Orthologs Set ID: EOG4003HF


Orthology Database
OrthoDB4
Gene Symbol(s)
ELMOD1

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 26677 95, 241, 270, 368, 498, 632, 725, 776, 910
Cavia porcellus 4935 241, 270, 368, 498, 632, 701, 725, 776, 910
Dipodomys ordii 15274 241, 270, 368, 498, 632, 701, 725, 776, 910
Gorilla gorilla 16216 95, 241, 270, 368, 498, 632, 701, 725, 776, 910
Homo sapiens 19398 95, 241, 270, 368, 498, 632, 725, 776, 910
Microcebus murinus 1120 241, 270, 363, 365, 498, 632, 701, 725, 776, 910
Mus musculus 44022 57, 241, 270, 368, 498, 632, 725, 776, 910
Ochotona princeps 2813 241, 270, 368, 498, 632, 701, 725, 776, 910
Otolemur garnettii 5141 241, 270, 368, 498, 632, 701, 725, 776
Pan troglodytes 7725 93, 241, 270, 368, 498, 632, 701, 725, 776, 910
Rattus norvegicus 33925 241, 270, 368, 498, 632, 725, 776, 910
Spermophilus tridecemlineatus 1234 241, 270, 368, 498, 632, 701, 725, 776, 910, 1005, 1044
Tarsius syrichta 2759 241, 270, 368, 498, 632, 701, 725, 776, 910
Tupaia belangeri 13218 270, 368, 498, 632, 701, 725, 776, 840, 910

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 26677 ENSCJAT00000019414 100399592 ENSCJAG00000009974 ELMOD1 calJac3
Cavia porcellus 4935 ENSCPOT00000007771 100716591 ENSCPOG00000007697 ELMOD1 cavPor3
Dipodomys ordii 15274 ENSDORT00000008597 ENSDORG00000008597 Elmod1 dipOrd1
Gorilla gorilla 16216 ENSGGOT00000005524 101148126 ENSGGOG00000005498 ELMOD1 gorGor3
Homo sapiens 19398 ENST00000443271 643923 ENSG00000110675 ELMOD1 hg19,GRCh37
Microcebus murinus 1120 ENSMICT00000001049 ENSMICG00000001050 ELMOD1 micMur1
Mus musculus 44022 ENSMUST00000048409 270162 ENSMUSG00000041986 Elmod1 mm9
Ochotona princeps 2813 ENSOPRT00000009635 101531430 ENSOPRG00000009640 ELMOD1 OchPri2.0
Otolemur garnettii 5141 ENSOGAT00000004966 100947630 ENSOGAG00000004962 ELMOD1 otoGar1
Pan troglodytes 7725 ENSPTRT00000007912 451525 ENSPTRG00000004241 ELMOD1 panTro2
Rattus norvegicus 33925 ENSRNOT00000012041 315670 ENSRNOG00000009054 Elmod1 rn4
Spermophilus tridecemlineatus 1234 ENSSTOT00000001234 101975887 ENSSTOG00000001237 Elmod1 speTri1
Tarsius syrichta 2759 ENSTSYT00000008093 103255251 ENSTSYG00000008092 ELMOD1 tarSyr1
Tupaia belangeri 13218 ENSTBET00000013219 ENSTBEG00000013213 ELMOD1 tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 18786 ENSCJAP00000018376 100399592 ENSCJAG00000009974 ELMOD1 calJac3
Cavia porcellus 3848 ENSCPOP00000006937 100716591 ENSCPOG00000007697 ELMOD1 cavPor3
Dipodomys ordii 14356 ENSDORP00000008069 ENSDORG00000008597 Elmod1 dipOrd1
Gorilla gorilla 13049 ENSGGOP00000005383 101148126 ENSGGOG00000005498 ELMOD1 gorGor3
Homo sapiens 29404 ENSP00000412257 643923 ENSG00000110675 ELMOD1 hg19,GRCh37
Microcebus murinus 954 ENSMICP00000000954 ENSMICG00000001050 ELMOD1 micMur1
Mus musculus 21874 ENSMUSP00000046191 270162 ENSMUSG00000041986 Elmod1 mm9
Ochotona princeps 2453 ENSOPRP00000008809 101531430 ENSOPRG00000009640 ELMOD1 OchPri2.0
Otolemur garnettii 4430 ENSOGAP00000004432 100947630 ENSOGAG00000004962 ELMOD1 otoGar1
Pan troglodytes 22613 ENSPTRP00000047667 451525 ENSPTRG00000004241 ELMOD1 panTro2
Rattus norvegicus 21791 ENSRNOP00000012041 315670 ENSRNOG00000009054 Elmod1 rn4
Spermophilus tridecemlineatus 1109 ENSSTOP00000001106 101975887 ENSSTOG00000001237 Elmod1 speTri1
Tarsius syrichta 2527 ENSTSYP00000007425 103255251 ENSTSYG00000008092 ELMOD1 tarSyr1
Tupaia belangeri 11447 ENSTBEP00000011448 ENSTBEG00000013213 ELMOD1 tupBel1

multiple sequence alignment in CLUSTALW format


Dipodomys_ordii|15274              ------------------------------------------------------------
Spermophilus_tridecemlineatus|1234 ------------------------------------------------------------
Microcebus_murinus|1120            ------------------------------------------------------------
Tupaia_belangeri|13218             ------------------------------------------------------------
Otolemur_garnettii|5141            ------------------------------------------------------------
Mus_musculus|44022                 GACAGTTGGCGTAGCATCCGGAGAGTCAAACGCCTGCAAAATGAAGCACTTCCTGAGCTT
Rattus_norvegicus|33925            ------------------------------------------------------------
Cavia_porcellus|4935               ------------------------------------------------------------
Callithrix_jacchus|26677           ------------------------------------------------------------
Tarsius_syrichta|2759              ------------------------------------------------------------
Ochotona_princeps|2813             ------------------------------------------------------------
Pan_troglodytes|7725               ------------------------------------------------------------
Gorilla_gorilla|16216              ------------------------------------------------------------
Homo_sapiens|19398                 ------------------------------------------------------------
                                                                                               

Dipodomys_ordii|15274              ---------------------------------AGAATGTTCATCCAGGTGTGCCTGTAT
Spermophilus_tridecemlineatus|1234 ------------------------------------------------------------
Microcebus_murinus|1120            ------------------------------------------------------------
Tupaia_belangeri|13218             ------------------------------------------------------------
Otolemur_garnettii|5141            ------------------------------------------------------------
Mus_musculus|44022                 TCTATCGGAAGGGTGCTGTCTTTTGTTCCCCACAGGATGTTGATCCAGGTGTGCCTGTAT
Rattus_norvegicus|33925            ------------------------------------ATGTTGATCCAGGTGTGCCTCTAT
Cavia_porcellus|4935               ---------------------------TTTCACAGAATGTTGATCCAGGTATGCCTGTAT
Callithrix_jacchus|26677           ------------------ATGAAGCACTTCCTGAGAATGTTGATCCAGGTCTGCCTGTAT
Tarsius_syrichta|2759              ---------------------------------AGAATGTTGATCCAGGTATGCCTGTAT
Ochotona_princeps|2813             ---------------------------------AGAATGTTGATCCAGGTGTGCCTGTAT
Pan_troglodytes|7725               ------------------cttgagcacttcttgAGAATGTTGATCCAGGTATGCCTGTAT
Gorilla_gorilla|16216              ------------------ATGAAGCACTTCCTGAGAATGTTGATCCAGGTATGCCTGTAT
Homo_sapiens|19398                 ------------------ATGAAGCACTTCCTGAGAATGTTGATCCAGGTATGCCTGTAT
                                                                                               

Dipodomys_ordii|15274              TTTTACTGTAAATTTTTGTGGCGCTGCCTGAAATTTGTAATGAGAAAGCTAACCGGAAGA
Spermophilus_tridecemlineatus|1234 ------------------------------------------------------------
Microcebus_murinus|1120            ------------------------------------------------------------
Tupaia_belangeri|13218             ------------------------------------------------------------
Otolemur_garnettii|5141            ------------------------------------------------------------
Mus_musculus|44022                 TTTTATTGTAAATTTTTGTGGCGCTGCATGAAGTTTGTGATGCGGAAACTCACCGGAAGG
Rattus_norvegicus|33925            TTCTACTGTAAATTTTTGTGGCGCTGCATGAAGTTTGTGATGCGTAAGCTCACGGGAAGG
Cavia_porcellus|4935               TTTTACTGTAAATTTTTGTGGCGTTGTCTGAAATTTGTAATGAGGAAGCTAACTGGAAGA
Callithrix_jacchus|26677           TTTTACTGTAACTTTCTGTGGCGCTGCTTGAAATTTGTGATGAGGAAGCTAACTGGGAGA
Tarsius_syrichta|2759              TTTTACTGTAAGTTTCTGTGGCGCTGCCTGAAATTTGTCATGAGGAAGCTAACCGGAAGA
Ochotona_princeps|2813             TTTTACTGTAAGTTTTTGTGGCGCTGCCTGAAATTTGTAATGAGAAAGCTGACTGGAAGG
Pan_troglodytes|7725               TTTTACTGTAAATTTCTGTGGCGCTGCCTGAAATTTGTAATGAGGAAGCTAACTGGAAGA
Gorilla_gorilla|16216              TTTTACTGTAAATTTCTGTGGCGCTGCCTGAAATTTGTAATGAGGAAGCTAACTGGAAGA
Homo_sapiens|19398                 TTTTACTGTAAATTTCTGTGGCGCTGCCTGAAATTTGTAATGAGGAAGCTAACTGGAAGA
                                                                                               

Dipodomys_ordii|15274              TGTGAACTGCAACGCATCTGCTACAACACCAAGCCAGGAGCATCTAGAACCATGAAAATT
Spermophilus_tridecemlineatus|1234 ---------------------------------------------------ATGAAGATT
Microcebus_murinus|1120            ---------------------------------------------------ATGAAAATC
Tupaia_belangeri|13218             ------------------------------------------------------------
Otolemur_garnettii|5141            ---------------------------------------------------ATGAAAATC
Mus_musculus|44022                 TGTGAACTGCAAAGGATTTGCTACGGCACCAAACCTGGAGCTTCCAGAACCATGAAAATT
Rattus_norvegicus|33925            TGTGAGCTGCAAAGGATTTGCTACGGCACCAAACCCGGAGCTTCCAGAACCATGAAAATT
Cavia_porcellus|4935               TGTGAACTGCAACGAATTTGTTACAGTACTAAACCTGGAGCTTCAAGAACCATGAAAATT
Callithrix_jacchus|26677           TGTGAACTACAGCGGATCTGTTACAATACCAAGCCCGGAGCTCCTAGAACCATGAAAATC
Tarsius_syrichta|2759              TGTGAACTGCAACGCATCTGTTACAACACCAAGCCTGGAGCTTCTAGGACCATGAAAATC
Ochotona_princeps|2813             TGCGAACTACAACGTATCTGTTACAACACCAAACCTGGTGCTTCCAGAACCATGAAAATC
Pan_troglodytes|7725               TGTGAACTACAACGGATCTGTTACAATACCAAGCCGGGAGCTTCTAGAACCATGAAAATC
Gorilla_gorilla|16216              TGTGAACTACAACGGATCTGTTACAATACCAAGCTGGGAGCTTCTAGAACCATGAAAATC
Homo_sapiens|19398                 TGTGAACTACAACGGATCTGTTATAATACCAAGCCGGGAGCTTCTAGAACCATGAAAATC
                                                                                               

Dipodomys_ordii|15274              GAAACATCATTGAGGGATTCAAAGAGTAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|1234 GAAACATCACTGAGGGATTCTAAAAGTAAGCTGTTGCAGACTTCAGTGAGTGTTCACCCT
Microcebus_murinus|1120            GAAACGTCACTAAAGGATTCCAAAAGTAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|13218             ---------------------AAAAGTAAGCTGTTGCAGACTTCAGTGAGTGTTCACCCT
Otolemur_garnettii|5141            GAAACATCATTAAGGGATTCCAAAAGTAAGCTGCTGCAGACTTCCGTGAGCGTTCACCTT
Mus_musculus|44022                 GAAACGTCACTGAGAGATTCAAAAAGCAAGCTGTTGCAGACATCCGTGAGTGTTCATCCT
Rattus_norvegicus|33925            GAAACGTCACTGAGAGATTCAAAAAGCAAGCTGTTGCAGACATCAGTGAGTGTTCATCCT
Cavia_porcellus|4935               GAAACTTCACTGAGGGATTCCAAAAGTAAGCTGTTGCAGACTTCCGTGAGTGTTCACCCT
Callithrix_jacchus|26677           GAAACATCACTGAGGGATTCTAAAAGTAAGCTGTTGCAGACTTCTGTGAGTGTTCACCCT
Tarsius_syrichta|2759              GAAACATCACTGAGGGAGTCAAAAAGCAAGCTGTTGCAGACTTCAGTGAGTGTTCACCCT
Ochotona_princeps|2813             GAAACATCCCTGAGGGAGTCAAAAAGTAAGCTGTTGCAGACATCAGTGAGTGTTCATCCT
Pan_troglodytes|7725               GAAACATCACTGAGGGATTCTAAAAGTAAGCTGTTGCAGACTTCTGTGAGTGTTCACCCT
Gorilla_gorilla|16216              GAAACATCACTGAGGGATTCTAAAAGTAAGCTGTTGCAGACTTCTGTGAGTGTTCACCCT
Homo_sapiens|19398                 GAAACATCACTGAGGGATTCTAAAAGTAAGCTGTTGCAGACTTCTGTGAGTGTTCACCCC
                                                        **.** *** .. ..  .   .  ... . ...      

Dipodomys_ordii|15274              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|1234 GATGCCATTGAAAAAACTATAGACGACATCATGGAACTGAAAAAAATTAATCCCGACATA
Microcebus_murinus|1120            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATGGAACTGAAAAAAATTAGCCCGGACATA
Tupaia_belangeri|13218             GATGCTATTGAAAAAACTATAGAAGACATCATGGAACTGAAAAAAATTAACCCCGACATA
Otolemur_garnettii|5141            GATGCCATTGAGAAAACTATAGACGACATCATGGAACTGAAGAAAATTAATCCCGACGTA
Mus_musculus|44022                 GATGCTATTGAAAAGACTATTGATGACATCATGGAATTGAAAAAAATTAACCCTGACATC
Rattus_norvegicus|33925            GATGCTATCGAAAAGACTATTGATGACATCATGGAATTGAAAAAAATTAACCCTGACATC
Cavia_porcellus|4935               GATGCAATTGAAAAAACTATAGAAGACATCATGGAACTGAAAAAAATTAACCCCGACATA
Callithrix_jacchus|26677           GACGCTATTGAAAAAACTATAGAAGATATCATGGAACTGAAAAAAATTAATCCTGACATA
Tarsius_syrichta|2759              GATGCGATTGAAAAAACTATAGAAGACATCATGGAACTGAAAAAAATTAACCCCGACATA
Ochotona_princeps|2813             GATGCTATCGAAAAAACTATAGAAGACATCATGGAACTGAAAAAAATTAACCCTGATATA
Pan_troglodytes|7725               GATGCTATTGAAAAAACTATAGAAGATATCATGGAACTGAAAAAAATTAATCCTGACATA
Gorilla_gorilla|16216              GACGCTATTGAAAAAACTATAGAAGATATCATGGAACTGAAAAAAATTAATCCTGACGTA
Homo_sapiens|19398                 GACGCTATTGAAAAAACTATAGAAGATATCATGGAACTGAAAAAAATTAATCCTGACGTA
                                   .  .   . .       . . .  .   .  ...   ..       ..      .   . 

Dipodomys_ordii|15274              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|1234 AATCCACAGTTGGGAATCTCTCTTCAGGCTTGCCTTCTTCAAATCGTTGGTTACAGAAAC
Microcebus_murinus|1120            AATCANNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|13218             AATCCACAGCTGGGAATCTCTCTTCAGGCTTGCCTTCTGCAAATCGTTGGGTACAGAAAC
Otolemur_garnettii|5141            AATCCACAGCTGGGAATCTCTCTCCAGGCTTGCCTTCTGCAAATTGTTGGGTACAGAAAC
Mus_musculus|44022                 AATCCACAGTTGGGGATCTCTCTCCAGGCTTGCCTCCTGCAAATCGTGGGTTACAGAAAC
Rattus_norvegicus|33925            AATCCACAGTTGGGAATCTCTCTCCAGGCTTGCCTTCTGCAAATTGTGGGTTACAGAAAC
Cavia_porcellus|4935               AATCCACAGCTGGGAATCTCTCTTCAGGCTTGCCTTCTGCAAATTGTGGGCTACAGAAAT
Callithrix_jacchus|26677           AATCCACAGCTGGGAATCTCTCTTCAGGCTTGCCTTCTGCAGATCGTGGGGTACAGAAAC
Tarsius_syrichta|2759              AATCCACAGCTGGGAATCTCTCTTCAGGCTTGCCTTCTGCAGATCGTGGGGTACAGAAAC
Ochotona_princeps|2813             AATCCACAGCTCGGAATCTCACTTCAGGCTTGCCTCCTACAAATCGTTGGGTACAGAAAC
Pan_troglodytes|7725               AATCCACAGCTGGGAATCTCTCTTCAGGCTTGCCTTCTGCAAATCGTTGGGTACAGGAAC
Gorilla_gorilla|16216              AATCCACAGCTGGGAATCTCTCTTCAGGCTTGCCTTCTGCAAATCGTTGGGTACAGGAAC
Homo_sapiens|19398                 AATCCACAGCTGGGAATCTCTCTTCAGGCTTGCCTTCTGCAAATCGTTGGGTACAGGAAC
                                     .     . . ..  . .   .   .   ..  .  .     . .. .. .   .    

Dipodomys_ordii|15274              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|1234 CTTATCGCAGATGTGGAAAAACTTCGCAGGGAACCTTATGATTCTGATAATCCCCAACAT
Microcebus_murinus|1120            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|13218             CTAATTGCAGATGTGGAAAAACTGCGCAGAGAGCCTTATGATTCTGATAATCCCCAACAT
Otolemur_garnettii|5141            CTTATTGCAGATGTGGAAAAACTGCGCAGAGAGCCCTATGACTCTGATAATCCCCAACAT
Mus_musculus|44022                 CTCATTGCAGATGTGGAAAAACTGCGCAGAGAACCCTATGATTCCGACAACCCCCAGCAT
Rattus_norvegicus|33925            CTCATTGCAGATGTGGAAAAACTGCGCAGAGAACCCTACGATTCCGACAACCCCCAGCAT
Cavia_porcellus|4935               CTTATTGCAGATGTGGAAAAGCTGCGCAAAGAGCCCTATGATTCTGATAATCCCCAGCAT
Callithrix_jacchus|26677           CTTATTGCAGATGTGGAAAAACTGCGTAGAGAGCCGTATGATTCTGATAATCCCCAACAT
Tarsius_syrichta|2759              CTTATCGCAGATGTGGAAAAACTACGCAGAGAGCCCTATGACTCTGACAACCCCCAACAT
Ochotona_princeps|2813             CTTATCGCAGATGTGGAAAAACTGCGCAGAGAGCCCTACGATTCGGAGAATCCCCAACAT
Pan_troglodytes|7725               CTTATTGCAGATGTGGAAAAACTGCGTAGAGAGGCGTATGATTCTGATAATCCCCAACAT
Gorilla_gorilla|16216              CTTATTGCAGATGTGGAAAAACTGCGTAGAGAGCCCTATGATTCTGATAATCCCCAACAT
Homo_sapiens|19398                 CTTATTGCAGATGTGGAAAAACTGCGTAGAGAGGCCTATGATTCTGATAATCCCCAACAT
                                    .  . .  . .....      .  .    .     .  .  .  .             .

Dipodomys_ordii|15274              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|1234 GAAGAAATGCTTTTGAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|1120            NNNNNNNNNNNNNNNNNNTTATGGAAATTCTTGAAGCCAGATACTCCACTGGAATCTCGG
Tupaia_belangeri|13218             GAAGAAATGCTTCTGAAGTTATGGAAGTTCCTGAAGCCCAATACGCCACTGGAATCTCGG
Otolemur_garnettii|5141            GAAGAGATGCTTTTGAAGTTATGGAAATTCTTGAAACCCAATACACCCCTGGAATCTCGG
Mus_musculus|44022                 GAAGAGATGCTTCTGAAGCTATGGGAGCTCCTGAAGCCCAACACTCCACTGGAGTCTCGG
Rattus_norvegicus|33925            GAAGAGATGCTTCTGAAGCTATGGGAGTTCCTGAAGCCCAACACTCCACTGGAGTCTCGG
Cavia_porcellus|4935               GAAGAAATGCTTTTGAAGTTATGGCAATTCTTGAAGCCAAATACTCCACTGGAATCCCGG
Callithrix_jacchus|26677           GAAGAAATGCTTTTGAAGTTATGGAAATTCTTGAAGCCCAATACTCCACTGGAATCTCGG
Tarsius_syrichta|2759              GAAGAAATGCTTTTGAAGTTATGGAAATTCTTGAAGCCCAATACTCCACTGGAATCTAGG
Ochotona_princeps|2813             GAAGAAATGCTTTTGAAGTTATGGAAATTCTTGAAGCCCAATACTCCGCTGGAATCACGC
Pan_troglodytes|7725               GAAGAAATGCTTTTGAAGTTATGGAAATTCTTGAAGCCCAATACTCCACTGGAATCTCGG
Gorilla_gorilla|16216              GAAGAAATGCTTTTGAAGTTATGGAAATTCTTGAAGCCCAATACTCCACTGGAATCTCGG
Homo_sapiens|19398                 GAAGAAATGCTTTTGAAGTTATGGAAATTCTTGAAGCCCAATACTCCACTGGAATCTCGG
                                   .  .   .. .. ..  . . ...    .  ..                ...  .   . 

Dipodomys_ordii|15274              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|1234 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|1120            ATTTCTAAGCAGTGGTGTGAAATTGGTTTCCAAGGTGATGATCCTAAAACAGACTTTCGA
Tupaia_belangeri|13218             ATTTCTAAGCAGTGGTGTGAAATTGGTTTCCAAGGTGATGATCCTAAAACAGATTTTCGA
Otolemur_garnettii|5141            ATTTCCAAGCAGTGGTGTGAAATTGGTTTCCAAGGTGACGATCCGAAAACAGACTTTCGA
Mus_musculus|44022                 GTTTCGAAGCAGTGGTGTGAGATCGGCTTCCAAGGCGATGATCCGAAAACAGATTTCCGA
Rattus_norvegicus|33925            ATTTCTAAGCAGTGGTGTGAGATTGGCTTCCAAGGTGATGATCCGAAAACAGATTTTCGA
Cavia_porcellus|4935               ATTTCTAAGCAGTGGTGTGAAATTGGTTTCCAAGGTGATGATCCTAAAACAGATTTTCGA
Callithrix_jacchus|26677           ATTTCTAAGCAGTGGTGTGAAATTGGTTTCCAAGGCGATGACCCTAAGACAGATTTCCGA
Tarsius_syrichta|2759              ATTTCTAAGCAATGGTGTGAAATTGGTTTCCAAGGTGATGATCCTAAAACAGATTTTCGA
Ochotona_princeps|2813             ATTTCTAAGCAGTGGTGTGAAATTGGTTTCCAAGGTGATGATCCTAAAACAGATTTTCGA
Pan_troglodytes|7725               ATTTCTAAGCAGTGGTGTGAAATTGGTTTCCAAGGTGATGATCCTAAAACAGACTTTCGA
Gorilla_gorilla|16216              ATTTCTAAGCAGTGGTGTGAAATTGGTTTCCAAGGTGATGATCCTAAAACAGATTTTCGA
Homo_sapiens|19398                 ATTTCTAAGCAGTGGTGTGAAATTGGTTTCCAAGGTGATGATCCTAAAACAGACTTTCGA
                                    ...    .   .......   . .. ..    .. .  .           .  ..  . 

Dipodomys_ordii|15274              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|1234 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|1120            GGAATGGGACTTCTGGGACTGTACAACTTGCAGTATTTTGCGGAAAGGGATGCTACAGCA
Tupaia_belangeri|13218             GGAATGGGACTTCTGGGACTATACAATTTGCAGTACTTTGCAGAAAGGGATGCTACAGCA
Otolemur_garnettii|5141            GGAATGGGACTTCTGGGACTGTACAATTTGCANNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|44022                 GGAATGGGTCTTCTGGGACTTTACAATTTGCAATATTTTGCAGAACGGGATGCCACCGTG
Rattus_norvegicus|33925            GGAATGGGTCTTCTGGGACTTTACAATTTGCAATATTTCGCAGAACGGGATGCCACGGTA
Cavia_porcellus|4935               GGAATGGGACTTCTGGGACTGTGCAATTTGCAATATTTTGCAGAAAAGGATGCTACAGCA
Callithrix_jacchus|26677           GGAATGGGACTTCTGGGACTGTACAACTTGCAGTACTTCGCAGAAAGGGATGCCACAGCA
Tarsius_syrichta|2759              GGAATGGGACTTCTGGGACTGTACAATTTACAGTATTTTGCAGAAAGAGATGCTACAGCA
Ochotona_princeps|2813             GGAATGGGACTTCTGGGCTTGTATAATTTACAGTACTTTGCAGAACGGGATGCAACAGCA
Pan_troglodytes|7725               GGAATGGGACTTCTGGGACTGTACAATTTGCAGTATTTCGCGGAAAGGGATGCCACAGCA
Gorilla_gorilla|16216              GGAATGGGACTTCTGGGACTGTACAATTTGCAGTATTTCGCGGAAAGGGATGCCACAGCA
Homo_sapiens|19398                 GGAATGGGACTTCTGGGACTGTACAATTTGCAGTATTTCGCGGAAAGGGATGCCACAGCA
                                   ..  ....  .. ....  . .     ..    .  .. .  .     . ..     .  

Dipodomys_ordii|15274              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|1234 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGATATCACTAAGGAAGAA
Microcebus_murinus|1120            GCTCAGCAGGTCCTCTCTGACTCTCTTCATCCAAAATGCAGGGATATCACTAAAGAGGAA
Tupaia_belangeri|13218             GCTCAGCAGGTCCTCTCTGATTCTCTTCATCCAAAATGCAGGGATATCACTAGAGAGGAA
Otolemur_garnettii|5141            NNNNNNNNNNNNNNNNNNGACTCTCTTCATCCCAAATGCAGGGATATCACTAAAGAAGAA
Mus_musculus|44022                 GCTCAGCAGGTCCTCTCCGACTCTGTCCATCCAAAATGC---------------------
Rattus_norvegicus|33925            GCTCAGCAAGTTCTGTGTGACTCTGTTCATCCAAAATGC---------------------
Cavia_porcellus|4935               GCTCAGCAGGTCCTCTCCGACTCTCTTCATCCAAAATGCAGGGATATCACTAAAGAGGAA
Callithrix_jacchus|26677           GCTCAGCAGGTCCTGTCTGACTCTCTCCATCCAAAATGC---------------------
Tarsius_syrichta|2759              GCCCAGCAAGTCCTCTCTGACTCTCTTCACCCCAAATGCAGNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|2813             GCTCAGCAGGTCCTCTCTGACTCTCTCCATCCAAAAAGCAGAGATATCACTAAAGAGGAA
Pan_troglodytes|7725               GCTCAGCAGGTCCTGTCTGACTCTCTTCATCCGAAATGCAGGGATATCACTAAAGAAGAA
Gorilla_gorilla|16216              GCTCAGCAGGTCCTGTCTGACTCTCTTCATCCGAAATGCAGGGATATCACTAAAGAAGAA
Homo_sapiens|19398                 GCTCAGCAGGTCCTGTCTGACTCTCTTCATCCGAAATGC---------------------
                                   .    .   ..  . .  .  . . .           .                      

Dipodomys_ordii|15274              NNNNNTAAGTTCAGCAAAGCAGAATGGGAGAAGAAAAGGATGGATAAAGCAATTGGGTAC
Spermophilus_tridecemlineatus|1234 ATAAGCAAATTCAGCAAAACAGAATGGGAGAAGAAAAGGATGGATAAAGCAATTGGGTAC
Microcebus_murinus|1120            ATAAGCAAATTCAGCAAAGCAGAATGGGAAAAGAAAAGGATGGATAAAGCAATTGGGTAC
Tupaia_belangeri|13218             ATAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|5141            ATAAGCAAATTCAGCAAAGCAGAATGGGAAAAGAAAAGGATGGATAAAGCAATTGGGTAC
Mus_musculus|44022                 ---AGCAAATTCAGCAAAATAGAATGGGAAAAGAAAAAGATGGATAAAGCCATTGGGTAC
Rattus_norvegicus|33925            ---AGCAAATTCAGCAAAACAGAATGGGAAAAGAAAAAGATGGATAAAGCAATTGGGTAC
Cavia_porcellus|4935               ATAAGCAAATTCAGCAAAGCAGAATGGGAGAAGAAAAAGTTGGATAAAGCAATTGGGTAC
Callithrix_jacchus|26677           ---AGCAAATTCAGCAAAGCAGAATGGGAGAAGAAAAGGATGGATAAGGCAATTGGGTAC
Tarsius_syrichta|2759              NNNNNCAAATTCAGCAAAGCAGAATGGGAGAAGAAGAGGATGGACAAGGCAATTGGATAC
Ochotona_princeps|2813             ATAAGCAAATTCAGCAAAGCAGAATGGGAGAAGAAAAGAATGGATAAAGCAATCGGGTAC
Pan_troglodytes|7725               ATAAGCAAATTCAGCAAAGCAGAATGGGAGAAGAAAAGGATGGATAAGGCAATTGGGTAC
Gorilla_gorilla|16216              ATAAGCAAATTCAGCAAAGCAGAATGGGAGAAGAAAAGGATGGATAAGGCAATTGGGTAC
Homo_sapiens|19398                 ---AGCAAATTCAGCAAAGCAGAATGGGAGAAGAAAAGGATGGATAAGGCAATTGGGTAC
                                       .    ..  .       .  ....    .       ...     .   . .. .  

Dipodomys_ordii|15274              TCCTTTGCAATTGTGGGCATCAATATCACCGACCTGGCCTATAATCTTCTGGTGAGCGGA
Spermophilus_tridecemlineatus|1234 TCATTTGCAATTGTGGGCATCAATATAACCGATCTGGCATATAATCTACTGGTCAGTGGA
Microcebus_murinus|1120            TCATTTGCAATTGTGGGCATCAATATAACCGACCTGGCATATAATCTACTGGTTAGCGGA
Tupaia_belangeri|13218             NNNNNNNNNNNNNNNNNNNNCAATATAACTGACCTGGCGTACAATCTACTGGTCAGTGGA
Otolemur_garnettii|5141            TCATTTGCAATTGTGGGCATCAATATAACTGACCTGGCGTATAATCTACTGGTGAGCGGA
Mus_musculus|44022                 TCCTTTGCAATTGTGGGCATCAATATCACCGACCTGGCATATAATCTGCTCGTGAGCGGC
Rattus_norvegicus|33925            TCCTTTGCAATCGTGGGCATCAATATCACCGACCTGGCATATAATCTGCTCGTGAGCGGC
Cavia_porcellus|4935               TCCTTTGCAATTGTGGGCATCAATATAACTGATCTGGCTTATAATCTTCTGCTCAGTGGA
Callithrix_jacchus|26677           TCATTTGCAATTGTGGGCATCAATATAACTGACCTGGCATATAATCTCCTGGTCAGCGGA
Tarsius_syrichta|2759              TCCTTTGCAATCGTGGGCATCAACATAACTGACCTGGCGTATAATCTACTGGTCAGCGGA
Ochotona_princeps|2813             TCATTTGCAATTGTGGGCATCAACATAACAGATCTGGCGTACAATCTACTGGTCAGTGGC
Pan_troglodytes|7725               TCATTTGCAATTGTGGGCATCAATATAACTGACCTGGCATATAATCTACTGGTCAGCGGA
Gorilla_gorilla|16216              TCATTTGCAATTGTGGGCATCAATATAACTGACCTGGCATATAATCTACTGGTCAGCGGA
Homo_sapiens|19398                 TCATTTGCAATTGTGGGCATCAATATAACTGACCTGGCATATAATCTACTGGTCAGCGGA
                                   .  ....   . .....  .*** **.** ** ***** ** ***** **  * ** **.

Dipodomys_ordii|15274              GCTCTAAAAACCCACTTCTACAACATTGCCCCAGAAGCTCCAACCTTGTCTCACTTTCAG
Spermophilus_tridecemlineatus|1234 GCACTAAAAACCCACTTCTACAACATCGCTCCAGAAGCTCCAACATTGTCTCACTTCCAA
Microcebus_murinus|1120            GCTCTAAAAACCCATTTCTACAACATTGCCCCAGAAGCGCCAACGTTGTCTCACTTCCAA
Tupaia_belangeri|13218             GCTCTAAAGACCCACTTCTACAACATCGCTCCGGAAGCTCCAACACTGTCTCACTTCCAG
Otolemur_garnettii|5141            GCTCTGAAAACCCACTTCTACAACATTGCCCCAGAAGCCCCAACGCTGTCTCACTTCCAG
Mus_musculus|44022                 GCTCTAAAAACACACTTCTACAACATTGCCCCCGAAGCTCCGACACTGTCTCACTTCCAA
Rattus_norvegicus|33925            GCTCTGAAAACACATTTCTACAACATCGCTCCCGAAGCTCCAACACTGTCTCACTTCCAG
Cavia_porcellus|4935               GCTCTAAAAACCCATTTCTACAACATCGCCCCCGAAGCTCCGACACTGTCTCACTTCCAG
Callithrix_jacchus|26677           GCTCTGAAAACCCATTTCTACAATATCGCCCCAGAAGCTCCAACATTGTCTCACTTTCAG
Tarsius_syrichta|2759              GCTCTAAAAACCCATTTCTACAACATCGCGCCAGAAGCCCCAACATTGTCTCACTTCCAG
Ochotona_princeps|2813             GCTCTGAAAACCCATTTCTATAACATTGCCCCAGAAGCTCCGACATTGTCTCACTTCCAG
Pan_troglodytes|7725               GCTCTAAAAACCCATTTCTACAATATCGCCCCAGAAGCTCCAACATTGTCTCACTTTCAG
Gorilla_gorilla|16216              GCTCTAAAAACCCATTTCTACAATATCGCCCCAGAAGCTCCAACATTGTCTCACTTTCAG
Homo_sapiens|19398                 GCTCTAAAAACCCATTTCTACAATATCGCCCCAGAAGCTCCAACATTGTCTCACTTTCAG
                                   **:**.**.**.** ***** ** ** ** ** ***** **.**  ********** **.

Dipodomys_ordii|15274              CAAACATTCTGCTACTTGATGCACGAATTTCACAAGTTTTGGATTGAAGAGGACCCCATG
Spermophilus_tridecemlineatus|1234 CAAACCTTCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|1120            CAAACGTTCTGCTATTTGATGCACGAATTTCATAAGTTTTGGATTGAAGAGGACCCCATG
Tupaia_belangeri|13218             CAGACATTCTGCTATTTGATGCACGAGTTTCATAAGTTTTGGATTGAAGAAGACCCCATG
Otolemur_garnettii|5141            CAGACGTTC---------------------------------------------------
Mus_musculus|44022                 CAAACATTCTGCTATTTGATGCACGAGTTTCACAAGTTTTGGATTGAAGAGGACCCCATG
Rattus_norvegicus|33925            CAAACATTCTGCTATTTGATGCACGAGTTTCACAAGTTTTGGATTGAAGAGGACCCCATG
Cavia_porcellus|4935               CAAACATTCTGTTATTTGATGCATGAATTTCACAAATTTTGGATTGAAGAGGACCCCATG
Callithrix_jacchus|26677           CAAACATTCTGCTATCTGATGCACGAATTTCATAAGTTTTGGATCGACGAGGACCCCATG
Tarsius_syrichta|2759              CAAACGTTCTGCTATTTGATGCATGAATTTCATAAGTTTTGGATCGAAGAGGACCCCATG
Ochotona_princeps|2813             CAAACATTCTGCTATTTGATGCATGAGTTTCATAAATTTTGGATTGAAGAGGACCCCATG
Pan_troglodytes|7725               CAAACATTCTGCTATTTGATGCATGAATTTCATAAGTTTTGGATCGAAGAGGACCCCATG
Gorilla_gorilla|16216              CAAACGTTCTGCTATTTGATGCATGAATTTCACAAGTTTTGGATCGAAGAGGACCCCATG
Homo_sapiens|19398                 CAAACATTCTGCTATTTGATGCATGAATTTCATAAGTTTTGGATCGAAGAGGACCCCATG
                                   **.** ***                                                   

Dipodomys_ordii|15274              GACATAATGGAATTTAATCGTGTGCGGGAGAAGTTTCGTAAGAGGATCCTAAAACAGCTA
Spermophilus_tridecemlineatus|1234 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATCGTAAAACAGCTG
Microcebus_murinus|1120            GACATAATGGAATTTAATCGCGTGCGGGAGAAATTCCGCAAGAGAATCATCAAACAGCTG
Tupaia_belangeri|13218             GACATAATGGAATTTAATCGTGTGCGGGAGAAATTCCGCAAGAGGATTGTAAAACAGCTG
Otolemur_garnettii|5141            ------------------------------------------------------------
Mus_musculus|44022                 GACATAATGGAGTTTAATCGCGTGAGGGAGAAATTCCGCAAGAGGATCATAAAACAGCTG
Rattus_norvegicus|33925            GACATAATGGAATTTAACCGCGTGCGGGAGAAATTCCGCAAGAGAATCATAAAACAGCTG
Cavia_porcellus|4935               GACATAATGGAATTTAATCGTGTGCGGGAGAAATTCCGCAAAAGAATCATAAAACAGCTG
Callithrix_jacchus|26677           GACATAATGGAATTTAACCGTGTGCGGGAGAAATTCCGCAAGAGGATCGTAAAGCAGCTG
Tarsius_syrichta|2759              GACATAATGGAATTTAATCGTGTGCGTGAGAAATTCCGCAAGAGGATTATAAAACAGCTG
Ochotona_princeps|2813             GACATAATGGAATTCAATCGTGTGCGGGAGAAATTCCGCAAGAGGATCATAAAACAGCTG
Pan_troglodytes|7725               GACATAATGGAATTTAATCGTGTGAGGGAGAAATTCCGCAAGAGGATCATCAAACAGCTG
Gorilla_gorilla|16216              GACATAATGGAATTTAATCGTGTGAGGGAGAAATTCCGCAAGAGGATCATCAAACAGCTG
Homo_sapiens|19398                 GACATAATGGAATTTAATCGTGTGAGGGAGAAATTCCGCAAGAGGATCATCAAACAGCTG
                                                                                               

Dipodomys_ordii|15274              CAAAACCCAGACATGGCGCTGTGCCCACATTTCGCTGCCTCTGAAGGTTTAATCAACATG
Spermophilus_tridecemlineatus|1234 CAAAATCCAGACATGGCGCTGTGC---CATTTTGCTGCCTCTGAAGGTTTAATCAACATG
Microcebus_murinus|1120            CAGAACCCAGACATGGCGCTGTGCCCACATTTCGCTGCCTCGGAAGGTTTAATCAACATG
Tupaia_belangeri|13218             CAGAACCCAGACATGGCACTGTGCCCACATTTTGCTGCCTCTGAAGGTTTAATTAACATG
Otolemur_garnettii|5141            ------------------------------------------------------------
Mus_musculus|44022                 CAGAACCCAGATATGGCGCTGTGCCCGCATTTTGCTGCATCGGAAGGTTTAATCAACATG
Rattus_norvegicus|33925            CAGAACCCAGACATGGCGCTGTGCCCACATTTCGCTGCCTCTGAAGGTTTAATCAACATG
Cavia_porcellus|4935               CAAAACCCAGACATGGCACTGTGCCCACATTTTGCTGCCTCAGAAGGTTTAATCAACATG
Callithrix_jacchus|26677           CAGAACCCAGACATGGCGCTGTGCCCACATTTTGCTGCCTCGGAAGGTTTAATCAACATG
Tarsius_syrichta|2759              CAGAACCCAGACATGGCGCTGTGCCCGCACTTCGCTGCCTCGGAAGGTTTAATCAACATG
Ochotona_princeps|2813             CAAAACCCAGACATGGCGCTGTGCCCGCATTTCGCTGCCTCGGAAGGTTTAATCAACATG
Pan_troglodytes|7725               CAGAACCCAGACATGGCACTGTGCCCACATTTTGCTGCCTCGGAAGGTTTAATCAACATG
Gorilla_gorilla|16216              CAGAACCCAGACATGGCGCTGTGCCCACATTTTGCTGCCTCGGAAGGTTTAATCAACATG
Homo_sapiens|19398                 CAGAACCCAGACATGGCGCTGTGCCCACATTTTGCTGCCTCGGAAGGTTTAATCAACATG
                                                                                               

Dipodomys_ordii|15274              TAG
Spermophilus_tridecemlineatus|1234 TAG
Microcebus_murinus|1120            TAG
Tupaia_belangeri|13218             TAG
Otolemur_garnettii|5141            ---
Mus_musculus|44022                 TAG
Rattus_norvegicus|33925            TAG
Cavia_porcellus|4935               TAG
Callithrix_jacchus|26677           TAG
Tarsius_syrichta|2759              TAG
Ochotona_princeps|2813             TAG
Pan_troglodytes|7725               TAG
Gorilla_gorilla|16216              TAG
Homo_sapiens|19398                 TAG
                                      

multiple sequence alignment in CLUSTALW format


Dipodomys_ordii|14356              -------------------------------RMFIQVCLYFYCKFLWRCLKFVMRKLTGR
Spermophilus_tridecemlineatus|1109 ------------------------------------------------------------
Microcebus_murinus|954             ------------------------------------------------------------
Tupaia_belangeri|11447             ------------------------------------------------------------
Otolemur_garnettii|4430            ------------------------------------------------------------
Mus_musculus|21874                 DSWRSIRRVKRLQNEALPELSIGRVLSFVPHRMLIQVCLYFYCKFLWRCMKFVMRKLTGR
Rattus_norvegicus|21791            --------------------------------MLIQVCLYFYCKFLWRCMKFVMRKLTGR
Cavia_porcellus|3848               -----------------------------FHRMLIQVCLYFYCKFLWRCLKFVMRKLTGR
Callithrix_jacchus|18786           --------------------------MKHFLRMLIQVCLYFYCNFLWRCLKFVMRKLTGR
Tarsius_syrichta|2527              -------------------------------RMLIQVCLYFYCKFLWRCLKFVMRKLTGR
Ochotona_princeps|2453             -------------------------------RMLIQVCLYFYCKFLWRCLKFVMRKLTGR
Pan_troglodytes|22613              --------------------------LEHFLRMLIQVCLYFYCKFLWRCLKFVMRKLTGR
Gorilla_gorilla|13049              --------------------------MKHFLRMLIQVCLYFYCKFLWRCLKFVMRKLTGR
Homo_sapiens|29404                 --------------------------MKHFLRMLIQVCLYFYCKFLWRCLKFVMRKLTGR
                                                                                               

Dipodomys_ordii|14356              CELQRICYNTKPGASRTMKIETSLRDSKSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Spermophilus_tridecemlineatus|1109 -----------------MKIETSLRDSKSKLLQTSVSVHPDAIEKTIDDIMELKKINPDI
Microcebus_murinus|954             -----------------MKIETSLKDSKSKXXXXXXXXXXXXXXXXXXXXMELKKISPDI
Tupaia_belangeri|11447             ---------------------------KSKLLQTSVSVHPDAIEKTIEDIMELKKINPDI
Otolemur_garnettii|4430            -----------------MKIETSLRDSKSKLLQTSVSVHLDAIEKTIDDIMELKKINPDV
Mus_musculus|21874                 CELQRICYGTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIDDIMELKKINPDI
Rattus_norvegicus|21791            CELQRICYGTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIDDIMELKKINPDI
Cavia_porcellus|3848               CELQRICYSTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKINPDI
Callithrix_jacchus|18786           CELQRICYNTKPGAPRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKINPDI
Tarsius_syrichta|2527              CELQRICYNTKPGASRTMKIETSLRESKSKLLQTSVSVHPDAIEKTIEDIMELKKINPDI
Ochotona_princeps|2453             CELQRICYNTKPGASRTMKIETSLRESKSKLLQTSVSVHPDAIEKTIEDIMELKKINPDI
Pan_troglodytes|22613              CELQRICYNTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKINPDI
Gorilla_gorilla|13049              CELQRICYNTKLGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKINPDV
Homo_sapiens|29404                 CELQRICYNTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKINPDV
                                                              ***                              

Dipodomys_ordii|14356              XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Spermophilus_tridecemlineatus|1109 NPQLGISLQACLLQIVGYRNLIADVEKLRREPYDSDNPQHEEMLLKXXXXXXXXXXXXXX
Microcebus_murinus|954             NXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLWKFLKPDTPLESR
Tupaia_belangeri|11447             NPQLGISLQACLLQIVGYRNLIADVEKLRREPYDSDNPQHEEMLLKLWKFLKPNTPLESR
Otolemur_garnettii|4430            NPQLGISLQACLLQIVGYRNLIADVEKLRREPYDSDNPQHEEMLLKLWKFLKPNTPLESR
Mus_musculus|21874                 NPQLGISLQACLLQIVGYRNLIADVEKLRREPYDSDNPQHEEMLLKLWELLKPNTPLESR
Rattus_norvegicus|21791            NPQLGISLQACLLQIVGYRNLIADVEKLRREPYDSDNPQHEEMLLKLWEFLKPNTPLESR
Cavia_porcellus|3848               NPQLGISLQACLLQIVGYRNLIADVEKLRKEPYDSDNPQHEEMLLKLWQFLKPNTPLESR
Callithrix_jacchus|18786           NPQLGISLQACLLQIVGYRNLIADVEKLRREPYDSDNPQHEEMLLKLWKFLKPNTPLESR
Tarsius_syrichta|2527              NPQLGISLQACLLQIVGYRNLIADVEKLRREPYDSDNPQHEEMLLKLWKFLKPNTPLESR
Ochotona_princeps|2453             NPQLGISLQACLLQIVGYRNLIADVEKLRREPYDSENPQHEEMLLKLWKFLKPNTPLESR
Pan_troglodytes|22613              NPQLGISLQACLLQIVGYRNLIADVEKLRREAYDSDNPQHEEMLLKLWKFLKPNTPLESR
Gorilla_gorilla|13049              NPQLGISLQACLLQIVGYRNLIADVEKLRREPYDSDNPQHEEMLLKLWKFLKPNTPLESR
Homo_sapiens|29404                 NPQLGISLQACLLQIVGYRNLIADVEKLRREAYDSDNPQHEEMLLKLWKFLKPNTPLESR
                                                                                               

Dipodomys_ordii|14356              XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Spermophilus_tridecemlineatus|1109 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDITKEE
Microcebus_murinus|954             ISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCRDITKEE
Tupaia_belangeri|11447             ISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCRDITREE
Otolemur_garnettii|4430            ISKQWCEIGFQGDDPKTDFRGMGLLGLYNLXXXXXXXXXXXXXXXXDSLHPKCRDITKEE
Mus_musculus|21874                 VSKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATVAQQVLSDSVHPKC-------
Rattus_norvegicus|21791            ISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATVAQQVLCDSVHPKC-------
Cavia_porcellus|3848               ISKQWCEIGFQGDDPKTDFRGMGLLGLCNLQYFAEKDATAAQQVLSDSLHPKCRDITKEE
Callithrix_jacchus|18786           ISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKC-------
Tarsius_syrichta|2527              ISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCXXXXXXX
Ochotona_princeps|2453             ISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKSRDITKEE
Pan_troglodytes|22613              ISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCRDITKEE
Gorilla_gorilla|13049              ISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCRDITKEE
Homo_sapiens|29404                 ISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKC-------
                                                                                               

Dipodomys_ordii|14356              XXKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQ
Spermophilus_tridecemlineatus|1109 ISKFSKTEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQ
Microcebus_murinus|954             ISKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQ
Tupaia_belangeri|11447             IXXXXXXXXXXXXXXXXXXXXXXXXXXNITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQ
Otolemur_garnettii|4430            ISKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQ
Mus_musculus|21874                 -SKFSKIEWEKKKMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQ
Rattus_norvegicus|21791            -SKFSKTEWEKKKMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQ
Cavia_porcellus|3848               ISKFSKAEWEKKKLDKAIGYSFAIVGINITDLAYNLLLSGALKTHFYNIAPEAPTLSHFQ
Callithrix_jacchus|18786           -SKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQ
Tarsius_syrichta|2527              XXKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQ
Ochotona_princeps|2453             ISKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQ
Pan_troglodytes|22613              ISKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQ
Gorilla_gorilla|13049              ISKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQ
Homo_sapiens|29404                 -SKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQ
                                                              **********:**********************

Dipodomys_ordii|14356              QTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRILKQLQNPDMALCPHFAASEGLINM
Spermophilus_tridecemlineatus|1109 QTFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVKQLQNPDMALC-HFAASEGLINM
Microcebus_murinus|954             QTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM
Tupaia_belangeri|11447             QTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIVKQLQNPDMALCPHFAASEGLINM
Otolemur_garnettii|4430            QTF---------------------------------------------------------
Mus_musculus|21874                 QTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM
Rattus_norvegicus|21791            QTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM
Cavia_porcellus|3848               QTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM
Callithrix_jacchus|18786           QTFCYLMHEFHKFWIDEDPMDIMEFNRVREKFRKRIVKQLQNPDMALCPHFAASEGLINM
Tarsius_syrichta|2527              QTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM
Ochotona_princeps|2453             QTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM
Pan_troglodytes|22613              QTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM
Gorilla_gorilla|13049              QTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM
Homo_sapiens|29404                 QTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM
                                   ***