Orthologs Set ID: EOG4003HH


Orthology Database
OrthoDB4
Gene Symbol(s)
ANXA4

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 15968 9, 97, 192, 306, 397, 477, 534, 628, 724, 783, 906
Cavia porcellus 14761 97, 192, 306, 397, 477, 534, 628, 724, 783, 906
Dipodomys ordii 15392 192, 306, 397, 477, 534, 628, 724, 744, 783, 906
Gorilla gorilla 1049 9, 97, 192, 306, 397, 477, 534, 628, 724, 783, 906
Homo sapiens 44459 9, 97, 192, 240, 397, 477, 534, 628, 724, 783, 906
Microcebus murinus 12912 9, 97, 192, 306, 397, 477, 534, 628, 724, 783
Mus musculus 36010 9, 97, 192, 306, 397, 477, 534, 628, 724, 783, 906
Ochotona princeps 2200 9, 97, 192, 306, 397, 477, 534, 628, 683, 693, 717, 724, 783, 906
Otolemur garnettii 8724 9, 97, 185, 192, 306, 397, 477, 534, 628, 724, 783
Pan troglodytes 23742 9, 97, 192, 306, 397, 477, 534, 628, 724, 783, 906
Rattus norvegicus 25577 9, 97, 192, 306, 397, 477, 534, 628, 724, 783, 906
Spermophilus tridecemlineatus 706 9, 97, 192, 306, 397, 477, 534, 628, 724, 783, 906
Tarsius syrichta 11655 192, 306, 397, 477, 534, 628, 724, 783, 906
Tupaia belangeri 11989 9, 97, 192, 306, 397, 477, 507, 510, 534, 628, 724, 783, 906

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 15968 ENSCJAT00000037699 100408331 ENSCJAG00000019192 ANXA4 calJac3
Cavia porcellus 14761 ENSCPOT00000007201 100719685 ENSCPOG00000007130 ANXA4 cavPor3
Dipodomys ordii 15392 ENSDORT00000010018 ENSDORG00000010018 Anxa4 dipOrd1
Gorilla gorilla 1049 ENSGGOT00000002137 101132856 ENSGGOG00000002124 ANXA4 gorGor3
Homo sapiens 44459 ENST00000409920 307 ENSG00000196975 ANXA4 hg19,GRCh37
Microcebus murinus 12912 ENSMICT00000011997 ENSMICG00000012000 ANXA4 micMur1
Mus musculus 36010 ENSMUST00000113675 11746 ENSMUSG00000029994 Anxa4 mm9
Ochotona princeps 2200 ENSOPRT00000006489 ENSOPRG00000006491 ANXA4 OchPri2.0
Otolemur garnettii 8724 ENSOGAT00000008409 100963431 ENSOGAG00000008405 ANXA4 otoGar1
Pan troglodytes 23742 ENSPTRT00000022368 459542 ENSPTRG00000012019 ANXA4 panTro2
Rattus norvegicus 25577 ENSRNOT00000024436, NM_024155 79124 ENSRNOG00000018159 Anxa4 rn4
Spermophilus tridecemlineatus 706 ENSSTOT00000000706 101965033 ENSSTOG00000000710 Anxa4 speTri1
Tarsius syrichta 11655 ENSTSYT00000008096 ENSTSYG00000008068 ANXA4 tarSyr1
Tupaia belangeri 11989 ENSTBET00000011990 ENSTBEG00000011983 ANXA4 tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 8589 ENSCJAP00000035700 100408331 ENSCJAG00000019192 ANXA4 calJac3
Cavia porcellus 11557 ENSCPOP00000006429 100719685 ENSCPOG00000007130 ANXA4 cavPor3
Dipodomys ordii 14470 ENSDORP00000009417 ENSDORG00000010018 Anxa4 dipOrd1
Gorilla gorilla 999 ENSGGOP00000002092 101132856 ENSGGOG00000002124 ANXA4 gorGor3
Homo sapiens 68692 ENSP00000386756 307 ENSG00000196975 ANXA4 hg19,GRCh37
Microcebus murinus 10926 ENSMICP00000010925 ENSMICG00000012000 ANXA4 micMur1
Mus musculus 33057 ENSMUSP00000109305 11746 ENSMUSG00000029994 Anxa4 mm9
Ochotona princeps 1920 ENSOPRP00000005947 ENSOPRG00000006491 ANXA4 OchPri2.0
Otolemur garnettii 7529 ENSOGAP00000007530 100963431 ENSOGAG00000008405 ANXA4 otoGar1
Pan troglodytes 14865 ENSPTRP00000020639 459542 ENSPTRG00000012019 ANXA4 panTro2
Rattus norvegicus 6255 ENSRNOP00000024436 79124 ENSRNOG00000018159 Anxa4 rn4
Spermophilus tridecemlineatus 637 ENSSTOP00000000632 101965033 ENSSTOG00000000710 Anxa4 speTri1
Tarsius syrichta 10680 ENSTSYP00000007428 ENSTSYG00000008068 ANXA4 tarSyr1
Tupaia belangeri 10375 ENSTBEP00000010378 ENSTBEG00000011983 ANXA4 tupBel1

multiple sequence alignment in CLUSTALW format


Spermophilus_tridecemlineatus|706 GTGGCAATGGCAACCAAAGGAGGTACCATCAAAGCTGCATCAGGATTCAATGCTGTTGAG
Ochotona_princeps|2200            ATGGCCATGGCATCCAAAGGAGGAACTGTCAAGGCCGCTTCAGGATTCAGTGCTGCTGAA
Otolemur_garnettii|8724           ATGGCCATGGCAAGCAAAGGAGGTACGATCAAAGCTGCTTCAGGATTCAATGCTGCCGAA
Tarsius_syrichta|11655            ------------------------------------------------------------
Cavia_porcellus|14761             TGTACTCAGGCAACCAAAGGAGGCACCGTCAAAGCTGCTTCAGGATTCAATGCCATCGAG
Rattus_norvegicus|25577           ------ATGGAAACCAAAGGAGGAACTGTGAAAGCTGCTTCAGGATTCAATGCAACTGAA
Mus_musculus|36010                ------ATGGAAGCCAAAGGAGGAACCGTGAAAGCTGCTTCAGGATTCAACGCAACTGAA
Tupaia_belangeri|11989            ATGGCCATGGCATCCAAAGGAGGCACCATCAAAGCTGCTTCAGGATTCAATGCTGTTGAA
Callithrix_jacchus|15968          ------ATGGCAACCAAAGGAGGTACTGTCAAAGCTGCTTCAGGATTCAATGCCGCGGAA
Gorilla_gorilla|1049              ------ATGGCAACGAAAGGAGGTACTGTCAAAGCTGCTTCAGGATTCAATGCCGTGGAA
Homo_sapiens|44459                ATGGCCATGGCAACCAAAGGAGGTACTGTCAAAGCTGCTTCAGGATTCAATGCCATGGAA
Pan_troglodytes|23742             ATGGCCATGGCAACCAAAGGAGGTACTGTCAAAGCTGCTTCAGGATTCAATGCCGTGGAA
Dipodomys_ordii|15392             ------------------------------------------------------------
Microcebus_murinus|12912          ATGGCCATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                                                                              

Spermophilus_tridecemlineatus|706 GATGCCCAGACCCTGCGGAAGGCCATGAAAGGGCTGGGCACGGATGAAGATGCCATTATT
Ochotona_princeps|2200            GATGCCCAGGTCCTGAGGAAGGCCATGAAAGGACTAGGCACCGATGAGGATGCCATCATT
Otolemur_garnettii|8724           GATGCCCAGAGCCTGAGAAAAGCCATGAAAGGGCTTGGCACCGATGAAGATGCCATTATT
Tarsius_syrichta|11655            ---------------------------------------ACTGATGAAGATGCCATTATT
Cavia_porcellus|14761             GATGCCCAGGCCCTGAGGAAGGCCATGAAAGGACTTGGCACAGATGAAGACGCCATCATC
Rattus_norvegicus|25577           GATGCCCAGGTCCTGAGGAAGGCCATGAAAGGTCTGGGTACTGACGAAGATGCCATTATC
Mus_musculus|36010                GATGCCCAGACCCTGAGGAAGGCCATGAAAGGCCTCGGTACTGATGAAGATGCCATTATC
Tupaia_belangeri|11989            GATGCCCAGAGCCTGAGGAAGGCCATGAAAGGCCTCGGCACCGATGAAGACGGCATCATT
Callithrix_jacchus|15968          GATGCCCAGACCCTGAGGAAGGCCATGAAAGGGCTCGGCACTGATGAAGATGCCATTATT
Gorilla_gorilla|1049              GATGCCCAGACCCTGAGGAAGGCCATGAAAGGGCTCGGCACCGATGAAGACGCCATTGTT
Homo_sapiens|44459                GATGCCCAGACCCTGAGGAAGGCCATGAAAGGGCTCGGCACCGATGAAGACGCCATTATT
Pan_troglodytes|23742             GATGCCCAGACCCTGAGGAAGGCCATGAAAGGGCTCGGCACCGATGAAGACGCCATTATT
Dipodomys_ordii|15392             ---------------------------------------ACCGATGAGGACGCCATTATC
Microcebus_murinus|12912          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCACCGATGAAGATGCCATCATC
                                                                         ** ** **.** * *** .* 

Spermophilus_tridecemlineatus|706 GGAGTCCTCGCCTACCGCAACACGGCCCAGCGCCAGGAAATCAGAACAGCCTACAAGAGC
Ochotona_princeps|2200            CAAGTCCTTGCCTACCGCAGCACGGCCCAGCGCCAGGAAATCAGGACCACCTACAAGTCC
Otolemur_garnettii|8724           AGAGTCCTTGCCTACCGCAACACTGCCCAGCGCCAGGAAATCAGGACAGCCTACAAGACC
Tarsius_syrichta|11655            AGCGTCCTTGCCTACCGCAACACGGCCCAGCGCCAGGAAATCAGGACGGCCTACAAGAGC
Cavia_porcellus|14761             AGAGTCCTGGCCTACCGCAGCACGGCCCAGCGCCAGGAAATCAGGACGGCCTACAAGACC
Rattus_norvegicus|25577           GGAGTCTTAGCCTGCCGGAACACTGCCCAACGACAGGAAATCAGGACGGCCTACAAGAGC
Mus_musculus|36010                GGAATCTTAGCCTACAGAAACACCGCCCAGCGCCAGGAGATCAGGAGTGCCTACAAGAGC
Tupaia_belangeri|11989            AAAGTCCTCGCCTACCGCAACACGGCCCAGCGCCAGGAAATCAGGACGGCCTACAAGACC
Callithrix_jacchus|15968          AGCATCCTTGCCTACCGCAACACCGCCCAGCGCCAGGAGATCAGGACCGCCTACAAGAGC
Gorilla_gorilla|1049              AGCGTCCTTGCCTACCGCAACACCGCCCAGCGGCAGGAGATCAGGACAGCCTACAAGAGC
Homo_sapiens|44459                AGCGTCCTTGCCTACCGCAACACCGCCCAGCGCCAGGAGATCAGGACAGCCTACAAGAGC
Pan_troglodytes|23742             AGCGTCCTTGCCTACCGCAACACCGCCCAGCGCCAGGAGATCAGGACAGCCTACAAGAGC
Dipodomys_ordii|15392             AGAGTCCTGGCCTACCGCAACACTGCCCAGCGCCAGGAAATCAGGACAGCCTACAAGACC
Microcebus_murinus|12912          AGAGTCCTCGCCTACCGCAGCACTGCCCAGCGCCAGGAAATCAGGACGGCCTACAAGACC
                                   ...** * ****.*.* *.*** *****.** *****.*****.*  .********: *

Spermophilus_tridecemlineatus|706 AACATTGGCAGGGACCTGATGGATGACTTGAAGTCAGAACTAAGCGGCAAGTTCGAGCAG
Ochotona_princeps|2200            ACCATTGGCAAGGACCTGATAGATGACCTGAAGTCTGAACTGAGTGGCAACTTCGAGCAG
Otolemur_garnettii|8724           ACCATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|11655            ACCATCGGCAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|14761             ACCATCGGCAGGGAGCTGATAGATGACTTGAAGTCCGAACTGAGTGGCAACTTCGAGCAG
Rattus_norvegicus|25577           ACCATTGGCAGGGACCTGCTTGAGGACTTGAAGTCGGAGCTGAGCAGCAACTTCGAGCAG
Mus_musculus|36010                ACCATTGGCAGGGACCTGATTGAGGACTTGAAGTCGGAGCTGAGCAGCAACTTTGAGCAG
Tupaia_belangeri|11989            AATATCGGCAGGGACTTGATAGATGACTTGAAGTCAGAACTGAGTGGCAACTTCGAGCAG
Callithrix_jacchus|15968          ACCATTGGCAGGGACTTGATAGACGACCTGAAGTCAGAACTGAGTGGCAATTTTGAGCAG
Gorilla_gorilla|1049              ACCATCGGCAGGGACTTGATAGACGACCTGAAGTCAGAACTGAGTGGCAACTTCGAGCAG
Homo_sapiens|44459                ACCATCGGCAGGGACTTGATAGACGACCTGAAGTCAGAACTGAGTGGCAACTTCGAGCAG
Pan_troglodytes|23742             ACCATCGGCAGGGACTTGATAGACGACCTGAAGTCAGAACTGAGTGGCAACTTCGAGCAG
Dipodomys_ordii|15392             ACTATTGGCAGGGATCTGATGGATGACTTGAAATCGGAACTGAGTGGCAACTTTGAGCAG
Microcebus_murinus|12912          ACCATTGGCAGGGACCTGATAGACGACCTGAAGTCAGAACTGAGTGGCAACTTCGAGCAG
                                  *. ** ..   ..   .. . .  .   ..   .  .   .  .  .    .. . .  .

Spermophilus_tridecemlineatus|706 GTCATCATAGGCATGATGACACCCACCGTGCTGTACGATGTGCAGGAGCTGCGAAAGGCC
Ochotona_princeps|2200            GTGATCCTGGGATTGATGACGCCCACCTTGCTGTATGACGTGCAGGAGCTGCGAAAGGCC
Otolemur_garnettii|8724           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|11655            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|14761             GTGATCATAGGAATGATGACACCCACCGTGCTATATGATGTGCAGGAGCTGCGAAGGGCC
Rattus_norvegicus|25577           GTGATCCTGGGCATGATGACGCCCACAGTGCTGTATGACGTGCAGGAGCTCCGGAGGGCT
Mus_musculus|36010                GTGATCCTGGGGCTGATGACACCCACAGTGCTGTATGACGTACAGGAGCTGCGGAGGGCC
Tupaia_belangeri|11989            GTGATCGTGGGCATGATGACGCCCACTGTGCTGTACGACGTGCAGGAGCTGCGAAGAGCC
Callithrix_jacchus|15968          GTGATTGTGGGGATGATGATGCCCACGGTGCTGTATGATGTGCAAGAGCTGCGAAGGGCC
Gorilla_gorilla|1049              GTGATTGTGGGGATGATGACGCCCACGGTGCTGTATGACGTGCAAGAGCTGCGAAGGGCC
Homo_sapiens|44459                ------------------------------------------------------------
Pan_troglodytes|23742             GTGATTGTGGGGATGATGACGCCCACGGTGCTGTATGATGTGCAGGAGCTGCGAAGGGCC
Dipodomys_ordii|15392             GTGATCATAGGCATGATGACGCCCACCCTGCTCTATGACGTGCAGGAGCTGAGAAGAGCC
Microcebus_murinus|12912          ACGATAGTGGCGCTGATGACGCCCACGGTGCTGTATGACGTGCAGGAGCTGCACCGGGCC
                                                                                              

Spermophilus_tridecemlineatus|706 ATGAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|2200            ATGAAGGGAGCAGGCACAGATGAGGGCTGCCTGATTGAGATCCTGGCCTCCCGGACCCCA
Otolemur_garnettii|8724           NNNNNNGGAGCCGGCACGGATGAGGGCTGCCTGATTGAGATCCTGGCCTCCCGGACCCCT
Tarsius_syrichta|11655            NNNNNNGGGGCCGGCACAGATGAGGGCTGCCTAATTGAGATCCTGGCCTCCCGGACCCCT
Cavia_porcellus|14761             ATGAAGGGAGCTGGCACGGATGAAGGCTGCCTGATTGAGATCCTGGCCTCGCGGACCCCC
Rattus_norvegicus|25577           ATGAAGGGAGCTGGCACGGACGAGGGCTGTCTGATTGAGATCCTGGCCTCTCGCAACCCT
Mus_musculus|36010                ATGAAGGGAGCTGGCACGGACGAGGGCTGTCTGATTGAGATCCTGGCCTCTCGTACCCCT
Tupaia_belangeri|11989            ATGAAGGGAGCTGGCACAGACGAGGGCTGCCTGATTGAGATCCTAGCCTCCCGGTCCCCC
Callithrix_jacchus|15968          ATGAAGGGAGCCGGCACTGATGAGGGCTGCCTAATTGAGATCCTGGCCTCTCGGACCCCT
Gorilla_gorilla|1049              ATGAAGGGAGCTGGCACTGATGAGGGCTGCCTAATTGAGATCCTAGCCTCCCGGACCCCT
Homo_sapiens|44459                ------GGAGCCGGCACTGATGAGGGCTGCCTAATTGAGATCCTGGCCTCCCGGACCCCT
Pan_troglodytes|23742             ATGAAGGGAGCCGGCACTGATGAGGGCTGCCTAATTGAGATCCTGGCCTCCCGGACCCCT
Dipodomys_ordii|15392             ATGAAGGGAGCTGGCACGGATGAGGGTTGCCTGATTGAAATCCTGGCCTCCCGGACCCCA
Microcebus_murinus|12912          ATGAAGGGAGCCGGCACGGACGAGGGCTGCCTGATCGAGATCCTGGCCTCCCGGACCCCT
                                        .. .  ..    .  .  .. ..  .  . .   .  . .  .   .       

Spermophilus_tridecemlineatus|706 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|2200            GAGGAGATCCGGCGCATCAACCAGACCTACCAGCAGCAGTACGGCCAGAGTCTGGAAGAT
Otolemur_garnettii|8724           GAGGAGATCCGACGTATAAGCCAGACCTACCAGCAGCACTATGGACGGAGCCTTGAAGAG
Tarsius_syrichta|11655            GACGAGATCCGGCGCATAAGCCAGACCTACCAGCAGCAATACGGACGGAGCCTTGAAGAC
Cavia_porcellus|14761             GAGGAGATCCACCGCATCAAGCAGACCTACCAGATTCAATATGGACGGAGCCTTGAAGAC
Rattus_norvegicus|25577           GAGGAGATCCGTCGCATCAACCAGACATACCAGCAGCAATATGGAAGGAGCCTTGAAGAG
Mus_musculus|36010                GAGGAGATCCGTCGAATCAACCAGACATACCAGCAGCAATATGGAAGGAGCCTTGAAGAG
Tupaia_belangeri|11989            GAGGAGATCCAGCGCATAAACCAGACCTACCAGCAGCAATACGGACGGAGCCTGGAGGAT
Callithrix_jacchus|15968          GAGGAGATCCGGCGCATAAGCCAAACCTACCAGCAGCAATATGGACGGAGCCTTGAAGAT
Gorilla_gorilla|1049              GAGGAGATCCGGCGCATAAGCCAAACCTACCAGCAGCAATATGGACGGAGCCTTGAAGAT
Homo_sapiens|44459                GAGGAGATCCGGCGCATAAGCCAAACCTACCAGCAGCAATATGGACGGAGCCTTGAAGAT
Pan_troglodytes|23742             GAGGAGATCCGGCGCATAAGCCAAACCTACCAGCAGCAATATGGACGGAGCCTTGAAGAT
Dipodomys_ordii|15392             GAGGAGATCCGACTTATTAACCAGACCTACCAGCAGCAATACGGACGGAGCCTTGAAGAT
Microcebus_murinus|12912          GAGGAGATCCGGCGCATAAACCAGATCTACCAGCAGCAATATGGACGGAGCCTTGAAGAT
                                  .  . . .        .          .    .      .  ..   . .  . .  .  

Spermophilus_tridecemlineatus|706 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGT
Ochotona_princeps|2200            GACATTCGCTCTGACACATCATTCATGTTCCAGCGTGTACTGGTGTCCCTTTCAGCTGGG
Otolemur_garnettii|8724           GACATTTGCTCTGACACATCATTCATGTTCCAGCGAGTGCTGGTGTCCCTGTCGGCTGGC
Tarsius_syrichta|11655            GACATTCGCTCCGACACATCATTCATGTTCCAGCGAGTGCTGGTGTCCCTTTCGGCTGGT
Cavia_porcellus|14761             GACATTTGCTCTGACACTTCATTCATGTTCCAGAGAGTGCTGGTGTCTCTGTCAGCTGGT
Rattus_norvegicus|25577           GACATCTGCTCTGACACATCCTTCATGTTCCAGCGAGTACTGGTGTCCCTGACAGCGGGT
Mus_musculus|36010                GACATCTGCTCTGACACATCCTTCATGTTCCAGCGAGTACTGGTGTCCCTGTCGGCGGCT
Tupaia_belangeri|11989            GACATTCGCTCGGACACGTCCTTCATGTTCCAGCGAGTGCTGGTGTCTCTGTCAGCTGGC
Callithrix_jacchus|15968          GACATTTGCTCTGACACATCGTTCATGTTCCAGCGAGTGCTTGTGTCTCTGTCAGCTGGT
Gorilla_gorilla|1049              GACATTCGCTCTGACACATCGTTCATGTTCCAGCGAGTGCTGGTGTCTCTGTCAGCTGGT
Homo_sapiens|44459                GACATTCGCTCTGACACATCGTTCATGTTCCAGCGAGTGCTGGTGTCTCTGTCAGCTGGT
Pan_troglodytes|23742             GACATTCGCTCTGACACATCGTTCATGTTCCAGCGAGTGCTGGTGTCTCTGTCAGCTGGT
Dipodomys_ordii|15392             GACATCCGCTCTGACACATCGTTCATGTTCCAGCGGGTGCTAGTGTCTCTGTCAGCTGGT
Microcebus_murinus|12912          GACATTTGCTCTGACACGTCATTCATGTTCCAGCGAGTGCTGGTGTCTCTGTCAGCGGGT
                                  .   .  . .  .     .  ..  ....   . . ..  . ....   .    .  *  

Spermophilus_tridecemlineatus|706 GGCAGGGATGAGGGGAATTTCCTGGATGATGCTCTCATGAAACAGGATGCCCAGGACCTG
Ochotona_princeps|2200            GGCAGGGATGAAGGGAATTACCTGGATGATGACCTCATGAGACAAGACGCCCAGNNNNNN
Otolemur_garnettii|8724           GGTAGGGATGAAGGAAATTTTCTGGATGATGCTCTCATGAAGCAGGATGCCCAGGACCTG
Tarsius_syrichta|11655            GGTAGGGATGAAGGAAATCATCTGGATGATGCTCTCATGAGGCAAGATGCCCAGGACCTG
Cavia_porcellus|14761             GGCAGGGATCAAGGGAACTACCTGGATGATGGTCTCGTGAAACAGGATGCCAAGGACCTG
Rattus_norvegicus|25577           GGCAGGGATGAAGGAAATTACCTCGATGATGCGCTCGTGAAGCAGGATGCCCAGGATCTG
Mus_musculus|36010                GGCAGGGATGAAGGAAATTACCTTGATGATGCTCTTATGAAGCAGGACGCCCAGGAACTG
Tupaia_belangeri|11989            GGCAGAGATGGAGGAAATTTT---CCGGAGGCTCTCGTGAGACAGGATGCCCAGGACCTG
Callithrix_jacchus|15968          GGGAGGGATGAAGGAAATTACCTGGACGATGCTCTCGTGAGACAGGATGCCCAGGACCTG
Gorilla_gorilla|1049              GGGAGGGATGAAGGAAATTATCTGGACGATGCTCTCGTGAGACAGGATGCCCAGGACCTG
Homo_sapiens|44459                GGGAGGGATGAAGGAAATTATCTGGACGATGCTCTCGTGAGACAGGATGCCCAGGACCTG
Pan_troglodytes|23742             GGGAGGGATGAAGGAAATTATCTGGACGATGCTCTCGTGAGACAGGATGCCCAGGACCTG
Dipodomys_ordii|15392             GGCAGGGATGGAGGGAATTACCTGAATGATGATCTCATGAGACAGGATGCCCAGGAACTA
Microcebus_murinus|12912          GGTAGGGATGAAGGAAATCAGCTGGATGATGATCTTGTGAGGCAGGATGCCCAGGACCTG
                                  ** **.*** ..**.**  :     . ** *  ** .***..**.** ***.**.   . 

Spermophilus_tridecemlineatus|706 TATGAGGCTGGAGAGCAGAGATGGGGGACAGATGAGGTGAAATTTCTATCTGTTCTCTGT
Ochotona_princeps|2200            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|8724           TATAAGGCTGGAGAGCAAAGATGGGGGACAGATGAGGTGAAATTTTTAACTATTCTCTGT
Tarsius_syrichta|11655            TATGAGGCTGGAGAGAAGAAATGGGGGACAGATGAGGTGAAATTTCTAACTGTTCTCTGT
Cavia_porcellus|14761             TATGATGCTGGAGAGAAGAGATGGGGAACAGATGAAGTGAAATTCCTAACGATCCTCTGT
Rattus_norvegicus|25577           TATGAGGCTGGAGAGAAGAGATGGGGGACGGATGAAGTGAAGTTCCTAAGCATTCTCTGT
Mus_musculus|36010                TATGAGGCTGGAGAGAAGAGATGGGGGACAGACGAGGTGAAATTCCTAAGCATTCTCTGT
Tupaia_belangeri|11989            TATGAGGCTGGAGAAAAGAAATGGGGGACAGACGAGGTGAAATTTCTAACTATTCTCTGT
Callithrix_jacchus|15968          TATGAGGCTGGAGAGAAGAAATGGGGGACAGACGAGGTGAAATTTCTAACTGTTCTATGC
Gorilla_gorilla|1049              TATGAGGCTGGAGAGAAGAAATGGGGGACAGATGAGGTGAAATTTCTAACTGTTCTCTGT
Homo_sapiens|44459                TATGAGGCTGGAGAGAAGAAATGGGGGACAGATGAGGTGAAATTTCTAACTGTTCTCTGT
Pan_troglodytes|23742             TATGAGGCTGGAGAGAAGAAATGGGGGACAGATGAGGTGAAATTTCTAACTGTTCTCTGT
Dipodomys_ordii|15392             TATGAGGCTGGAGAGAAGAAATGGGGGACAGATGAGGTGAAATTTCTAACCATACTCTGT
Microcebus_murinus|12912          TATGAGGCTGGAGAGAAGAAATGGGGGACAGATGAGGTGAAATTTCTAACTGTTCTCTGT
                                  . .   . ... .        .....    .  .  ...   ..  .     .  . .. 

Spermophilus_tridecemlineatus|706 TCCCGGAATCGAAATCATCTGTTGCATGTGTTTGATGAATACAAAAGGATATCACAGAAG
Ochotona_princeps|2200            NNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTTTGATGAGTACAAAAGGATATCCCAGAAG
Otolemur_garnettii|8724           TCCCGGAATCGAAATCATCTGTTGCACGTGTTTGATGAATACAAAAGGATGTCACAGAAG
Tarsius_syrichta|11655            TCCCGGAATCGAAATCATCTGTTGCATGTGTTTGATGAATACAAAAGGATATCCCAGAAG
Cavia_porcellus|14761             TCCCGAAACCGAAATCATCTGTTGCATGTTTTTGATGAATACAAAAGGATATCGAAGAAG
Rattus_norvegicus|25577           TCCCGGAACCGGAACCACCTGCTCCATGTGTTTGATGAATACAAACGGATCTCACAGAAG
Mus_musculus|36010                TCCCGGAACCGGAACCATCTGCTCCACGTGTTTGATGAATACAAAAGAATCTCACAGAAG
Tupaia_belangeri|11989            TCCCGGAATCGAAACCATCTGCTGCATGTGTTTGATGAATACAAAAGGATATCGCAGAAG
Callithrix_jacchus|15968          TCCCGGAACCGAAATCACCTGTTGCATGTGTTTGATGAATACAAAAGGATATCACAGAAG
Gorilla_gorilla|1049              TCCCGGAACCGAAATCACCTGTTGCATGTGTTTGATGAATACAAAAGGATATCACAGAAG
Homo_sapiens|44459                TCCCGGAACCGAAATCACCTGTTGCATGTGTTTGATGAATACAAAAGGATATCACAGAAG
Pan_troglodytes|23742             TCCCGGAACCGAAATCACCTGTTGCATGTGTTTGATGAATACAAAAGGATATCACAGAAG
Dipodomys_ordii|15392             TCTAGAAATCGCAACCATCTCTTGCATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|12912          TCCCGGAATCGAAATCATCTGTTGCATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                  .   .     .        .  .    .. .... ..  .      .  . .    .  .

Spermophilus_tridecemlineatus|706 GATATTGAACAGAGTATTAAATCTGAGACATCTGGTCATTTTGAAGATGCTCTGCTGGCT
Ochotona_princeps|2200            GATATCGAGCAGAGTATTAAATCGGAAACATCC---AGCTTCGAAGATGCC---CTGGCT
Otolemur_garnettii|8724           GATATTGAACAGAGTATTAAATCTGAAACATCTGGTAGCTTTGAAGATGCTCTGCTGGCT
Tarsius_syrichta|11655            GACATTGAACAGAGTATTAAATCTGAAACATCTGGTAGCTTTGAAGATGCTCTGCTGGCT
Cavia_porcellus|14761             GATATTGAGCAGAGTATCAAATCTGAAACATCCGGTAGCTTTGAAGATGCTCTGCTGGCT
Rattus_norvegicus|25577           GACATTGAACAGAGCATTAAGTCTGAGACATCTGGAAGCTTTGAAGATGCTCTGCTGGCT
Mus_musculus|36010                GACATTGAACAGAGCATTAAGTCTGAGACATCTGGAAGCTTTGAAGATGCCCTGTTGGCT
Tupaia_belangeri|11989            GATATTGAGCAGAGTATTAAATCTGAAACGTCCGGCAGTTTTGAAGACGCTCTGCTGGCT
Callithrix_jacchus|15968          GATATTGAACAAAGTATTAAATCTGAAACATCTGGTAGCTTTGAAGACGCTCTGCTGGCT
Gorilla_gorilla|1049              GATATTGAACAGAGTATTAAATCTGAAACATCTGGTAGCTTTGAAGATGCTCTGCTGGCT
Homo_sapiens|44459                GATATTGAACAGAGTATTAAATCTGAAACATCTGGTAGCTTTGAAGATGCTCTGCTGGCT
Pan_troglodytes|23742             GATATTGAACAGAGTATTAAATCTGAAACATCTGGTAGCTTTGAAGATGCTCTGCTGGCT
Dipodomys_ordii|15392             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|12912          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                  .   . .      .  .    .  .     .        .. .  .  .      ... .

Spermophilus_tridecemlineatus|706 ATAGTAAAGTGCATGAGGAATAAATCTGCATATTTTGCTGAAAGGCTTTATAAATCTATG
Ochotona_princeps|2200            ATAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|8724           ATAGTAAAGTGTATGAGGAACAAATCTGCGTATTTTGCTGAAAGGCTTTATAAATCGATG
Tarsius_syrichta|11655            ATAGTAAAATGCATGAGGAACAAATCTGCATACTTTGCTGAAAGACTTTATAAATCCATG
Cavia_porcellus|14761             ATTGTAAAGTGCATGAGGAACAAATCTGCATATTTTGCTGAAAGGCTTTATAAATCTATG
Rattus_norvegicus|25577           ATAGTGAAGTGCATGAGGAATAAACCTGCCTATTTTGCTGAAAGGCTTTATAAATCCATG
Mus_musculus|36010                ATAGTGAAGTGCATGCGGAGTAAACCTTCATATTTCGCTGAGAGACTTTATAAATCCATG
Tupaia_belangeri|11989            ATAGTAAAGTGCATGAGGAACAAACCTGCATATTTTGCTGAACGGCTTTATAAATCCATG
Callithrix_jacchus|15968          ATAGTAAAGTGCATAAGGAACAAATCTGCATATTTTGCTGAAAAGCTTTATAAATCGATG
Gorilla_gorilla|1049              ATAGTAAAGTGCATGAGGAACAAATCTGCATATTTTGCTGAAAAGCTCTATAAATCGATG
Homo_sapiens|44459                ATAGTAAAGTGCATGAGGAACAAATCTGCATATTTTGCTGAAAAGCTCTATAAATCGATG
Pan_troglodytes|23742             ATAGTAAAGTGCATGAGGAACAAATCTGCATATTTTGCTGAAAAGCTCTATAAATCAATG
Dipodomys_ordii|15392             NNNNTAAAGTGTATGAGGAATAAA---GCATACTTTGCTGAGAGGCTTTATAAATCTATG
Microcebus_murinus|12912          NNNNTTAAGTGTATGAGGAACAAATCTGCATATTTTGCTGAAAGGCTTTATAAATCGATG
                                   . ..    ..  .  ..            .  .. . ..      . . .   .   ..

Spermophilus_tridecemlineatus|706 AAGGGCTTGGGCACTGATGATGACACCCTTATTAGAGTGATGGTTTCTCGAGCAGAGATT
Ochotona_princeps|2200            NNNGGCTTGGGCACCGACGACAACACCCTCATCCGCGTGATGGTGTCGCGAGCGGAGGTC
Otolemur_garnettii|8724           AAGGGCTTGGGCACAGATGACAACACCCTCATTAGAGTGATGGTATCTCGAGCAGAGATT
Tarsius_syrichta|11655            AAGGGCTTGGGCACCGATGATAACACCCTCATCAGAGTGATGGTTTCTCGAGCAGAGATT
Cavia_porcellus|14761             AAGGGCTTGGGCACCGACGACAGCACCCTCATCAGAGTGATGGTTTCCCGAGCAGAGATT
Rattus_norvegicus|25577           AAGGGCTTAGGCACTGACGACAGCACCCTCATCAGAGTGATGGTGTCTCGAGCAGAGATT
Mus_musculus|36010                AAGGGCTTAGGCACTGATGACAACACCCTCATCAGAGTGATGGTCTCAAGAGCAGAGATT
Tupaia_belangeri|11989            AAGGGCTTGGGTACCGATGATAACACTCTCATTAGAGTGATGGTTTCTCGAGCAGAAATT
Callithrix_jacchus|15968          AAGGGCTTGGGCACCGATGATAACACCCTCATCAGAGTGATGGTTTCTCGGGCAGAAATT
Gorilla_gorilla|1049              AAGGGCTTGGGCACCGATGATAACACCCTCATCAGAGTGATGGTTTCTCGAGCAGAAATT
Homo_sapiens|44459                AAGGGCTTGGGCACCGATGATAACACCCTCATCAGAGTGATGGTTTCTCGAGCAGAAATT
Pan_troglodytes|23742             AAGGGCTTGGGCACCGATGATAACACCCTCATCAGAGTGATGGTTTCTCGAGCAGAAATT
Dipodomys_ordii|15392             AAGGGCTTGGGCACGGATGATAGCACCCTCATCAGAGTGATGGTTTCCCGTGCAGAGATT
Microcebus_murinus|12912          AAGGGCTTGGGCACGGATGATAACACCCTCATCCGAGTGATGGTTTCTCGAGCAGAGATT
                                    .*****.** ** ** ** ..*** ** ** .*.******** ** .* **.**..* 

Spermophilus_tridecemlineatus|706 GACATGCTGGACATCCGGGCAAATTTCAAGAGGCTCTATGGAAAGTCTCTGTACTCTTTT
Ochotona_princeps|2200            GACATGCTGGACATCCGGGCCAACTTCAAGAGGCTCTATGGAAAGTCTCTGTACTCGTTC
Otolemur_garnettii|8724           GACATGATGGATATCCGGGAGCACTTCAAGAGGCTCTATGGAAAGTCTCTGTACTCTTTC
Tarsius_syrichta|11655            GACATGCTGGACATCCGGGCACATTTCAAGAGGCTCTATGGAAAGTCTCTGTACTCGTTC
Cavia_porcellus|14761             GACATGCTGGACATCCGAGAAAACTTCAAGAGGCTCTATGGAAAGTCTCTGTACTCTTTC
Rattus_norvegicus|25577           GACATGCTGGACATCCGGGCAAACTTCAAGAGGCTCTACGGGAAGTCTTTGTACTCTTTT
Mus_musculus|36010                GACATGCTGGACATCCGGGCGAGCTTCAAGAGGCTCTACGGGAAGTCTTTGTACTCTTTC
Tupaia_belangeri|11989            GACATGTTGGATATCCGGGCCAACTTCAAGAGGCTCTATGGAAAGTCTCTGTACTCCTTC
Callithrix_jacchus|15968          GACATGCTGGATATCCGGGCACACTTCAAGAGACTCTATGGAAAGTCTCTGTACTCATTC
Gorilla_gorilla|1049              GACATGTTGGATATCCGGGCACACTTCAAGAGACTCTATGGAAAGTCTCTGTACTCGTTC
Homo_sapiens|44459                GACATGTTGGATATCCGGGCACACTTCAAGAGACTCTATGGAAAGTCTCTGTACTCGTTC
Pan_troglodytes|23742             GACATGTTGGATATCCGGGCACACTTCAAGAGACTCTATGGAAAGTCTCTGTACTCGTTC
Dipodomys_ordii|15392             GACATGCTGGACATCCGGGCAAATTTCAAGAGGCTCTANNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|12912          GACATGATGGACATCCGGGCACACTTCAAGAGGCTCTATGGAAAGTCTCTGTACTCTTTC
                                  ****** **** *****.*. .. ********.***** ..   .. . ...  .  .. 

Spermophilus_tridecemlineatus|706 ATCAAGGGTGACACATCTGGAGACTACAGGAAAGTACTGCTCATTCTCTGTGGAGGAGAT
Ochotona_princeps|2200            ATCAAGGGTGACACATCCGGGGACTACAGGAAGGTGCTGCTTGCTCTCTGTGGAGGAGAA
Otolemur_garnettii|8724           ATCAAG------------------------------------------------------
Tarsius_syrichta|11655            ATCAAGGGCGACACGTCCGGAGACTACAGAAAAGTCCTGCTCATTCTTTGTGGAGGAGAT
Cavia_porcellus|14761             ATCAAGGGTGACACATCTGGAGACTACAGGAAGGTACTGCTCGCTCTCTGTGGAGGAGAT
Rattus_norvegicus|25577           ATCAAGGGCGACACTTCTGGAGACTACAGGAAGGTTCTGCTCATTCTCTGTGGAGGAGAT
Mus_musculus|36010                ATCAAGGGTGACACTTCCGGAGACTACAGGAAGGTTCTGCTCGTTCTCTGTGGAGGAGAT
Tupaia_belangeri|11989            ATTAAGGGTGACACATCGGGAGACTACAGGAAGGTACTGCTCGTGCTCTGTGGAGGAGAT
Callithrix_jacchus|15968          ATCAAGGGTGACACATCCGGAGACTACAGGAAAGTACTGCTTGTTCTCTGTGGAGGAGAT
Gorilla_gorilla|1049              ATCAAGGGTGATACATCTGGAGACTACAGGAAAGTACTGCTTGTTCTCTGTGGAGGAGAT
Homo_sapiens|44459                ATCAAGGGTGACACATCTGGAGACTACAGGAAAGTACTGCTTGTTCTCTGTGGAGGAGAT
Pan_troglodytes|23742             ATCAAGGGTGACACATCTGGAGACTACAGGAAAGTACTGCTTGTTCTCTGTGGAGGAGAT
Dipodomys_ordii|15392             NNNNNNGGTGACACCTCAGGAGACTACAGGAAAGTCCTGCTCATTCTCTGCGGAGGAGAT
Microcebus_murinus|12912          ATCAAG------------------------------------------------------
                                   .   .                                                      

Spermophilus_tridecemlineatus|706 GATTAA
Ochotona_princeps|2200            GATTAG
Otolemur_garnettii|8724           ------
Tarsius_syrichta|11655            GATTAA
Cavia_porcellus|14761             GATTAA
Rattus_norvegicus|25577           GATTAA
Mus_musculus|36010                GATTAA
Tupaia_belangeri|11989            GATTAA
Callithrix_jacchus|15968          GATTAA
Gorilla_gorilla|1049              GATTAA
Homo_sapiens|44459                GATTAA
Pan_troglodytes|23742             GATTAA
Dipodomys_ordii|15392             GATTAG
Microcebus_murinus|12912          ------
                                        

multiple sequence alignment in CLUSTALW format


Spermophilus_tridecemlineatus|637 VAMATKGGTIKAASGFNAVEDAQTLRKAMKGLGTDEDAIIGVLAYRNTAQRQEIRTAYKS
Ochotona_princeps|1920            MAMASKGGTVKAASGFSAAEDAQVLRKAMKGLGTDEDAIIQVLAYRSTAQRQEIRTTYKS
Otolemur_garnettii|7529           MAMASKGGTIKAASGFNAAEDAQSLRKAMKGLGTDEDAIIRVLAYRNTAQRQEIRTAYKT
Tarsius_syrichta|10680            ---------------------------------TDEDAIISVLAYRNTAQRQEIRTAYKS
Cavia_porcellus|11557             CTQATKGGTVKAASGFNAIEDAQALRKAMKGLGTDEDAIIRVLAYRSTAQRQEIRTAYKT
Rattus_norvegicus|6255            --METKGGTVKAASGFNATEDAQVLRKAMKGLGTDEDAIIGVLACRNTAQRQEIRTAYKS
Mus_musculus|33057                --MEAKGGTVKAASGFNATEDAQTLRKAMKGLGTDEDAIIGILAYRNTAQRQEIRSAYKS
Tupaia_belangeri|10375            MAMASKGGTIKAASGFNAVEDAQSLRKAMKGLGTDEDGIIKVLAYRNTAQRQEIRTAYKT
Callithrix_jacchus|8589           --MATKGGTVKAASGFNAAEDAQTLRKAMKGLGTDEDAIISILAYRNTAQRQEIRTAYKS
Gorilla_gorilla|999               --MATKGGTVKAASGFNAVEDAQTLRKAMKGLGTDEDAIVSVLAYRNTAQRQEIRTAYKS
Homo_sapiens|68692                MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKS
Pan_troglodytes|14865             MAMATKGGTVKAASGFNAVEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKS
Dipodomys_ordii|14470             ---------------------------------TDEDAIIRVLAYRNTAQRQEIRTAYKT
Microcebus_murinus|10926          MAMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTDEDAIIRVLAYRSTAQRQEIRTAYKT
                                                                   ****.*: :** *.********::**:

Spermophilus_tridecemlineatus|637 NIGRDLMDDLKSELSGKFEQVIIGMMTPTVLYDVQELRKAMKXXXXXXXXXXXXXXXXXX
Ochotona_princeps|1920            TIGKDLIDDLKSELSGNFEQVILGLMTPTLLYDVQELRKAMKGAGTDEGCLIEILASRTP
Otolemur_garnettii|7529           TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGAGTDEGCLIEILASRTP
Tarsius_syrichta|10680            TIGRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGAGTDEGCLIEILASRTP
Cavia_porcellus|11557             TIGRELIDDLKSELSGNFEQVIIGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTP
Rattus_norvegicus|6255            TIGRDLLEDLKSELSSNFEQVILGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRNP
Mus_musculus|33057                TIGRDLIEDLKSELSSNFEQVILGLMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTP
Tupaia_belangeri|10375            NIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRSP
Callithrix_jacchus|8589           TIGRDLIDDLKSELSGNFEQVIVGMMMPTVLYDVQELRRAMKGAGTDEGCLIEILASRTP
Gorilla_gorilla|999               TIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTP
Homo_sapiens|68692                TIGRDLIDDLKSELSGNFEQ----------------------GAGTDEGCLIEILASRTP
Pan_troglodytes|14865             TIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTP
Dipodomys_ordii|14470             TIGRDLMDDLKSELSGNFEQVIIGMMTPTLLYDVQELRRAMKGAGTDEGCLIEILASRTP
Microcebus_murinus|10926          TIGRDLIDDLKSELSGNFEQTIVALMTPTVLYDVQELHRAMKGAGTDEGCLIEILASRTP
                                  .                                                           

Spermophilus_tridecemlineatus|637 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGRDEGNFLDDALMKQDAQDL
Ochotona_princeps|1920            EEIRRINQTYQQQYGQSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDDLMRQDAQXX
Otolemur_garnettii|7529           EEIRRISQTYQQHYGRSLEEDICSDTSFMFQRVLVSLSAGGRDEGNFLDDALMKQDAQDL
Tarsius_syrichta|10680            DEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNHLDDALMRQDAQDL
Cavia_porcellus|11557             EEIHRIKQTYQIQYGRSLEDDICSDTSFMFQRVLVSLSAGGRDQGNYLDDGLVKQDAKDL
Rattus_norvegicus|6255            EEIRRINQTYQQQYGRSLEEDICSDTSFMFQRVLVSLTAGGRDEGNYLDDALVKQDAQDL
Mus_musculus|33057                EEIRRINQTYQQQYGRSLEEDICSDTSFMFQRVLVSLSAAGRDEGNYLDDALMKQDAQEL
Tupaia_belangeri|10375            EEIQRINQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDGGNF-PEALVRQDAQDL
Callithrix_jacchus|8589           EEIRRISQTYQQQYGRSLEDDICSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDL
Gorilla_gorilla|999               EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDL
Homo_sapiens|68692                EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDL
Pan_troglodytes|14865             EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDL
Dipodomys_ordii|14470             EEIRLINQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDGGNYLNDDLMRQDAQEL
Microcebus_murinus|10926          EEIRRINQIYQQQYGRSLEDDICSDTSFMFQRVLVSLSAGGRDEGNQLDDDLVRQDAQDL
                                                                         .*** **   : *::***:  

Spermophilus_tridecemlineatus|637 YEAGEQRWGTDEVKFLSVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGHFEDALLA
Ochotona_princeps|1920            XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDEYKRISQKDIEQSIKSETS-SFEDA-LA
Otolemur_garnettii|7529           YKAGEQRWGTDEVKFLTILCSRNRNHLLHVFDEYKRMSQKDIEQSIKSETSGSFEDALLA
Tarsius_syrichta|10680            YEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLA
Cavia_porcellus|11557             YDAGEKRWGTDEVKFLTILCSRNRNHLLHVFDEYKRISKKDIEQSIKSETSGSFEDALLA
Rattus_norvegicus|6255            YEAGEKRWGTDEVKFLSILCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLA
Mus_musculus|33057                YEAGEKRWGTDEVKFLSILCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLA
Tupaia_belangeri|10375            YEAGEKKWGTDEVKFLTILCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLA
Callithrix_jacchus|8589           YEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLA
Gorilla_gorilla|999               YEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLA
Homo_sapiens|68692                YEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLA
Pan_troglodytes|14865             YEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLA
Dipodomys_ordii|14470             YEAGEKKWGTDEVKFLTILCSRNRNHLLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Microcebus_murinus|10926          YEAGEKKWGTDEVKFLTVLCSRNRNHLLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                                                                                              

Spermophilus_tridecemlineatus|637 IVKCMRNKSAYFAERLYKSMKGLGTDDDTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSF
Ochotona_princeps|1920            IXXXXXXXXXXXXXXXXXXXXGLGTDDNTLIRVMVSRAEVDMLDIRANFKRLYGKSLYSF
Otolemur_garnettii|7529           IVKCMRNKSAYFAERLYKSMKGLGTDDNTLIRVMVSRAEIDMMDIREHFKRLYGKSLYSF
Tarsius_syrichta|10680            IVKCMRNKSAYFAERLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSF
Cavia_porcellus|11557             IVKCMRNKSAYFAERLYKSMKGLGTDDSTLIRVMVSRAEIDMLDIRENFKRLYGKSLYSF
Rattus_norvegicus|6255            IVKCMRNKPAYFAERLYKSMKGLGTDDSTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSF
Mus_musculus|33057                IVKCMRSKPSYFAERLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRASFKRLYGKSLYSF
Tupaia_belangeri|10375            IVKCMRNKPAYFAERLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSF
Callithrix_jacchus|8589           IVKCIRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSF
Gorilla_gorilla|999               IVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSF
Homo_sapiens|68692                IVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSF
Pan_troglodytes|14865             IVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSF
Dipodomys_ordii|14470             XXKCMRNK-AYFAERLYKSMKGLGTDDSTLIRVMVSRAEIDMLDIRANFKRLXXXXXXXX
Microcebus_murinus|10926          XXKCMRNKSAYFAERLYKSMKGLGTDDNTLIRVMVSRAEIDMMDIRAHFKRLYGKSLYSF
                                                       ******.***********:**:***  ****        

Spermophilus_tridecemlineatus|637 IKGDTSGDYRKVLLILCGGDD
Ochotona_princeps|1920            IKGDTSGDYRKVLLALCGGED
Otolemur_garnettii|7529           IK-------------------
Tarsius_syrichta|10680            IKGDTSGDYRKVLLILCGGDD
Cavia_porcellus|11557             IKGDTSGDYRKVLLALCGGDD
Rattus_norvegicus|6255            IKGDTSGDYRKVLLILCGGDD
Mus_musculus|33057                IKGDTSGDYRKVLLVLCGGDD
Tupaia_belangeri|10375            IKGDTSGDYRKVLLVLCGGDD
Callithrix_jacchus|8589           IKGDTSGDYRKVLLVLCGGDD
Gorilla_gorilla|999               IKGDTSGDYRKVLLVLCGGDD
Homo_sapiens|68692                IKGDTSGDYRKVLLVLCGGDD
Pan_troglodytes|14865             IKGDTSGDYRKVLLVLCGGDD
Dipodomys_ordii|14470             XXGDTSGDYRKVLLILCGGDD
Microcebus_murinus|10926          IK-------------------