Orthologs Set ID: EOG4003HJ


Orthology Database
OrthoDB4
Gene Symbol(s)
FAIM2

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 27573 15, 214, 318, 383, 437, 488, 528, 566, 654, 750, 804
Cavia porcellus 24222 15, 214, 318, 383, 437, 488, 528, 566, 654, 750, 804
Dipodomys ordii 14643 214, 318, 330, 383, 437, 488, 528, 566, 654, 750, 804
Gorilla gorilla 26260 15, 214, 318, 383, 437, 488, 528, 566, 654, 750, 804
Homo sapiens 21309 15, 214, 318, 383, 437, 488, 528, 566, 654, 750, 804
Microcebus murinus 16747 15, 214, 318, 383, 437, 488, 528, 566, 654, 672, 725, 748, 750
Mus musculus 14691 15, 214, 318, 383, 437, 488, 528, 566, 654, 750, 804
Ochotona princeps 1523 214, 318, 383, 437, 488, 528, 537, 566, 654, 750
Oryctolagus cuniculus 15482 15, 214, 318, 383, 437, 488, 528, 566, 654, 750, 804
Pan troglodytes 9173 15, 214, 318, 383, 437, 488, 528, 566, 654, 750, 804
Rattus norvegicus 32863 15, 214, 318, 383, 437, 488, 528, 566, 654, 750, 804
Tarsius syrichta 1190 437, 488, 528, 566, 654, 750, 804
Tupaia belangeri 12184 15, 214, 318, 383, 437, 488, 528, 566, 654, 750, 804

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 27573 ENSCJAT00000045564 100398146 ENSCJAG00000021045 FAIM2 calJac3
Cavia porcellus 24222 ENSCPOT00000009785 100722287 ENSCPOG00000009698 FAIM2 cavPor3
Dipodomys ordii 14643 ENSDORT00000005952 ENSDORG00000005952 Faim2 dipOrd1
Gorilla gorilla 26260 ENSGGOT00000025116 101126235 ENSGGOG00000006671 FAIM2 gorGor3
Homo sapiens 21309 ENST00000320634, NM_012306 23017 ENSG00000135472 FAIM2 hg19,GRCh37
Microcebus murinus 16747 ENSMICT00000015592 ENSMICG00000015588 FAIM2 micMur1
Mus musculus 14691 ENSMUST00000023750, NM_028224 72393 ENSMUSG00000023011 Faim2 mm9
Ochotona princeps 1523 ENSOPRT00000013822 ENSOPRG00000013828 FAIM2 OchPri2.0
Oryctolagus cuniculus 15482 ENSOCUT00000011474 100350155 ENSOCUG00000011476 FAIM2 oryCun2.0
Pan troglodytes 9173 ENSPTRT00000009090 451885 ENSPTRG00000004917 FAIM2 panTro2
Rattus norvegicus 32863 ENSRNOT00000048934, NM_144756 246274 ENSRNOG00000029015 Faim2 rn4
Tarsius syrichta 1190 ENSTSYT00000014045 ENSTSYG00000014045 FAIM2 tarSyr1
Tupaia belangeri 12184 ENSTBET00000012185 ENSTBEG00000012184 FAIM2 tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 19638 ENSCJAP00000048315 100398146 ENSCJAG00000021045 FAIM2 calJac3
Cavia porcellus 19197 ENSCPOP00000008704 100722287 ENSCPOG00000009698 FAIM2 cavPor3
Dipodomys ordii 13760 ENSDORP00000005574 ENSDORG00000005952 Faim2 dipOrd1
Gorilla gorilla 20454 ENSGGOP00000024988 101126235 ENSGGOG00000006671 FAIM2 gorGor3
Homo sapiens 45783 ENSP00000321951 23017 ENSG00000135472 FAIM2 hg19,GRCh37
Microcebus murinus 14205 ENSMICP00000014209 ENSMICG00000015588 FAIM2 micMur1
Mus musculus 33460 ENSMUSP00000023750 72393 ENSMUSG00000023011 Faim2 mm9
Ochotona princeps 1325 ENSOPRP00000012610 ENSOPRG00000013828 FAIM2 OchPri2.0
Oryctolagus cuniculus 23596 ENSOCUP00000009868 100350155 ENSOCUG00000011476 FAIM2 oryCun2.0
Pan troglodytes 20858 ENSPTRP00000008400 451885 ENSPTRG00000004917 FAIM2 panTro2
Rattus norvegicus 7009 ENSRNOP00000039775 246274 ENSRNOG00000029015 Faim2 rn4
Tarsius syrichta 1089 ENSTSYP00000012891 ENSTSYG00000014045 FAIM2 tarSyr1
Tupaia belangeri 10554 ENSTBEP00000010551 ENSTBEG00000012184 FAIM2 tupBel1

multiple sequence alignment in CLUSTALW format


Tarsius_syrichta|1190       ------------------------------------------------------------
Ochotona_princeps|1523      ---------------CTCTCCGTGGCTAACAAGGCCCCCGGGACCGAGGGGCAGCAG---
Microcebus_murinus|16747    ATGACCCAGGGCAAGCTCTCCGTGGCTAACAAGGCCCCTGGGACTGAGGGGCAGCAG---
Dipodomys_ordii|14643       ---------------CTCTCCGTGGCTAACAAGGCCCCTGGGACGGAGGGGCAGCAG---
Mus_musculus|14691          ATGACCCAGGGAAAGCTCTCTGTGGCTAACAAGGCCCCCGGGACTGAGGGGCAGCAGCAC
Rattus_norvegicus|32863     ATGACCCAGGGAAAGCTCTCTGTGGCTAACAAGGCCCCTGGGACTGAGGGGCAGCAG---
Oryctolagus_cuniculus|15482 CTAGCCCAGCCCAAGCTCTCCGTGGCTAACAAGGCCCCCGGGACCGAAGGGCAGCAG---
Callithrix_jacchus|27573    ATGACCCAGGGAAAGCTCTCCGTGGCTAACAAGGCCCCCGGGACTGAGGGGCAGCAG---
Gorilla_gorilla|26260       ATGACCCAGGGAAAGCTCTCCGTGGCTAACAAGGCCCCTGGGACCGAGGGGCAGCAG---
Homo_sapiens|21309          ATGACCCAGGGAAAGCTCTCCGTGGCTAACAAGGCCCCTGGGACCGAGGGGCAGCAG---
Pan_troglodytes|9173        ATGACCCAGGGAAAGCTCTCCGTGGCTAACAAGGCCCCTGGGACCGAGGGGCAGCAG---
Cavia_porcellus|24222       ATGACCCAAGGAAAGCTCTCCGTGGCTAACAAGGCTCCTGGGACCGAGGGGCAGCAG---
Tupaia_belangeri|12184      ATGACCCAGGGAAAGCTCTCCGTGGCAAACAAGACCCCTGGGACTGAGGGGCAGCAG---
                                                                                        

Tarsius_syrichta|1190       ------------------------------------------------------------
Ochotona_princeps|1523      CAGGCACATGGCGAG---AAGGAGGCTCCAGCAGTGCCCTCGGCCCCACCCTCCTACGAA
Microcebus_murinus|16747    CAGGTGAATAGCGAGAAGAAGGAGGTTCCGGCAGTGCCCTCGGCCCCGCCCTCTTATGAG
Dipodomys_ordii|14643       CAGGCCAATGGTGAGAAGAAGGAGACTCCGGCAGTGCCCTCGGCCCCACCCTCCTATGAG
Mus_musculus|14691          CAGGCAAATGGAGAGAAGAAGGATGCTCCGGCAGTGCCCTCGGCGCCACCCTCCTATGAG
Rattus_norvegicus|32863     CAGGCAAATGGAGAGAAGAAGGATGCCCCAGCAGTGCCCTCGGCACCACCCTCCTACGAG
Oryctolagus_cuniculus|15482 CAGGCGCAGGGGGAGAAGAAGGAGACTCCGGCTGTGCCCTCGGCCCCGCCCTCCTACGAA
Callithrix_jacchus|27573    CAGGCACATGGCGAGAAGAAGGAGGCTCCAGCAGTGCCCTCAGCCCCACCCTCCTATGAG
Gorilla_gorilla|26260       CAGGTGCATGGCGAGAAGAAGGAGGCTCCAGCAGTGCCCTCAGCCCCACCCTCCTATGAG
Homo_sapiens|21309          CAGGTGCATGGCGAGAAGAAGGAGGCTCCAGCAGTGCCCTCAGCCCCACCCTCCTATGAG
Pan_troglodytes|9173        CAGGTGCATGGCGAGAAGAAGGAGGCTCCAGCAGTGCCCTCAGCCCCACCCTCCTATGAG
Cavia_porcellus|24222       CAGGCGAATGCTGAGAAGAAGGAGACTGTGGCAGTGCCCTCGGCCCCACCCTCTTATGAG
Tupaia_belangeri|12184      CAGGCGAATGGTGAGAAGAAGGAGGCTCCAGCAGTGCCCTCGGCCCCACCCTCCTATGAA
                                                                                        

Tarsius_syrichta|1190       ------------------------------------------------------------
Ochotona_princeps|1523      GAGGCCACCTCTGGGGAGGGGCTGAAGGCAGGAGCCTTCCCTCCAGCCCCCACGGCTGTG
Microcebus_murinus|16747    GAGGCCACCTCTGGGGAGGGGCTGAAGTCAGGGGCCTTCCCCGCCGCACCCACGGCTCTG
Dipodomys_ordii|14643       GAGGCCACCTCTGGGGAGGGGCTGAAGGCTGGGGCCTTCCCCCCAGCCCCCACGGCTGTG
Mus_musculus|14691          GAGGCCACCTCTGGAGAGGGGCTGAAGGCAGGGACCTTCCCCCAGGGCCCAACAGCTGTG
Rattus_norvegicus|32863     GAGGCCACCTCTGGAGAGGGGCTGAAGGCAGGGGCCTTCCCCCAGGGTCCCACAGCTGTA
Oryctolagus_cuniculus|15482 GAGGCCACCTCTGGGGAGGGGCTGAAGGCAGGGGCCTTCCCCCCAACCTCCACAGCTGTG
Callithrix_jacchus|27573    GAGGCCACCTCTGGGGAGGGGATGAAGGCAGGGGCTTTCCCCCCAGCCCCCTCGGCAGTA
Gorilla_gorilla|26260       GAAGCCACCTCTGGGGAGGGGATGAAGGCAGGGGCCTTCCCCCCAGCCCCCACAGCGGTG
Homo_sapiens|21309          GAAGCCACCTCTGGGGAGGGGATGAAGGCAGGGGCCTTCCCCCCAGCCCCCACAGCGGTG
Pan_troglodytes|9173        GAAGCCACCTCTGGGGAGGGGATGAAGGCAGGGGCCTTCCCCCCAGCCCCCACAGCGGTG
Cavia_porcellus|24222       GAAGCCACCTCGGGAGAGGGGTTAAAGGCAGGAGCCTTCCCTCCGGTCCCCACAGCTGTG
Tupaia_belangeri|12184      GAGGCCACCTCTGGGGAGGGGCTGAAGGCAGGGGCCTTCCCTCCGGCCCCCACAGCTGTA
                                                                                        

Tarsius_syrichta|1190       ------------------------------------------------------------
Ochotona_princeps|1523      CCTCTCCACCCCAGCTGGGCCTACGTGGACCCCAGCAGCAGCTCCAGCTATGACCGCGGT
Microcebus_murinus|16747    CCTCTCCACCCAAGCTGGGCCTATGTGGACCCCAGCGGCAGTTCCGGCTATGACAACGGT
Dipodomys_ordii|14643       CCTCTCCACCCAAGCTGGGCCTATGTGGATCCCAGCAGCAGCTCCAGTTATGACAGTGGT
Mus_musculus|14691          CCACTCCATCCAAGCTGGGCCTACGTGGACCCCAGCGGCAGCTCCGGCTATGAAGGTGGT
Rattus_norvegicus|32863     CCACTCCATCCAAGCTGGGCCTATGTGGACCCCAGCAGCAGCTCTGGCTATGAAGGTGGT
Oryctolagus_cuniculus|15482 CCTCTCCACCCCAGCTGGGCCTACGTGGACCCCAGCAGCAGCTCCAGCTATGACCGCGGA
Callithrix_jacchus|27573    CCTCTCCACCCAAGCTGGGCCTATGTGGACCCCAGCAGCAGCTCCAGCTACGACAACGGT
Gorilla_gorilla|26260       CCTCTCCACCCTAGCTGGGCCTATGTGGACCCCAGCAGCAGCTCCAGCTATGACAACGGT
Homo_sapiens|21309          CCTCTCCACCCTAGCTGGGCCTATGTGGACCCCAGCAGCAGCTCCAGCTATGACAACGGT
Pan_troglodytes|9173        CCTCTCCACCCTAGCTGGGCCTATGTGGACCCCAGCAGCAGCTCCAGCTATGACAACGGT
Cavia_porcellus|24222       CCTCTCCACCCGAGCTGGGCCTATGTGGACCCTAGCGGCAGCTCCTCCTATGACAACCGT
Tupaia_belangeri|12184      CCTCTCCACCCAAGCTGGGCCTATGTGGACCCGAGCAGCAGCTCCAGCTACGAGAGCGGC
                                                                                        

Tarsius_syrichta|1190       ------------------------------------------------------------
Ochotona_princeps|1523      TTCCCCACCGGACACCATGAACTCTTCTCCACCTTCAGCTGGGATGACCAGAAAGTTCGC
Microcebus_murinus|16747    TTCCCCACAGGAGACCATGAGCTCTTCACCACCTTCAGTTGGGACGACCAGAAGGTTCGG
Dipodomys_ordii|14643       TTCCCCACCGGACATCATGAACTCTTCTCCACCTTCAGCTGGGATGACCAGAAAGTTCGC
Mus_musculus|14691          TTCCCCGCAGGACATCACGAGCATTTCACCACCTTCAGCTGGGATGACCAGAAAGTTCGT
Rattus_norvegicus|32863     TTCCCTGCAGGACACCATGAGCTTTTCAGCACCTTCAGCTGGGATGACCAGAAAGTTCGT
Oryctolagus_cuniculus|15482 TTCTCCACTGGACACCATGAACTCTTCACCACCTTCAGCTGGGACGACCAGAAAGTCCGC
Callithrix_jacchus|27573    TTCCCCACTGGAGAGCATGAGCTCTTCACCACTTTCAGCTGGGACGACCAGAAAGTTCGT
Gorilla_gorilla|26260       TTCCCCACCGGAGACCATGAGCTCTTCACCACTTTCAGCTGGGATGACCAGAAAGTTCGT
Homo_sapiens|21309          TTCCCCACCGGAGACCATGAGCTCTTCACCACTTTCAGCTGGGATGACCAGAAAGTTCGT
Pan_troglodytes|9173        TTCCCCACCGGAGACCATGAGCTCTTCACCACTTTCAGCTGGGATGACCAGAAAGTTCGT
Cavia_porcellus|24222       TTCCCCACTGGACACCATGAACTTTTCACCACCTACAGTTGGGATGACCAGAAAGTTCGC
Tupaia_belangeri|12184      TTCCCCACTGGGCACCATGAGCTCTTCACCACCTTCAGCTGGGACGACCAGAAAGTCCGC
                                                                                        

Tarsius_syrichta|1190       ------------------------------------------------------------
Ochotona_princeps|1523      CGAGTCTTCATCAGAAAGGTCTATACCATCCTGCTCATCCAGCTGCTGGTGACTTTGGCT
Microcebus_murinus|16747    CGAGTCTTTGTCAGAAAGGTCTACACCATCCTGCTGATCCAGCTGCTGATGACTGTGAGC
Dipodomys_ordii|14643       CGTGTCTTCATCAGAAAGGTCTATACCATC---CTGATCCAGTTACTGGTGACCTTGGGT
Mus_musculus|14691          CGGCTCTTCATCAGAAAGGTCTATACCATCCTATTGGTCCAGCTGCTGGTGACCTTGGCT
Rattus_norvegicus|32863     CAGCTTTTCATCAGAAAGGTCTATACCATCCTGTTGGTTCAGCTGCTGGTGACCTTGGCT
Oryctolagus_cuniculus|15482 CGCGTCTTTATCAGAAAGGTCTACACCATCCTGCTGATCCAGCTGCTGGTGACTTTGGGC
Callithrix_jacchus|27573    CGAGTCTTCATCAGAAAAGTCTACACCATCCTGCTGATCCAGCTGCTGGTGACCTTGGCT
Gorilla_gorilla|26260       CGAGTCTTCATCAGAAAGGTCTACACCATCCTGCTGATTCAGCTGCTGGTGACCTTGGCT
Homo_sapiens|21309          CGAGTCTTTGTCAGAAAGGTCTACACCATCCTGCTGATTCAGCTGCTGGTGACCTTGGCT
Pan_troglodytes|9173        CGAGTCTTCGTCAGAAAGGTCTACACCATCCTGCTGATTCAGTTGCTGGTGACCTTGGCT
Cavia_porcellus|24222       CGGGTTTTCATCAGAAAGGTCTACACTATCCTGCTTATCCAGCTGCTGGTGACCTTGGGT
Tupaia_belangeri|12184      CGAGTCTTCATCAGAAAGGTCTACACCATCCTGCTGATCCAGCTGCTGGTGACCTTGGGT
                                                                                        

Tarsius_syrichta|1190       ------------------------GACCCCGTTAAGGACTATGTCCAGGCCAACCCAGGC
Ochotona_princeps|1523      GTTGTGGCTCTCTTTACTTTCTGTGACCCGGTAAAAGACTATGTCCAGGCCAATCCAGGC
Microcebus_murinus|16747    ATTGTGTCTCTCTTTACCTTCTGTGACATCGTCAAGGAATATGTCCAGACCAACCCAGGC
Dipodomys_ordii|14643       GTTGTGGCTCTCTTTACCTTCTGTGACCCCGTTAAAGACTATGTCCAGGCCAATCCAGGC
Mus_musculus|14691          GTGGTGGCTCTCTTTACCTTCTGTGATGTCGTTAAGGACTATGTCCAGGCTAACCCCGGC
Rattus_norvegicus|32863     GTGGTGGCTCTCTTTACCTTCTGTGACGTCGTTAAGGACTATGTCCAGGCCAACCCAGGC
Oryctolagus_cuniculus|15482 GTCGTGGCTCTCTTTACCTTCTGTGACCCTGTGAAGGATTATGTTCAAGCCAATCCGGGC
Callithrix_jacchus|27573    GTCGTGGCTCTCTTTACCTTCTGTGACCCTGTCAAGGACTATGTCCAGGCCAACCCAGGC
Gorilla_gorilla|26260       GTCGTGGCTCTCTTTACTTTCTGTGACCCTGTCAAGGACTACGTCCAGGCCAACCCAGGC
Homo_sapiens|21309          GTCGTGGCTCTCTTTACTTTCTGTGACCCTGTCAAGGACTATGTCCAGGCCAACCCAGGC
Pan_troglodytes|9173        GTCGTGGCTCTCTTTACTTTCTGTGACCCTGTCAAGGACTATGTCCAGGCCAACCCAGGC
Cavia_porcellus|24222       ATCGTGGCTCTCTTTACCTTCTGTGACCCTGTGAAGAACTATGTCCAAGCCAACCCAGCC
Tupaia_belangeri|12184      GTCGTGGCTCTCTTTACCTTCTGTGACCCTGTTAAGGACTATGTCCAGGCCAACCCAGGA
                                                    **    ** **..* ** ** **..* ** ** * .

Tarsius_syrichta|1190       TGGTACTGGGCATCCTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|1523      TGGTACTGGGCATCCTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|16747    TGGTACTGGGCATCCTATGCCGTCTTCTTTGCAACCTACCTGACCCTGGCTTGCTGTACT
Dipodomys_ordii|14643       TGGTACTGGGCATCATATGCTGTGTTCTTCGCAACCTACTTGACCTTGGCTTGCTGTTCT
Mus_musculus|14691          TGGTACTGGGCGTCCTATGCCGTGTTCTTTGCAACTTACCTGACTCTGGCTTGCTGTTCT
Rattus_norvegicus|32863     TGGTACTGGGCATCCTATGCCGTATTCTTTGCAACATACCTGACTCTGGCTTGCTGTTCT
Oryctolagus_cuniculus|15482 TGGTACTGGGCGTCCTACGCTGTGTTCTTCGTCACCTATCTGACCCTGGCTTGCTGCTCT
Callithrix_jacchus|27573    TGGTACTGGGCATCCTATGCTGTGTTCTTTGCAACCTACCTGACCCTGGCTTGCTGTTCT
Gorilla_gorilla|26260       TGGTACTGGGCATCCTATGCTGTGTTCTTTGCAACCTACCTGACCCTGGCTTGCTGTTCT
Homo_sapiens|21309          TGGTACTGGGCATCCTATGCTGTGTTCTTTGCAACCTACCTGACCCTGGCTTGCTGTTCT
Pan_troglodytes|9173        TGGTACTGGGCATCCTATGCTGTGTTCTTTGCAACCTACCTGACCCTGGCTTGCTGTTCT
Cavia_porcellus|24222       TGGTACTGGGCATCCTATGCTGTGTTCTTTGCCACCTACCTGACTCTGGCTTGCTGTTCT
Tupaia_belangeri|12184      TGGTACTGGGCATCCTATGCTGTGTTTTTTGCAACCTACCTGACCCTGGCTTGCTGTTCT
                            ***********.**.** .  .. .. .. .     .   ..    ... ... ..   .

Tarsius_syrichta|1190       NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACCCTGTCCATG
Ochotona_princeps|1523      NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCTGTCCATG
Microcebus_murinus|16747    GGACCCAGGAGACACTTCCCCTGTAACCTGATTCTCTTGACCATCTTTACCCTGTCCATG
Dipodomys_ordii|14643       GGACCCAGGAGGCACTTTCCTTGGAACCTGATTCTGCTGACCGTCTTTNNNNNNNNNNNN
Mus_musculus|14691          GGACCCAGGAGACATTTCCCTTGGAACCTGATTCTGCTGACCATCTTTACCCTGTCCATG
Rattus_norvegicus|32863     GGGCCCAGGAGACACTTCCCTTGGAACCTGATTCTGCTGACCATCTTTACCCTGTCCATG
Oryctolagus_cuniculus|15482 GGACCCAGGAGGCACTTTCCATGGAACCTGATTCTTCTGACCGTGTTCACCCTGTCCATG
Callithrix_jacchus|27573    GGACCCAGGAGGCATTTCCCCTGGAACCTGATTCTCTTGACCGTCTTTACCCTGTCCATG
Gorilla_gorilla|26260       GGACCCAGGAGGCATTTCCCCTGGAACCTGATTCTCCTGACCGTCTTTACCCTGTCCATG
Homo_sapiens|21309          GGACCCAGGAGGCATTTCCCCTGGAACCTGATTCTCCTGACCGTCTTTACCCTGTCCATG
Pan_troglodytes|9173        GGACCCAGGAGGCATTTCCCCTGGAACCTGATTCTCCTGACCGTCTTTACCCTGTCCATG
Cavia_porcellus|24222       GGACCCAGGAGACACTTCCCCTGGAACCTGATCCTGCTGACCATCTTTACCCTGTCCATG
Tupaia_belangeri|12184      GGACCCAGGAGGCATTTCCCCTGGAACCTGATTCTCCTGACCATCTTTACCCTGTCCATG
                            ..     .. .    ..    ..     .. .  .  ..    . ..     ...   ..

Tarsius_syrichta|1190       GCCTACCTCACTGGGATGCTGTGCAGTTACTACAACACCACATCTGTGCTGCTGTGCCTG
Ochotona_princeps|1523      GCCTACCTCACCGGGATGTTGTCCAGCTACTACAACACCACATCTGTGCTGCTGTGCCTG
Microcebus_murinus|16747    TCCTACCTCACTGGGATGTTGTCCAGTTACTACAACACCAAATCTGTACTGCTGTGCCTG
Dipodomys_ordii|14643       NNNNNNNNNNNNNNNNNNNNNNNNNNTTACTACAACACCACCTCTGTGCTGCTGTGCCTG
Mus_musculus|14691          GCCTACCTCACTGGGATGCTGTCCAGTTACTACAACACCACATCTGTGCTGCTGTGCCTG
Rattus_norvegicus|32863     GCCTACCTCACTGGGATGCTGTCCAGTTACTACAACACCACGTCTGTCCTGCTGTGCCTG
Oryctolagus_cuniculus|15482 GCGTACCTCACTGGGATGCTGTCCAGCTACTACAACACCACATCTGTGCTGCTGTGCCTG
Callithrix_jacchus|27573    GCCTACCTCACTGGGATGCTGTCCAGCTACTACAACACCACCTCTGTGCTGCTGTGCCTG
Gorilla_gorilla|26260       GCCTACCTCACTGGGATGCTGTCCAGCTACTACAACACCACCTCCGTGCTGCTGTGCCTG
Homo_sapiens|21309          GCCTACCTCACTGGGATGCTGTCCAGCTACTACAACACCACCTCCGTGCTGCTGTGCCTG
Pan_troglodytes|9173        GCCTACCTCACTGGGATGCTGTCCAGCTACTACAACACCACCTCCGTGCTGCTGTGCCTG
Cavia_porcellus|24222       GCCTACCTCACTGGGATGCTGTCCAGTTACTACAACACCACATCTGTGCTGCTGTGCCTG
Tupaia_belangeri|12184      GCCTACCTCACTGGGATGCTGTCCAGTTACTACAACACCACGTCTGTGCTGCTGTGCCTG
                               .   .    ... .. ...   . *************. ** ** ************

Tarsius_syrichta|1190       GGTATCACGGCCTTTGTCTGCCTCTCAGTCACCATCTTCAGCTTCCAGACCAAGNNNNNN
Ochotona_princeps|1523      GGCATCACAGCCCTCGTCTGCCTCTCCGTCACCATCTTCAGCTTCCAGACCAAGTTTGAC
Microcebus_murinus|16747    AGCATCACGGCCCTCGTCTGCCTCTCGGTCACCATCTTCAGCTTCCAGACGAAGTTTGAC
Dipodomys_ordii|14643       GGAATCACGGCCCTTGTCTGCCTCTCAGTCACCGTCTTCAGCTTCCAGACCAAGTTTGAT
Mus_musculus|14691          GTCATCACGGCTCTCGTCTGCCTCTCGGTCACCATCTTCAGTTTCCAGACCAAGTTTGAC
Rattus_norvegicus|32863     GGCATCACAGCTCTTGTCTGCCTCTCAGTCACCATCTTCAGTTTCCAGACCAAGTTTGAC
Oryctolagus_cuniculus|15482 GGAATCACAGCCCTCGTCTGCCTCTCGGTCACCATCTTCAGCTTCCAGACCAAGTTTGAC
Callithrix_jacchus|27573    GGCATCACGGCCCTCGTCTGCCTCTCAGTCACCGTCTTCAGCTTCCAGACCAAGTTCGAC
Gorilla_gorilla|26260       GGCATCACGGCCCTTGTCTGCCTCTCAGTCACCGTCTTCAGCTTCCAGACCAAGTTCGAC
Homo_sapiens|21309          GGCATCACGGCCCTTGTCTGCCTCTCAGTCACCGTCTTCAGCTTCCAGACCAAGTTCGAC
Pan_troglodytes|9173        GGCATCACGGCCCTTGTCTGCCTCTCAGTCACCGTCTTCAGCTTCCAGACCAAGTTCGAC
Cavia_porcellus|24222       GGTATCACAGCCCTCGTCTGCCTTTCAGTCACGGTCTTCAGCTTCCAGACCAAGTTTGAC
Tupaia_belangeri|12184      GGCATCACGGCGCTCGTCTGCCTCTCAGTCACCGTCTTCAGCTTCCAGACCAAGTTTGAC
                            .  *****.**  * ******** ** ***** .******* ******** ***.. .  

Tarsius_syrichta|1190       NNNNNNNNNNNNNNNNGTGTGCTCTTCGTGTTGCTCATGACTCTTTTCTTCAGCGGACTC
Ochotona_princeps|1523      TTCACCTCCTGCCAGGGAGTGATCTTCGTGCTACTCATGACCCTTCTCTTCAGCGGACTT
Microcebus_murinus|16747    TTCACCTCCTGC---GGCGTGCTCTTCGTGCTGCTCATGACTCTATTCTTCAGCGGAATC
Dipodomys_ordii|14643       TTCACTTCCTGCCAGGGCGTGCTCTTCGTCCTGCTCATGACCCTCTTCTTCAGTGGCCTC
Mus_musculus|14691          TTCACCTCCTGTCAGGGTGTGCTGTTTGTGCTGCTCATGACCCTCTTCTTCAGTGGACTC
Rattus_norvegicus|32863     TTCACCTCCTGTCACGGTGTGCTATTTGTACTGCTCATGACTCTCTTCTTCAGTGGACTC
Oryctolagus_cuniculus|15482 TTCACCTCCTGCCAGGGCGTGATCTTCGTGCTGCTCATGACCCTTCTGTTCAGTGGACTC
Callithrix_jacchus|27573    TTCACCTCCTGCCAGGGTGTACTCTTCGTGCTGCTCATGACTCTTTTCTTCAGCGGACTC
Gorilla_gorilla|26260       TTCACCTCCTGCCAGGGCGTGCTCTTTGTGCTTCTCATGACTCTTTTCTTCAGCGGACTC
Homo_sapiens|21309          TTCACCTCCTGCCAGGGCGTGCTCTTCGTGCTTCTCATGACTCTTTTCTTCAGCGGACTC
Pan_troglodytes|9173        TTCACCTCCTGCCAGGGCGTGCTCTTCGTGCTTCTCATGACTCTTTTCTTCAGCGGACTC
Cavia_porcellus|24222       TTCACTTCCTGCCAGGGTGTGATCTTCGTGCTGCTCATGACCCTGTTCTTCAGCGGACTC
Tupaia_belangeri|12184      TTCACCTCCTGCCAGGGTGTGATCTTCGTGCTGCTCATGACTCTCCTCTTCAGCGGGCTC
                            ..    .  ..    .* **..* ** **  * ******** **  * ***** ** .* 

Tarsius_syrichta|1190       ATCCTAGCCATCCTCCTGCCCTTCCAATATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|1523      ATCCTAGCCATCATCCTGCCCTTCCAATATGTACCCTGGCTGCATGCAGTCTACGCTGTG
Microcebus_murinus|16747    ATCCTGGCCATCCTCCTGCCCTTCCAATATGTGCCCTGGCTCCACGCGGTCTACGCAGCA
Dipodomys_ordii|14643       ATCCTAGCTATCCTCCTGCCCTTCCAATATGTACCCTGGCTCCATGCAGTCTATGCCGTG
Mus_musculus|14691          CTCCTCGCTGTCCTCCTGCCCTTCCAATACGTCCCCTGGCTCCACGCGGTCTATGCTGTA
Rattus_norvegicus|32863     CTCCTCGCCATCCTCCTGCCCTTCCAATATGTCCCCTGGCTCCACGCCGTCTATGCTGTG
Oryctolagus_cuniculus|15482 ATCCTAGCCATCCTCCTGCCCTTCCAATATGTGCCCTGGCTCCATGCAATCTACGCAGTG
Callithrix_jacchus|27573    ATCCTGGCCATCCTCCTACCCTTCCAATATGTGCCCTGGCTCCATGCAGTCTACGCATCG
Gorilla_gorilla|26260       ATCCTGGCCATCCTCCTACCCTTCCAATATGTGCCCTGGCTCCATGCAGTCTATGCAGCA
Homo_sapiens|21309          ATCCTGGCCATCCTCCTACCCTTCCAATATGTGCCCTGGCTCCATGCAGTTTATGCAGCA
Pan_troglodytes|9173        ATCCTGGCCATCCTCCTACCCTTCCAATATGTGCCCTGGCTCCATGCAGTCTATGCAGCA
Cavia_porcellus|24222       ATCCTAGCCATCCTCCTACCCTTCCAATATGTGCCCTGGCTCCACGCAGTCTACGCAGTG
Tupaia_belangeri|12184      ATCCTCGCCATTCTCCTGCCCTTCCAATACGTGCCCTGGCTCCACGCAGTCTACGCCGTG
                            .**** ** .* .****.*********** ..    ... .    .   . .  .     

Tarsius_syrichta|1190       NNNNNNNNNNNNNNNNNNNNNNNNTTCCTGGCATTTGACACGCAGTTGCTGATGGGGAAC
Ochotona_princeps|1523      CTGGGAGCTGGTGTGTTTACACTG------------------------------------
Microcebus_murinus|16747    CTGGGAGCAGGCGTGTTTACATTG------------------------------------
Dipodomys_ordii|14643       CTAGGAGCAGGTGTATTTACGCTGTTCCTAGCATTTGACACACAGTTGCTGATGGGTAAC
Mus_musculus|14691          CTGGGAGCGGGTGTGTTCACGTTGTTCCTGGCCTTTGATACCCAGTTGCTGATGGGTAAC
Rattus_norvegicus|32863     CTAGGAGCGGGTGTGTTCACGTTGTTCCTGGCATTTGATACCCAGCTGCTGATGGGTAAC
Oryctolagus_cuniculus|15482 CTGGGAGCGGGCGTGTTTACGTTGTTCCTGGCATTTGACACCCAGTTGCTGATGGGTAAC
Callithrix_jacchus|27573    CTGGGAGCGGGTGTGTTTACATTGTTCCTGGCACTGGACACCCAGTTGCTGATGGGTAAC
Gorilla_gorilla|26260       CTGGGAGCGGGTGTATTTACATTGTTCCTGGCACTTGACACCCAGTTGCTGATGGGTAAC
Homo_sapiens|21309          CTGGGAGCGGGTGTATTTACATTGTTCCTGGCACTTGACACCCAGTTGCTGATGGGTAAC
Pan_troglodytes|9173        CTGGGAGCGGGTGTATTTACATTGTTCCTGGCACTTGACACCCAGTTGCTGATGGGTAAC
Cavia_porcellus|24222       TTAGGAGCGGGTGTGTTTACGTTGTTCCTGGCATTCGACACCCAGTTGCTGATGGGTAGC
Tupaia_belangeri|12184      CTGGGAGCAGGCGTGTTTACATTGTTCCTGGCATTTGACACCCAGTTGCTGATGGGTAGC
                             . .. .  .. .. ..     ..                                    

Tarsius_syrichta|1190       CGACGCCACTCGCTGAGCCCCGAGGAGTATATTTTTGGAGCCCTCAACATTTACCTAGAC
Ochotona_princeps|1523      ------------------------------------------------------------
Microcebus_murinus|16747    ------------------------------------------------------------
Dipodomys_ordii|14643       CGACGCCACTCGCTGAGCCCCGAGGAGTATATTTTCGGAGCCCTCAACATTTACCTAGAC
Mus_musculus|14691          CGTCGACACTCGCTGAGCCCCGAGGAGTATATTTTTGGAGCCCTCAACATCTACTTAGAC
Rattus_norvegicus|32863     CGTCGACACTCGCTGAGTCCTGAGGAGTATATTTTTGGAGCCCTCAACATCTACCTAGAC
Oryctolagus_cuniculus|15482 CGTCGCCACTCGCTGAGCCCCGAGGAGTATATTTTTGGAGCCCTCAACATCTATCTGGAT
Callithrix_jacchus|27573    CGACGCCACTCGCTGAGCCCTGAGGAGTATATTTTTGGAGCCCTCAACATTTACCTAGAC
Gorilla_gorilla|26260       CGACGCCACTCGCTGAGCCCTGAGGAGTATATTTTTGGAGCCCTCAACATTTACCTAGAC
Homo_sapiens|21309          CGACGCCACTCGCTGAGCCCTGAGGAGTATATTTTTGGAGCCCTCAACATTTACCTAGAC
Pan_troglodytes|9173        CGACGCCACTCGCTGAGCCCTGAGGAGTATATTTTTGGAGCCCTCAACATTTACCTAGAC
Cavia_porcellus|24222       CGACGCCACTCGCTGAGTCCCGAGGAGTATATATTTGGAGCCCTCAACATCTACCTGGAC
Tupaia_belangeri|12184      CGAAGACACTCACTGAGCCCCGAGGAGTATATTTTTGGAGCCCTCAACATTTACCTAGAT
                                                                                        

Tarsius_syrichta|1190       ATCATCTACATCTTCACCTTCTTCCTGCAGCTTTTTGGCACCAACAGGGAATGA
Ochotona_princeps|1523      ------------------------------------------------------
Microcebus_murinus|16747    ------------------------------------------------------
Dipodomys_ordii|14643       ATTATCTACATCTTCACCTTCTTCCTACAGCTTTTTGGCACCAATCGGGAATGA
Mus_musculus|14691          ATTATCTATATCTTCACCTTCTTCCTGCAGCTTTTTGGCACCAACCGGGAATGA
Rattus_norvegicus|32863     ATTATCTATATCTTCACCTTCTTCCTGCAGCTTTTTGGCACCAACCGGGAATGA
Oryctolagus_cuniculus|15482 ATCATCTACATTTTCACCTTCTTCCTGCAGCTTTTTGGCACCAACCGGGATTGA
Callithrix_jacchus|27573    ATCATCTATATCTTCACCTTCTTCCTGCAGCTTTTTGGCACTAACCGGGAATGA
Gorilla_gorilla|26260       ATCATCTATATCTTCACCTTCTTCCTGCAGCTTTTTGGCACTAACCGAGAATGA
Homo_sapiens|21309          ATCATCTATATCTTCACCTTCTTCCTGCAGCTTTTTGGCACTAACCGAGAATGA
Pan_troglodytes|9173        ATCATCTATATCTTCACCTTCTTCCTGCAGCTTTTTGGCACTAACCGAGAATGA
Cavia_porcellus|24222       ATCATCTACATCTTCACCTTTTTCCTTCAGCTTTTTGGCACCAATCGGGAATGA
Tupaia_belangeri|12184      ATCATCTATATCTTCACCTTCTTCCTGCAGCTTTTTGGCACCAACCGGGAATGA
                                                                                  

multiple sequence alignment in CLUSTALW format


Tarsius_syrichta|1089       ------------------------------------------------------------
Ochotona_princeps|1325      -----LSVANKAPGTEGQQ-QAHGE-KEAPAVPSAPPSYEEATSGEGLKAGAFPPAPTAV
Microcebus_murinus|14205    MTQGKLSVANKAPGTEGQQ-QVNSEKKEVPAVPSAPPSYEEATSGEGLKSGAFPAAPTAL
Dipodomys_ordii|13760       -----LSVANKAPGTEGQQ-QANGEKKETPAVPSAPPSYEEATSGEGLKAGAFPPAPTAV
Mus_musculus|33460          MTQGKLSVANKAPGTEGQQHQANGEKKDAPAVPSAPPSYEEATSGEGLKAGTFPQGPTAV
Rattus_norvegicus|7009      MTQGKLSVANKAPGTEGQQ-QANGEKKDAPAVPSAPPSYEEATSGEGLKAGAFPQGPTAV
Oryctolagus_cuniculus|23596 LAQPKLSVANKAPGTEGQQ-QAQGEKKETPAVPSAPPSYEEATSGEGLKAGAFPPTSTAV
Callithrix_jacchus|19638    MTQGKLSVANKAPGTEGQQ-QAHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPSAV
Gorilla_gorilla|20454       MTQGKLSVANKAPGTEGQQ-QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAV
Homo_sapiens|45783          MTQGKLSVANKAPGTEGQQ-QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAV
Pan_troglodytes|20858       MTQGKLSVANKAPGTEGQQ-QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAV
Cavia_porcellus|19197       MTQGKLSVANKAPGTEGQQ-QANAEKKETVAVPSAPPSYEEATSGEGLKAGAFPPVPTAV
Tupaia_belangeri|10554      MTQGKLSVANKTPGTEGQQ-QANGEKKEAPAVPSAPPSYEEATSGEGLKAGAFPPAPTAV
                                                                                        

Tarsius_syrichta|1089       ------------------------------------------------------------
Ochotona_princeps|1325      PLHPSWAYVDPSSSSSYDRGFPTGHHELFSTFSWDDQKVRRVFIRKVYTILLIQLLVTLA
Microcebus_murinus|14205    PLHPSWAYVDPSGSSGYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLMTVS
Dipodomys_ordii|13760       PLHPSWAYVDPSSSSSYDSGFPTGHHELFSTFSWDDQKVRRVFIRKVYTI-LIQLLVTLG
Mus_musculus|33460          PLHPSWAYVDPSGSSGYEGGFPAGHHEHFTTFSWDDQKVRRLFIRKVYTILLVQLLVTLA
Rattus_norvegicus|7009      PLHPSWAYVDPSSSSGYEGGFPAGHHELFSTFSWDDQKVRQLFIRKVYTILLVQLLVTLA
Oryctolagus_cuniculus|23596 PLHPSWAYVDPSSSSSYDRGFSTGHHELFTTFSWDDQKVRRVFIRKVYTILLIQLLVTLG
Callithrix_jacchus|19638    PLHPSWAYVDPSSSSSYDNGFPTGEHELFTTFSWDDQKVRRVFIRKVYTILLIQLLVTLA
Gorilla_gorilla|20454       PLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFIRKVYTILLIQLLVTLA
Homo_sapiens|45783          PLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLA
Pan_troglodytes|20858       PLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLA
Cavia_porcellus|19197       PLHPSWAYVDPSGSSSYDNRFPTGHHELFTTYSWDDQKVRRVFIRKVYTILLIQLLVTLG
Tupaia_belangeri|10554      PLHPSWAYVDPSSSSSYESGFPTGHHELFTTFSWDDQKVRRVFIRKVYTILLIQLLVTLG
                                                                                        

Tarsius_syrichta|1089       --------DPVKDYVQANPGWYWASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLSM
Ochotona_princeps|1325      VVALFTFCDPVKDYVQANPGWYWASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSM
Microcebus_murinus|14205    IVSLFTFCDIVKEYVQTNPGWYWASYAVFFATYLTLACCTGPRRHFPCNLILLTIFTLSM
Dipodomys_ordii|13760       VVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFXXXX
Mus_musculus|33460          VVALFTFCDVVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSM
Rattus_norvegicus|7009      VVALFTFCDVVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSM
Oryctolagus_cuniculus|23596 VVALFTFCDPVKDYVQANPGWYWASYAVFFVTYLTLACCSGPRRHFPWNLILLTVFTLSM
Callithrix_jacchus|19638    VVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSM
Gorilla_gorilla|20454       VVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSM
Homo_sapiens|45783          VVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSM
Pan_troglodytes|20858       VVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSM
Cavia_porcellus|19197       IVALFTFCDPVKNYVQANPAWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSM
Tupaia_belangeri|10554      VVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSM
                                    * **:***:**.*****                                   

Tarsius_syrichta|1089       AYLTGMLCSYYNTTSVLLCLGITAFVCLSVTIFSFQTKXXXXXXXXVLFVLLMTLFFSGL
Ochotona_princeps|1325      AYLTGMLSSYYNTTSVLLCLGITALVCLSVTIFSFQTKFDFTSCQGVIFVLLMTLLFSGL
Microcebus_murinus|14205    SYLTGMLSSYYNTKSVLLCLSITALVCLSVTIFSFQTKFDFTSC-GVLFVLLMTLFFSGI
Dipodomys_ordii|13760       XXXXXXXXXYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGL
Mus_musculus|33460          AYLTGMLSSYYNTTSVLLCLVITALVCLSVTIFSFQTKFDFTSCQGVLFVLLMTLFFSGL
Rattus_norvegicus|7009      AYLTGMLSSYYNTTSVLLCLGITALVCLSVTIFSFQTKFDFTSCHGVLFVLLMTLFFSGL
Oryctolagus_cuniculus|23596 AYLTGMLSSYYNTTSVLLCLGITALVCLSVTIFSFQTKFDFTSCQGVIFVLLMTLLFSGL
Callithrix_jacchus|19638    AYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGL
Gorilla_gorilla|20454       AYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGL
Homo_sapiens|45783          AYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGL
Pan_troglodytes|20858       AYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGL
Cavia_porcellus|19197       AYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVIFVLLMTLFFSGL
Tupaia_belangeri|10554      AYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVIFVLLMTLLFSGL
                                     ****.****** ***:******:******        *:*******:***:

Tarsius_syrichta|1089       ILAILLPFQYXXXXXXXXXXXXXXXXXXFLAFDTQLLMGNRRHSLSPEEYIFGALNIYLD
Ochotona_princeps|1325      ILAIILPFQYVPWLHAVYAVLGAGVFTL--------------------------------
Microcebus_murinus|14205    ILAILLPFQYVPWLHAVYAALGAGVFTL--------------------------------
Dipodomys_ordii|13760       ILAILLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGNRRHSLSPEEYIFGALNIYLD
Mus_musculus|33460          LLAVLLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGNRRHSLSPEEYIFGALNIYLD
Rattus_norvegicus|7009      LLAILLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGNRRHSLSPEEYIFGALNIYLD
Oryctolagus_cuniculus|23596 ILAILLPFQYVPWLHAIYAVLGAGVFTLFLAFDTQLLMGNRRHSLSPEEYIFGALNIYLD
Callithrix_jacchus|19638    ILAILLPFQYVPWLHAVYASLGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLD
Gorilla_gorilla|20454       ILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLD
Homo_sapiens|45783          ILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLD
Pan_troglodytes|20858       ILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLD
Cavia_porcellus|19197       ILAILLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGSRRHSLSPEEYIFGALNIYLD
Tupaia_belangeri|10554      ILAILLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGSRRHSLSPEEYIFGALNIYLD
                            :**::*****                                                  

Tarsius_syrichta|1089       IIYIFTFFLQLFGTNRE
Ochotona_princeps|1325      -----------------
Microcebus_murinus|14205    -----------------
Dipodomys_ordii|13760       IIYIFTFFLQLFGTNRE
Mus_musculus|33460          IIYIFTFFLQLFGTNRE
Rattus_norvegicus|7009      IIYIFTFFLQLFGTNRE
Oryctolagus_cuniculus|23596 IIYIFTFFLQLFGTNRD
Callithrix_jacchus|19638    IIYIFTFFLQLFGTNRE
Gorilla_gorilla|20454       IIYIFTFFLQLFGTNRE
Homo_sapiens|45783          IIYIFTFFLQLFGTNRE
Pan_troglodytes|20858       IIYIFTFFLQLFGTNRE
Cavia_porcellus|19197       IIYIFTFFLQLFGTNRE
Tupaia_belangeri|10554      IIYIFTFFLQLFGTNRE