus_tridecemlineatus|12398 AGAAAGCCGCCGCCACCTGACCCCGCCACCAAGCCTAAGGTGTCCTGGATCCACCGCAAG
                                                         ** ** ***   ** **.***** ********  **   

Mus_musculus|15208                  CACAGCGCCGCTGCCGCT------GCACCGTCGCCTCCGCCTGCAGGCCGCAAGGCTGCG
Rattus_norvegicus|8663              CAAGGCGCCGTGGCCGCT------GCACCTTCGCCGCCGCCCGCAGGCCGCAAGGCTGCG
Cavia_porcellus|15401               CACGGCGCCGCTGCCGCGACCCAAGCGCCCTCACCATCGCCCCCGGGCCCGGAGCCTGCA
Dipodomys_ordii|3086                CACGGAGCCGCCGCCGCGGCCCGCGCGCCCTCGCCGCCACCTCCGGGTCCTGAGGCTGCA
Gorilla_gorilla|7164                CACAGCGCCGCTGCAGCTGGCCGTGCGCCCTCACCACCGCCGCCAGGCTCCGAGGCCGCG
Callithrix_jacchus|7736             CACAGCGCCGCTGCAGCTGGCTGTGCACCCTCACCACCGCCGCCCGGCCCCGAGGCCGCG
Homo_sapiens|57027                  CACAGCGCCGCTGCAGCTGGCCGTGCGCCCTCACCACCGCCGCCAGGCTCCGAGGCCGCG
Pan_troglodytes|22120               CACAGCGCCGCTGCAGCTGGCCGTGCGCCCTCACCACCGCCGCCAGGCTCCGAGGCCGCG
Tarsius_syrichta|2690               CACGGCGCCGCCGCCGCGACCCGTGCACCTTCGCCGCCGGCCTCAGGCCTGGAGACCGCG
Spermophilus_tridecemlineatus|12398 CATGGCGCAGCTGCCGCGGCCCGAGCGCCCTCGCCGCCACCTCAGGGCCCCGAGACTGCG
                                    ** .*.**.*  **.**       **.** **.**  *. *  . **    .** * **.

Mus_musculus|15208                  CCGAGCCCTAGCGGGAGGAAACGGACCCCCAGCAACTCGTCGGTG---------------
Rattus_norvegicus|8663              CCGAGCCCTAGCGGGAGGAAACGGACCCCCAGCAACATGTCGGTG---------------
Cavia_porcellus|15401               CCCAGCCCCAGCAAGAGGAAACGGACACCCAGTGACACGTCGGCGCGGCCGGAGGAGCCC
Dipodomys_ordii|3086                CCCAGTCCCAGCAAGAGGAAACGGACACCCAGCGACACGTCGGCG---------------
Gorilla_gorilla|7164                CCCAGCCCCAGCAAGAGGAAACGGACGCCCAGCGACAAATCGGCGCAGCCGGTCGAACAC
Callithrix_jacchus|7736             CCCAGCCCCAGCAAGAGGAAACGGACGCCCAGCGACAAATCGGCGCAGCCGGTCGAGCAC
Homo_sapiens|57027                  CCCAGCCCCAGCAAGAGGAAACGGACGCCCAGCGACAAATCGGCGCATACGGTCGAACAC
Pan_troglodytes|22120               CCCAGCTCCAGCAAGAGGAAACGGACGCCCAGCGACAAATCGGCGCATACGGTCGAACAC
Tarsius_syrichta|2690               CCCAGCCCCAGGAAGAGGAAAAGGACG---AGCGACACATCG---CGGCCAGACGAGCCC
Spermophilus_tridecemlineatus|12398 CCCAGCCCCAGCAAAAGAAAACGGACACCCAGCGACACGTCGGCGCGGCCTGAAGAGCCC
                                    ** **  * ** ...**.***.****    ** .**: .***                  

Mus_musculus|15208                  ------------------------------CAGCCCCCCGGACTGACCGAGGAGGCCCCC
Rattus_norvegicus|8663              ------------------------------CAGCCCCCGGGCCTGACCGAAGAAGCCACC
Cavia_porcellus|15401               AGTAGCCCCCGGCCCCGCGACACGACACTGAGGCCCCCGGGGCTGGCCGAGGAGGTCCTG
Dipodomys_ordii|3086                ------------------------------CGGCCCCCGGGGCTGGCCGAGGAGCTACCA
Gorilla_gorilla|7164                GGCAGCCCCCAGACCCGCGACCCAACGCCGCGGCCCCCCGGGCTGCCCGAGGAGGCGACA
Callithrix_jacchus|7736             GGCAGCCCCCGGACCCGCGACCCGACGCCGCGGCCCTCAGGGCTGGCCGAGGAGGCGACG
Homo_sapiens|57027                  GGCAGCCCCCGGACCCGCGACCCAACGCCGCGCCCCCCGGGGCTGCCCGAGGAGGCGACA
Pan_troglodytes|22120               GGCAGCCCCCGGACCCGCGACCCAACGCCGCGGCCCCCCGGGCTGCCCGAGGAGGCGACA
Tarsius_syrichta|2690               AGCAGCCCCCGGACCCGCTACCCAAGCTCTCGATCCCCGGGGCTGGCCGAGGAGGTGCCG
Spermophilus_tridecemlineatus|12398 GGCAGCCCACGGGCCCGCGACCCGACGCCAAGGCCCCCCGGGCTGGCCGAGGAGGCTTCA
                                                                  ..  ** * ** *** ****.**.      

Mus_musculus|15208                  GGCCCGGCTTCACCCACGCCAccccgcgcccgagcgcgcggc------cgcggccTGGGG
Rattus_norvegicus|8663              GGCCCGGCCTCACCCACGCCACCCCGCGCCCGAGCGCGCGGC------CGCGGCCCGGGT
Cavia_porcellus|15401               GCTCCCGTCGCGCCCTCACCGCCCCGGGCCCGAGCGCGAGGC------CGCGGTCCTGGC
Dipodomys_ordii|3086                GGTCTGGCCGCGCCCTCACCGCCCCGGGCTCGAGCTCGGGTCGCGACCCGGTCTCCCAGA
Gorilla_gorilla|7164                GCCCTCGCTGCGCCC---------------------------------------------
Callithrix_jacchus|7736             GCCCTCGCTGCGCCCTCGCCGCCCAGGGCCCGAGCGCGGGCCGCGCCCCGGCCTCTTGGA
Homo_sapiens|57027                  GCCCTCGCTGCGCCCTCGCCGCCCAGGGCCCGAGCGCGCGCCGCGCCCCGGCCTCTTGGA
Pan_troglodytes|22120               GCCCTCGCTGCGCCCTCGCCGCCCAGGGCCCGAGCGCGGGCCGCGCCCCGGCCTCTTGGA
Tarsius_syrichta|2690               GCGCTCGCTGCACCTTCGCCGACCCGGGTCCAAGCACGCGCCGAGCCCTGGCCTCTTGGA
Spermophilus_tridecemlineatus|12398 GCCCTAGTCACTCCTTCGCCGCCC---GCCCGAGCGCGGGCCGCGCCCCGGCCTCTTGGA
                                    *  *  *   * **                                              

Mus_musculus|15208                  CTCTCGGAGCCAACGGACGCGGGAGGTCCCCCGCGCAGCGCGCCCGAGGCCGCCTCTATG
Rattus_norvegicus|8663              CTCTTGGAGCCCACGGACGCGGGAGGTCCCCCGCGCAGTGCGCCCGAGGCCGCCTCTATG
Cavia_porcellus|15401               CTCTCGGAGCCCACGGACGCCTGTGGTCCTCCGCGCAGCGCGCCCGAGGCCGCCTCCATG
Dipodomys_ordii|3086                ATCAACGGACGCCAGTGGTCC---------TCTGCGCAGCGCGCCGAGGCCGCCTCCATG
Gorilla_gorilla|7164                CTCTTGGAGCCCACGGACGCCGGCGGTCCCCCGCGAAGCGCGCCCGAGGCTGCCTCCATG
Callithrix_jacchus|7736             GCCCACGGACGCCGGCGGTTC---------CCCGCGAAGTGCGCCGAGGCTGCCTCCATG
Homo_sapiens|57027                  GCCCACGGACGCCGGCGGTCC---------CCCGCGAAGCGCGCCGAGGCTGCCTCCATG
Pan_troglodytes|22120               GCCCACGGACGCCGGCGGTCC---------CCCGCGAAGCGCGCCGAGGCTGCCTCCATG
Tarsius_syrichta|2690               GCCTACGGGCGACGG---------------------CAGCGCGCTGATGCTGCCTCCATG
Spermophilus_tridecemlineatus|12398 GCCTACGGACACCGTTGGTCC---------CCCACGCAGCGCGCCGAGGCCGCATCTATG
                                      *   *..* ..                       ..     * ** ** **.** ***

Mus_musculus|15208                  CTGGCAGCTGAGCTGCGCGACAAGACTCGCAGCTTAGGCCGCGCCGAG------------
Rattus_norvegicus|8663              CTGGCAGCCGAGCTGCGCGACAAGACTCGCAGCCTGGGTCGCGCCGAG------------
Cavia_porcellus|15401               CTGGCGGCGGAGCTGCGCGACAAGACTCGCAGCCTGGGCCGCGCCGAGGCGGCCTCGGGC
Dipodomys_ordii|3086                TTGGCGGCAGAGCTGCGCGGCAAGACTCGAAGTCTGGGTCGCACGGAGGGAGCGCTCGTA
Gorilla_gorilla|7164                TTGGCCGCTGAGCTGCGCGGCAAGACTCGCAGCCTGGGCCGCGCCGAGGTGGCCCTGGGC
Callithrix_jacchus|7736             CTGGCAGCGGAGCTGCGCGGCAAGACTCGCAGCCTGGGCCGCGCCGAGGGGGCACTGGGC
Homo_sapiens|57027                  TTGGCCGCTGACGTGCGCGGCAAGACTCGCAGCCTGGGCCGCGCCGAGGTGGCCCTGGGC
Pan_troglodytes|22120               TTGGCCGCTGAGCTGCGCGGCAAGACTCGCAGCCTGGGCCGCGCCGAGGTGGCCCTGGGC
Tarsius_syrichta|2690               CTGGCCGCCGAGATGCACGGCAAGACACGCAGTCTGGGCCACGCCCAGGGGGATCCTGGC
Spermophilus_tridecemlineatus|12398 CTGGCGGCAGAGCTGCGTGGCACT------CGCCTGGGCCGCGTCGAGGCCCTA------
                                     **** ** **  ***. *.**.       .*  *.** *.*.   **            

Mus_musculus|15208                  ------------------AAGCCGCCGCCGCCGCAGAAGGCCAAGCGCTCCGTGCTCCCC
Rattus_norvegicus|8663              ------------------AAGCCGCCGCCGCCTCAGAAGGCCAAGCGCTCCGTGCTCCCG
Cavia_porcellus|15401               GCGCAAGGTCCGCGGGAGAAGCCGGCGCCACCGCAGAAGGCCAAGCGCTCGGTGCCGCCA
Dipodomys_ordii|3086                GCCCAGAGCCCCCGGGAGAAGCCGGCGCCGCCGCAGAAGGCCAAGCGGTCAGTGCCGCCC
Gorilla_gorilla|7164                GCGCAGGGCCCCAGGGAAAAGCCGGCGCCCCCACAGAAGGCCAAGCGCTCCGTGCCGCCA
Callithrix_jacchus|7736             GCGCAGGGTCCCCGGGAGAAGCCGGCGCCCCCGCAGAAAGCCAAGCGCTCGGTGCCGCAA
Homo_sapiens|57027                  GCGCAGGGCCCCAGGGAAAAGCCGGCGCCCCCACAGAAAGCCAAGCGCTCCGTGCCGCCA
Pan_troglodytes|22120               GCGCAGGGCCCCAGGGAAAAGCCGGCGCCCCCACAGAAAGCCAAGCGCTCCGTGCCGCCA
Tarsius_syrichta|2690               GCCCAAGGCCCCCGGGAGAAGCCGGCGCCGCTGCAGAAGACCAAGCGCTCGGTGCCGCCT
Spermophilus_tridecemlineatus|12398 ------------------------------------------------------------
                                                                                                

Mus_musculus|15208                  GCCGCGACGGTCCGCACAGCCTCGGCGTCCGAGGCCTCGGGGTCAGAGAAGGCGGCGGCC
Rattus_norvegicus|8663              GCGTCGACCGCCCGCGCGGCTTCGGCGTCCGAAGCCTCGGCGTCTGAGAAGGTGGCAGCC
Cavia_porcellus|15401               GCCTCGCCCGCCCGCGTGTCCCCGGCACCCGAGGTCACGGGGCTCGAGAAGGCAGCGACC
Dipodomys_ordii|3086                GCCTCGCCGGCCCGCGTGTCCCCTGCGACGGAGGTTGTAGAGCCAGACAAGGCGGGGTCT
Gorilla_gorilla|7164                GCCTCGCCCGCCCGCGCGCCCCCAGCGACCGAAACCCCGGGGCCTGAGAAGGCGGCGACC
Callithrix_jacchus|7736             GCCTCGCCCGCCAGCGCGCCCCCAGCGGCCGAAACCCCGGGGCCTGAGAAGGCGGCGACC
Homo_sapiens|57027                  GCCTCGCCCGCCCGCGCGCCCCCAGCGACCGAAACCCCGGGGCCTGAGAAGGCGGCGACC
Pan_troglodytes|22120               GCCTCGCCCGCCCGAGCGCCCCCAGCGACCGAAACTCCGGGGCCTGAGAAGGCGGCGACC
Tarsius_syrichta|2690               GCCTCACCAGCCCGTGCGTCTCCCGCAACCAAGACCTCGGGGCCCGAGAAGGCGGCGACC
Spermophilus_tridecemlineatus|12398 ------------------------------------------------------------
                                                                                                

Mus_musculus|15208                  AGCGCACCTGCGCCCGAGACCCCTCGGAAGAAAACCCCCATCCAGAAACCGCCTCGGAAG
Rattus_norvegicus|8663              AGCGCACCTGAGCCCGAGACACCTCGGAAGAAGACCCCCATCCAGAAACCGCCTCGAAAG
Cavia_porcellus|15401               AGCACGCCGGCGCCCGAGACCCCTCGAAAGAAGACCCCTATCCAGAAGCCGCCGCGAAAG
Dipodomys_ordii|3086                GGCACGCCGGCAAATGAAACCCCTCGGAAGAAGATTCCCATCCAGAAGCCGCCGCGCAAG
Gorilla_gorilla|7164                GACTTGCCCGCGCCTGAGACCCCCCGGAAGAAGACCCCCATCCAGAAGCCGCCGCGCAAG
Callithrix_jacchus|7736             GACGTGTCCGCGCCCGAGACCCCCCGGAAGAAGACCCCCATCCAAAAGCCGCCTCGCAAG
Homo_sapiens|57027                  GACTTGCCCGCGCCTGAGACCCCCCGGAAGAAGACCCCCATCCAGAAGCCGCCGCGCAAG
Pan_troglodytes|22120               GACTTGCCCGCGCCTGAGACCCCCCGGAAGAAGACCCCCATCCAGAAGCCGCCGCGCAAG
Tarsius_syrichta|2690               AGCGCGTCTGCGCCCGAGACCCTCCGGAAGAAGACCCCCATTCAGAAGCCGCTCAAGAAG
Spermophilus_tridecemlineatus|12398 ------------------------------------------------------------
                                                                                                

Mus_musculus|15208                  AAGAGCAGGGAGGCAGCGGGGGAGCCGAGTAGGGCGGGCACGGCCCCCGGAGCTTCCTAA
Rattus_norvegicus|8663              AAGAGCAGGGAGGCTGCGGGGGAGCCGAGCAGGGCGGGCGCGGCCCCCGGAGCTTCCTAG
Cavia_porcellus|15401               AAGAGCCGGGAAGCGGCGGGCGAGCCCCCGAGGGTAGGCGCGCCCACCCTG------TAG
Dipodomys_ordii|3086                AAGAGCAGGGAGGCGGCGGGAGAGCTGGTTAGGGTGGGCGCTCCCACTCTG------TAG
Gorilla_gorilla|7164                AAGAGCCGGGAGGCGGCGGGCGAGCTGGGCAGGGCGGGCGCGCCCACCCTG------TAG
Callithrix_jacchus|7736             AAGAGCAGGGAGGCGGCGGGCGAGCTGGGCAGGGCCGGCGCGCCCACCCTG------TAG
Homo_sapiens|57027                  AAGAGCCGGGAGGCGGCGGGCGAGCTGGGCAGGGCGGGCGCACCCACCCTG------TAG
Pan_troglodytes|22120               AAGAGCCGGGAGGCGGCGGGCGAGCTGGGCAGGGCGGGCGCGCCCACCCTG------TAG
Tarsius_syrichta|2690               AGC------GAATCGACGGGCAAACCGGGAAGGGCGGGCGCGCCCACTCTC------TAG
Spermophilus_tridecemlineatus|12398 ------------------GGC---------------------------------------
                                                      **                                        

multiple sequence alignment in CLUSTALW format


Mus_musculus|48491                  MEGAGSRGAGPARRQGARG-----------LGLLLLLWLLPGLAAPQDLNPRGRNVCRTP
Rattus_norvegicus|23182             MEGAGSRGAGPARRQGARGPP-----------LLLLLWLLPGLAAAQDLNPRGRNVCRTP
Cavia_porcellus|12079               PGSGSRCGISCPARRHSCRPPPRPRTPLPAALLLLLLWLLPGPAAPQELNPRGRNVCRAP
Dipodomys_ordii|2879                ---------------------------------------------------RGRNVCRAS
Gorilla_gorilla|6366                -----------------GGPPP---SSPPSLRALLLLWMLPDTVAPQELNPRGRNVCRAP
Callithrix_jacchus|68               ----------------------------------------------------------TH
Homo_sapiens|41161                  MEGAGPRGAGPARRRGAGGPPS---PLLPSLLLLLLLWMLPDTVAPQELNPRGRNVCRAP
Pan_troglodytes|1538                MEGAGPRGAGPARRRGAGGPPS---PLLPSLLLLLLLWMLPDTVAPQELNPRGRNVCRAP
Tarsius_syrichta|2462               ------------------------------------------------------------
Spermophilus_tridecemlineatus|11108 ------------------------------------------------------------
                                                                                                

Mus_musculus|48491                  GSQVLTCCAGWRQLGDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQF
Rattus_norvegicus|23182             GSQVLTCCAGWRQLGDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQF
Cavia_porcellus|12079               GSQAPTCCAGWKQQGDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQF
Dipodomys_ordii|2879                GPQVFTCCAGWRQQGDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQF
Gorilla_gorilla|6366                GSQVPTCCAGWRQQGDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQF
Callithrix_jacchus|68               SSQVPTCCAGWRQQGDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPHQF
Homo_sapiens|41161                  GSQVPTCCAGWRQQGDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQF
Pan_troglodytes|1538                GSQVPTCCAGWKQQGDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQF
Tarsius_syrichta|2462               --------------------AVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQF
Spermophilus_tridecemlineatus|11108 -SQVPTCCAGWRQQGDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQF
                                                        *************************************:**

Mus_musculus|48491                  WGPDCKERCSCHPHGQCEDVTGQCTCHARRWGARCEHACQCQHGTCHPRSGACRCEPGWW
Rattus_norvegicus|23182             WGPDCKERCSCHPHGQCEDVTGQCTCHARRWGARCEHACQCQHGTCHPRSGACRCEPGWW
Cavia_porcellus|12079               WGPDCKERCICHPHGQCEDVTGQCTCHAQRWGERCEHACQCQHGTCHPRSGACRCEPGWW
Dipodomys_ordii|2879                WGPDCKERCSCHPNGQCEDVTGQCTCHARRWGARCEHACQCQHGTCHPRTGACRCEPGWW
Gorilla_gorilla|6366                WGPDCKELCSCHPHGQCEDVTGQCTCHARRWGARCEHACQCQHGTCHPRSGA--------
Callithrix_jacchus|68               WGPDCKELCSCHPHGQCEDVTGQCTCHARRWGARCEHACQCQHGTCHPRSGACRCEPGWW
Homo_sapiens|41161                  WGPDCKELCSCHPHGQCEDVTGQCTCHARRWGARCEHACQCQHGTCHPRSGACRCEPGWW
Pan_troglodytes|1538                WGPDCKELCSCHPHGQCEDVTGQCTCHARRWGARCEHACQCQHGTCHPRSGACRCEPGWW
Tarsius_syrichta|2462               WGPDCKELCSCHPHGQCEDVTGQCTCHARRWGVRCEHACQCQHGACHPRSGTCRCEPGWW
Spermophilus_tridecemlineatus|11108 WGPDCKERCSCHPHGQCEDVTGQCTCHARRWGARCEHACQCQHGTCHPRSGACRCEPGWW
                                    ******* * ***:**************:*** ***********:****:*:        

Mus_musculus|48491                  GAQCASACYCSATSRCDPQTGACLCHVGWWGRSCNNQCACNSSPCEQQSGRCQCRERMFG
Rattus_norvegicus|23182             GAQCASACYCSATSRCDPQTGACLCHAGWWGRSCNNQCSCNSSPCEQQSGRCQCRERTFG
Cavia_porcellus|12079               GAQCARACYCSATSRCDPQTGACQCHAGWWGRSCNNQCACNSSPCEQQSGRCQCRERTFG
Dipodomys_ordii|2879                GPQCASACYCSATSRCDPQTGACLCHAGWWGRSCNNQCACNSSPCEQQSGRCQCRERTFG
Gorilla_gorilla|6366                --------------------------------SCNNRCACNSSPCEQQSGRCQCRERTFG
Callithrix_jacchus|68               GAQCASACYCSATSRCDPQTGACLCHAGWWGRSCNNQCACNSSPCEQQSGRCQCRERTFG
Homo_sapiens|41161                  GAQCASACYCSATSRCDPQTGACLCHAGWWGRSCNNQCACNSSPCEQQSGRCQCRERTFG
Pan_troglodytes|1538                GAQCASACYCSATSRCDPQTGACLCHAGWWGRSCNNQCACNSSPCEQQSGRCQCRERTFG
Tarsius_syrichta|2462               GAQCASACYCSATSRCDPQTGACLCHAGWWGRSCNNQCACNSSPCEQQSGRCQCRERTFG
Spermophilus_tridecemlineatus|11108 GSQCASACYCSATSRCDPQTGACLCHAGWWGRSCNNQCACNSSPCEQQSGRCQCRERTFG
                                                                    ****:*:****************** **

Mus_musculus|48491                  ARCDRYCQCSHGRCHPVDGTCACDPGYRGKYCREPCPAGFYGPGCRRRCGQCKGQQPCTV
Rattus_norvegicus|23182             ARCDRYCQCFRGRCHPVDGTCACDPGYRGKYCREPCPAGFYGLGCRRRCGQCKGQQPCTV
Cavia_porcellus|12079               ARCERYCQCFRGRCHPVDGTCACEPGYRGKYCREPCPAGFYGLGCRRRCGQCKGQQPCTV
Dipodomys_ordii|2879                ARCDRYCQCFRGRCNPVDGTCACEPGYRGKYCREPCPAGFYGLGCRRRCGQCKGQQPCTV
Gorilla_gorilla|6366                ARCDRYCQCFRGRCHPVDGTCACEPGYRGKYCREPCPAGFYGLGCRRRCGQCKGQQPCTV
Callithrix_jacchus|68               ARCDRYCQCFRGRCHPVDGTCACEPGYRGKYCREPCPAGFYGLGCRRRCGQCKGQQPCTV
Homo_sapiens|41161                  ARCDRYCQCFRGRCHPVDGTCACEPGYRGKYCREPCPAGFYGLGCRRRCGQCKGQQPCTV
Pan_troglodytes|1538                ARCDRYCQCFRGRCHPVDGTCACEPGYRGKYCREPCPAGFYGLGCRRRCGQCKGQQPCTV
Tarsius_syrichta|2462               ARCDRYCQCFRGRCHPVDGTCACEPGYRGKYCREPCPAGFYGLGCRRRXXXXXXXXXXXX
Spermophilus_tridecemlineatus|11108 ARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                                    **                                                          

Mus_musculus|48491                  VEGRCLTCEPGWNGTKCDQPCATGFYGEGCGHRCPPCRDGHACNHVTGKCTHCNAGWIGD
Rattus_norvegicus|23182             VEGRCLTCEPGWNGTKCDQPCATGFYGEGCGHRCPPCRDGHACNHVTGKCTHCNAGWIGD
Cavia_porcellus|12079               AEGRCLTCEPGWNGTKCDQPCAAGFYGEGCGHRCPPCRDGHACNHVTGKCTRCNAGWIGD
Dipodomys_ordii|2879                AEGRCLTCEPGWNGTKCDQPCATGFYGEGCEHRCPPCRDGHACNHVTGKCTRCNAGWIGD
Gorilla_gorilla|6366                AEGRCLTCEPGWNGTKCDQPCATGFYGEGCSHRCPPCRDGHACNHVTGKCTRCNAGWIGD
Callithrix_jacchus|68               AEGRCLTCEPGWNGTKCDQPCATGFYGEGCSHRCPPCRDGHACNHVTGKCTRCNAGWIGD
Homo_sapiens|41161                  AEGRCLTCEPGWNGTKCDQPCATGFYGEGCSHRCPPCRDGHACNHVTGKCTRCNAGWIGD
Pan_troglodytes|1538                AEGRCLTCEPGWNGTKCDQPCATGFYGEGCSHRCPPCRDGHACNHVTGKCTRCNAGWIGD
Tarsius_syrichta|2462               XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Spermophilus_tridecemlineatus|11108 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                                                                                                

Mus_musculus|48491                  RCETKCSNGTYGEDCAFVCSDCGSGHCDFQSGRCLCSPGVHGPHCNVTCPAGLHGVDCAQ
Rattus_norvegicus|23182             RCETKCSNGTYGEDCAFVCSDCGSGHCDFQSGRCLCSPGVHGPHCNVTCPAGLHGVDCAQ
Cavia_porcellus|12079               RCETKCSNGTYGEDCAFVCADCASGHCDFQSGRCLCSPGVHGPHCNMTCPMGHHGVDCAQ
Dipodomys_ordii|2879                RCETKCSNGTYGEDCAFVCADCGSGHCDFQSGRCLCSPGVHGPHCNVTCPPGLHGVDCAQ
Gorilla_gorilla|6366                RCETKCSNGTYGEDCAFVCADCGSGHCDFQSGRCLCSPGVHGPHCNVTCPPGLHGADCAQ
Callithrix_jacchus|68               RCETKCSNGTYGEDCAFVCADCGSGHCDFQSGRCLCSPGVHGPHCNVTCPLGLHGVDCAQ
Homo_sapiens|41161                  RCETKCSNGTYGEDCAFVCADCGSGHCDFQSGRCLCSPGVHGPHCNVTCPPGLHGADCAQ
Pan_troglodytes|1538                RCETKCSNGTYGEDCAFVCADCGSGHCDFQSGRCLCSPGVHGPHCNVTCPPGLHGADCAQ
Tarsius_syrichta|2462               XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCNVTCPPGLHGVDCAQ
Spermophilus_tridecemlineatus|11108 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                                                                                                

Mus_musculus|48491                  ACSCHEESCDPVTGACHLETNQRKGVMGAGALLTLLLGLLLSLLGCCCACRGKDSA----
Rattus_norvegicus|23182             ACSCHEESCDPVTGACHLETNQRKGVMGAGALLTLLLGLLLSLLGCCCACRGKDSA----
Cavia_porcellus|12079               TCSCHEDSCDPVTGACHLETNQRKGVMGAGALL----ALLLSLLGCCCACRGKDPI----
Dipodomys_ordii|2879                ACSCHEDSCDPVTGACRLETNQRKGVMGAGALLTLLLGLLLSLLGCCCACRGKDPVSRPC
Gorilla_gorilla|6366                ACSCHEDSCDPVTGACHLETNQRKGVMGAGALLVLLVCLLLSLLGCCCACRGKDPA----
Callithrix_jacchus|68               ACSCHEDSCDPVTGACHLETNQRKGVMGAGALLVLLVCLLLSLLGCCCACRGKDPARRPR
Homo_sapiens|41161                  ACSCHEDTCDPVTGACHLETNQRKGVMGAGALLVLLVCLLLSLLGCCCACRGKDPT----
Pan_troglodytes|1538                ACSCHEDSCDPVTGACHLETNQRKGVMGAGALLVLLVCLLLSLLGCCCACRGKDPARRPR
Tarsius_syrichta|2462               ACRCHEDSCDPVTGACRLETHLISGVMGGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Spermophilus_tridecemlineatus|11108 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                                                                                                

Mus_musculus|48491                  -RRELTLGRKKAPQRFCGSFSRISMKLPRIPLRRQKLPKVVVAHHDLDNTLNCSFLDPPS
Rattus_norvegicus|23182             -RRELTLGRKKAPQRFCGSFSRISMKLPRIPLRRQKLPKVVVAHHDLDNTLNCSFLEPPS
Cavia_porcellus|12079               -RRELSLGRKKAPHRLCGRFSRISMKLPRIPLRRQKLPKVVVAHHDLDNTLNCSFLEPPS
Dipodomys_ordii|2879                PRRELSLGRKKAPQRLCGRFSRISMKLPRIPLRRQKLPKVVVAHHDLDNTLNCSFLEPPS
Gorilla_gorilla|6366                -RRELSLGRKKAPHRLCGRFSRISMKLPRIPLRRQKLPKVVVAHHDLDNTLNCSFLEPPS
Callithrix_jacchus|68               PHRELSLGRKKAPHRLCGRFSRISMKLPRIPLRRQKLPKVVVAHHDLDNTLNCSFLEPPS
Homo_sapiens|41161                  -RRELSLGRKKAPHRLCGRFSRISMKLPRIPLRRQKLPKVVVAHHDLDNTLNCSFLEPPS
Pan_troglodytes|1538                PRRELSLGRKKAPHRLCGRFSRISMKLPRIPLRRQKLPKVVVAHHDLDNTLNCSFLEPPS
Tarsius_syrichta|2462               XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-
Spermophilus_tridecemlineatus|11108 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHHDLDNTLNCSFLEPPS
                                                                                                

Mus_musculus|48491                  GLEQPSPSWSSRASFSSFDTTDEGPVYCVPHEEATADSRDLEATAALTEVAAVSLEPTGT
Rattus_norvegicus|23182             GLEQPSPSWSSRASFSSFDTTDEGPVYCVPHEEATAENRDPEASASLTEVPAVSLAPMGT
Cavia_porcellus|12079               GLDQPSPSWSSRASFSSFDTTDEGPVYCVPHEEAAAETRDPEAPSAPAEAPVPSPALLTT
Dipodomys_ordii|2879                GLEQPSPSWSSRASFSSFDTTDEGPVYCVPHEEAATESREPEATTLPTDAPAPSPATLTT
Gorilla_gorilla|6366                GLEQPSPSWSSRASFSSFDTTDEGPVYCVPHEEAPAESRDPEVPTVPAEAPAPSPVPLTT
Callithrix_jacchus|68               GLEQPSPSWSSRASFSSFDTTDEGPVYCVPHEEAPAESRDPEVPTVPAEAPAPSPVPLTT
Homo_sapiens|41161                  GLEQPSPSWSSRASFSSFDTTDEGPVYCVPHEEAPAESRDPEVPTVPAEAPAPSPVPLTT
Pan_troglodytes|1538                GLEQPSPSWSSRASFSSFDTTDEGPVYCVPHE----------------------------
Tarsius_syrichta|2462               ---------------------------XXXXXXAATESRDPEVSPVPVEAPAPSPVSLTT
Spermophilus_tridecemlineatus|11108 GLEQPSPSWSSRASFSSFDTTDEGPVYCVPHEEVAADSRDSEAPIAPAEALAPSPAPLST
                                                                                                

Mus_musculus|48491                  STPGEE-AAVLPASSDSERSASSVEGPSGALYARVARREARPARTRNEAGGLSLSPSPER
Rattus_norvegicus|23182             SVPGDE-AAALPASSDSERSASSVEGPGGALYARVARREARPARTRCEAGGLSLSPSPER
Cavia_porcellus|12079               LASAEE-APPLSASSDSERSASSVEGPGGALYARV---------------GLSLSPSPER
Dipodomys_ordii|2879                RASAEEAAAPLPASSDSERSASSVEGPGGALYARVARREARPVRARGEAGGLSLSPSPER
Gorilla_gorilla|6366                PASAEE-AMPLPASSDSERSASSVEGPGGALYARVARR---------EIGGLSLSPSPER
Callithrix_jacchus|68               PASAEE-AMPLPASSDSERSASSVEGPGGALYARVARREARPARARGEVGGLSLSPSPER
Homo_sapiens|41161                  PASAEE-AIPLPASSDSERSASSVEGPGGALYARVARREARPARARGEIGGLSLSPSPER
Pan_troglodytes|1538                ------------------------------------------------------------
Tarsius_syrichta|2462               PVAAKE-ATP-RMTSDSERLASSLKGPIGALFPCIVWREARPDQAGGEAGGLSL--SLKR
Spermophilus_tridecemlineatus|11108 PASTEE-ATPLPASSDSERSASSVEGPGGALYARVARREARPARARAEAGGLSLSPSPER
                                                                                                

Mus_musculus|48491                  RKPPPPDPATKPKVSWIHGKHSAAAA--APSPPPAGRKAAPSPSGRKRTPSNSSV-----
Rattus_norvegicus|23182             RKPPPPDPATKPKVSWIHGKQGAVAA--APSPPPAGRKAAPSPSGRKRTPSNMSV-----
Cavia_porcellus|12079               RKPPPPDPATKPKVSWIHGKHGAAAATQAPSPSPPGPEPAPSPSKRKRTPSDTSARPEEP
Dipodomys_ordii|2879                RKPPPPDPATKPKVSWIHGKHGAAAAARAPSPPPPGPEAAPSPSKRKRTPSDTSA-----
Gorilla_gorilla|6366                RKPPPPDPATKPKVSWIHGKHSAAAAGRAPSPPPPGSEAAPSPSKRKRTPSDKSAQPVEH
Callithrix_jacchus|68               RKPPPPDPATKPKVSWIHSKHSAAAAGCAPSPPPPGPEAAPSPSKRKRTPSDKSAQPVEH
Homo_sapiens|41161                  RKPPPPDPATKPKVSWIHGKHSAAAAGRAPSPPPPGSEAAPSPSKRKRTPSDKSAHTVEH
Pan_troglodytes|1538                -------PAT-PKVSWIHG-HSAAAAGRAPSPPPPGSEAAPSSSKRKRTPSDKSAHTVEH
Tarsius_syrichta|2462               RKPPPPDPATKPKVSWIHGKHGAAAATRAPSPPASGLETAPSPRKRKRT-SDTS-RPDEP
Spermophilus_tridecemlineatus|11108 RKPPPPDPATKPKVSWIHRKHGAAAAARAPSPPPQGPETAPSPSKRKRTPSDTSARPEEP
                                           *** *******  :.*.**  ****.. * :.***.  **** *: *      

Mus_musculus|48491                  ----------QPPGLTEEAPGPASPTPPRARARG--RGLGLSEPTDAGGPPRSAPEAASM
Rattus_norvegicus|23182             ----------QPPGLTEEATGPASPTPPRARARG--RGPGLLEPTDAGGPPRSAPEAASM
Cavia_porcellus|12079               SSPRPRDTTLRPPGLAEEVLAPVAPSPPRARARG--RGPGLSEPTDACGPPRSAPEAASM
Dipodomys_ordii|2879                ----------RPPGLAEELPGLAAPSPPRARARVATRSPRINGRQWS---SAQRAEAASM
Gorilla_gorilla|6366                GSPQTRDPTPRPPGLPEEATALAAP---------------LLEPTDAGGPPRSAPEAASM
Callithrix_jacchus|68               GSPRTRDPTPRPSGLAEEATALAAPSPPRARARAAPRPLGAHGRRRF---PAKCAEAASM
Homo_sapiens|41161                  GSPRTRDPTPRPPGLPEEATALAAPSPPRARARAAPRPLGAHGRRRS---PAKRAEAASM
Pan_troglodytes|1538                GSPRTRDPTPRPPGLPEEATALAAPSPPRARARAAPRPLGAHGRRRS---PAKRAEAASM
Tarsius_syrichta|2462               SSPRTRYPSSRSPGLAEEVPALAAPSPTRVQARAEPWPLGAYGRR-------QRADAASM
Spermophilus_tridecemlineatus|11108 GSPRARDPTPRPPGLAEEASALVTPSPP-ARARAAPRPLGAYGHRWS---PTQRAEAASM
                                              :..**.**  . .:*                           . .:****

Mus_musculus|48491                  LAAELRDKTRSLGRAE----------KPPPPQKAKRSVLPAATVRTASASEASGSEKAAA
Rattus_norvegicus|23182             LAAELRDKTRSLGRAE----------KPPPPQKAKRSVLPASTARAASASEASASEKVAA
Cavia_porcellus|12079               LAAELRDKTRSLGRAEAASGAQGPREKPAPPQKAKRSVPPASPARVSPAPEVTGLEKAAT
Dipodomys_ordii|2879                LAAELRGKTRSLGRTEGALVAQSPREKPAPPQKAKRSVPPASPARVSPATEVVEPDKAGS
Gorilla_gorilla|6366                LAAELRGKTRSLGRAEVALGAQGPREKPAPPQKAKRSVPPASPARAPPATETPGPEKAAT
Callithrix_jacchus|68               LAAELRGKTRSLGRAEGALGAQGPREKPAPPQKAKRSVPQASPASAPPAAETPGPEKAAT
Homo_sapiens|41161                  LAADVRGKTRSLGRAEVALGAQGPREKPAPPQKAKRSVPPASPARAPPATETPGPEKAAT
Pan_troglodytes|1538                LAAELRGKTRSLGRAEVALGAQGPREKPAPPQKAKRSVPPASPARAPPATETPGPEKAAT
Tarsius_syrichta|2462               LAAEMHGKTRSLGHAQGDPGAQGPREKPAPLQKTKRSVPPASPARASPATKTSGPEKAAT
Spermophilus_tridecemlineatus|11108 LAAELRGT--RLGRVEAL------------------------------------------
                                    ***:::..   **:.:                                            

Mus_musculus|48491                  SAPAPETPRKKTPIQKPPRKKSREAAGEPSRAGTAPGAS
Rattus_norvegicus|23182             SAPEPETPRKKTPIQKPPRKKSREAAGEPSRAGAAPGAS
Cavia_porcellus|12079               STPAPETPRKKTPIQKPPRKKSREAAGEPPRVGAPTL--
Dipodomys_ordii|2879                GTPANETPRKKIPIQKPPRKKSREAAGELVRVGAPTL--
Gorilla_gorilla|6366                DLPAPETPRKKTPIQKPPRKKSREAAGELGRAGAPTL--
Callithrix_jacchus|68               DVSAPETPRKKTPIQKPPRKKSREAAGELGRAGAPTL--
Homo_sapiens|41161                  DLPAPETPRKKTPIQKPPRKKSREAAGELGRAGAPTL--
Pan_troglodytes|1538                DLPAPETPRKKTPIQKPPRKKSREAAGELGRAGAPTL--
Tarsius_syrichta|2462               SASAPETLRKKTPIQKPLKKS--ESTGKPGRAGAPTL--
Spermophilus_tridecemlineatus|11108 --------------------------G------------
                                                              *