Orthologs Set ID: EOG4003HK


Orthology Database
OrthoDB4
Gene Symbol(s)
CCNDBP1

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 24172 109, 169, 249, 331, 428, 502, 579, 860, 921, 968
Cavia porcellus 1694 109, 169, 249, 331, 428, 502, 579, 860, 921, 968
Dipodomys ordii 13939 109, 169, 249, 331, 428, 502, 575, 579, 860, 921, 968
Gorilla gorilla 14446 109, 169, 249, 331, 428, 502, 579, 860, 921, 968
Gorilla gorilla 14631 331, 428, 502, 579, 860, 921, 968
Homo sapiens 28510 109, 169, 249, 331, 428, 502, 579, 860, 921, 968
Microcebus murinus 10676 109, 169, 249, 264, 331, 428, 502, 579, 860, 921, 968
Mus musculus 23722 109, 169, 249, 331, 428, 502, 579, 860, 921, 968
Ochotona princeps 9180 109, 169, 249, 331, 428, 502, 579, 860, 921, 968
Otolemur garnettii 11615 325, 331, 428, 502, 579, 860, 921, 968
Pan troglodytes 12692 109, 169, 249, 331, 428, 502, 579, 860, 921, 968
Rattus norvegicus 22939 109, 169, 249, 331, 428, 502, 579, 860, 921, 968
Spermophilus tridecemlineatus 1036 109, 169, 249, 331, 428, 502, 579, 860, 921, 968, 1074
Tarsius syrichta 12399 109, 169, 249, 428, 502, 579, 681, 860, 921, 968
Tupaia belangeri 17009 109, 169, 249, 331, 428, 502, 579, 615, 860, 921, 968

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 24172 ENSCJAT00000052236 100389460 ENSCJAG00000002983 CCNDBP1 calJac3
Cavia porcellus 1694 ENSCPOT00000003428 100723755 ENSCPOG00000003385 CCNDBP1 cavPor3
Dipodomys ordii 13939 ENSDORT00000007431 ENSDORG00000007431 Ccndbp1 dipOrd1
Gorilla gorilla 14446 ENSGGOT00000032190 101147804 ENSGGOG00000028557 CCNDBP1 gorGor3
Gorilla gorilla 14631 ENSGGOT00000006578 101147804 ENSGGOG00000006546 gorGor3
Homo sapiens 28510 ENST00000300213 23582 ENSG00000166946 CCNDBP1 hg19,GRCh37
Microcebus murinus 10676 ENSMICT00000009950 ENSMICG00000009950 CCNDBP1 micMur1
Mus musculus 23722 ENSMUST00000060455 17151 ENSMUSG00000023572 Ccndbp1 mm9
Ochotona princeps 9180 ENSOPRT00000014989 ENSOPRG00000014998 CCNDBP1 OchPri2.0
Otolemur garnettii 11615 ENSOGAT00000011164 100967203 ENSOGAG00000011162 CCNDBP1 otoGar1
Pan troglodytes 12692 ENSPTRT00000012892 453373 ENSPTRG00000006987 CCNDBP1 panTro2
Rattus norvegicus 22939 ENSRNOT00000015472, NM_001013204 362201 ENSRNOG00000011379 Ccndbp1 rn4
Spermophilus tridecemlineatus 1036 ENSSTOT00000001036 101954684 ENSSTOG00000001030 Ccndbp1 speTri1
Tarsius syrichta 12399 ENSTSYT00000012419 ENSTSYG00000012417 CCNDBP1 tarSyr1
Tupaia belangeri 17009 ENSTBET00000017010 ENSTBEG00000017011 CCNDBP1 tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 16389 ENSCJAP00000043911 100389460 ENSCJAG00000002983 CCNDBP1 calJac3
Cavia porcellus 1318 ENSCPOP00000003059 100723755 ENSCPOG00000003385 CCNDBP1 cavPor3
Dipodomys ordii 13111 ENSDORP00000006970 ENSDORG00000007431 Ccndbp1 dipOrd1
Gorilla gorilla 11740 ENSGGOP00000027982 101147804 ENSGGOG00000028557 CCNDBP1 gorGor3
Gorilla gorilla 11876 ENSGGOP00000006408 101147804 ENSGGOG00000006546 gorGor3
Homo sapiens 74026 ENSP00000300213 23582 ENSG00000166946 CCNDBP1 hg19,GRCh37
Microcebus murinus 9061 ENSMICP00000009063 ENSMICG00000009950 CCNDBP1 micMur1
Mus musculus 12744 ENSMUSP00000062496 17151 ENSMUSG00000023572 Ccndbp1 mm9
Ochotona princeps 7995 ENSOPRP00000013687 ENSOPRG00000014998 CCNDBP1 OchPri2.0
Otolemur garnettii 9991 ENSOGAP00000009990 100967203 ENSOGAG00000011162 CCNDBP1 otoGar1
Pan troglodytes 4893 ENSPTRP00000011936 453373 ENSPTRG00000006987 CCNDBP1 panTro2
Rattus norvegicus 15453 ENSRNOP00000015472 362201 ENSRNOG00000011379 Ccndbp1 rn4
Spermophilus tridecemlineatus 924 ENSSTOP00000000927 101954684 ENSSTOG00000001030 Ccndbp1 speTri1
Tarsius syrichta 11380 ENSTSYP00000011394 ENSTSYG00000012417 CCNDBP1 tarSyr1
Tupaia belangeri 14793 ENSTBEP00000014788 ENSTBEG00000017011 CCNDBP1 tupBel1

multiple sequence alignment in CLUSTALW format


Spermophilus_tridecemlineatus|1036 ATGGCCAGCGAAACTGCGTCTGCAGCCTCAGTCCTCACTCTGGCTCCGCCTTTGGAACAG
Ochotona_princeps|9180             ATGGGCGACATGGCTGCACCTGCAGCGGCAGCCTCCACCTCAGCTCCGCCTGTGGAGCAG
Tupaia_belangeri|17009             ATGGATAACGCAGTTGCCCCTGCAGCCGCAGACCACCCCCTGGCCTCGCCTTTGGAGCAG
Tarsius_syrichta|12399             ATGGCGAGCACAGCTACATCCGCAGCAGCAGTGCCCACCCTGGCTTCGCCTGTGGAGCAG
Mus_musculus|23722                 ---------ATGGCGAGCTCGACAGCCGCAGTCCCCTTCCTTGCTCCGCCTCTGGAGCAG
Rattus_norvegicus|22939            ---------ATGGCGAGCTCGACAACCCCAGTCTCGTTCCTTGCTCCTCCTCTAGAGCAG
Dipodomys_ordii|13939              ------------------------ATGGCCGGGGTCGCCGCGGTCCCCACCCGGGAGCAG
Cavia_porcellus|1694               ATGGCTAGCACGGCTGCACCCGCTACCTCAGCGCCCGCCCATGCCCTGTCCTTGGAGCAG
Microcebus_murinus|10676           ------------------------------ATGGCGAGTCTGGCTCCGCCTTTGGAGCAG
Otolemur_garnettii|11615           ------------------------------------------------------------
Callithrix_jacchus|24172           ATGGCGAGCGCAGGGGCACCTGCAACCGCAGTCCCCACCTTGGCTCCGCCTTTGGAGCAG
Pan_troglodytes|12692              ATGGCGAGCGCAACTGCACCTGCAGCCGCAGTCCCCACCCTGGCTTCGCCTTTGGAGCAG
Homo_sapiens|28510                 ATGGCGAGCGCAACTGCACCTGCAGCCGCAGTCCCCACCCTGGCTTCGCCTTTGGAGCAG
Gorilla_gorilla|14446              ATGGCGAGCGCAACTGCACCTGCAGCCGCAGTCCCCACCCTGGCTTCGCCTTTGGAGCAG
Gorilla_gorilla|14631              ------------------------------------------------------------
                                                                                               

Spermophilus_tridecemlineatus|1036 CTCCGGCACTTGGCGGCTGAGCTGCGGTTGCTCTTGCCTGGAGTGCGGGNNNNNNNNNNN
Ochotona_princeps|9180             CTGCGGCGCTTGGCCGTGGAGCTGCGCCTCCTGCTCCCTCGAGTGCGGGTCGGCGAAGCC
Tupaia_belangeri|17009             CTTCGGCGCTTGGCGGTGGAGCTGCGACTGCTCCTGCCTCGAGTGCGGGTCGGCGAAGCC
Tarsius_syrichta|12399             CTCCGGCACTTGGCAGCGGAACTGCGGTTGCTCCTGCCCCGAGTGCGTGTCGGCGAAGCC
Mus_musculus|23722                 CTCCGGCACTTAGCAGAGGAGCTACGGTCACTTCTGCCTCGAGTACGGGTCGGCGAAGCC
Rattus_norvegicus|22939            CTCCGGCACTTAGCAGAGGAGCTGCGGTCGCTTCTGCCTCGAGTACGGGTCGGCGAAGCC
Dipodomys_ordii|13939              CTCCAGCACCTGGCGGCGGAGCTGCGGCTGCTGCTACCGAGAGTGCGGGNNNNNNNNNNN
Cavia_porcellus|1694               CTTCGGCGCTTGGCGGCGGAGCTGCGGCTGCTGGCGGCCCAGGTGCGGGTCGGCGAAGCC
Microcebus_murinus|10676           CTTCGGCACTTGGCGGTGGAGCTGCGGCTGCTCCTGCCTCGCGTGCGGGTTGGCGAAGCC
Otolemur_garnettii|11615           ------------------------------------------------------------
Callithrix_jacchus|24172           CTCCGGCACTTGGCAGTGGAGCTGCGGTTGCTCCTGCCTCGAGTGCGGGTCGGCGAAGCC
Pan_troglodytes|12692              CTCCGGTACTTGGCGGAGGAGCTGCGGTTGCTCCTGCCTCGAGTGCGGGTCGGCGAAGCC
Homo_sapiens|28510                 CTCCGGCACTTGGCGGAGGAGCTGCGGTTGCTCCTGCCTCGAGTGCGGGTCGGCGAAGCC
Gorilla_gorilla|14446              CTCCGGCACTTGGCGGAGGAGCTGCGGTTGCTCCTGCCTCGAGTGCGGGTCGGCGAAGCC
Gorilla_gorilla|14631              ------------------------------------------------------------
                                                                                               

Spermophilus_tridecemlineatus|1036 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|9180             CGCGGGACCCTCGAAGAGTTTAACCGGGAGCTGTTTTGGAGAAGACTCATTGAGGCAGCC
Tupaia_belangeri|17009             CGGGAAACCACCGAGGAGTTTAATCGGGAGGTGTTTTGGAGAAGACTCAAGGAGGAGGCT
Tarsius_syrichta|12399             CGGGAGACCACCCAGGAATTTAATCGGGAGATATTTTGGAGAAGACTTAATGAGGCAGCT
Mus_musculus|23722                 CAGGAGACAGCGGAGGAATTTAATCGAGAAATGTTTTGGAGAAGACTCAATGAGGCAGCA
Rattus_norvegicus|22939            CAGGAGACAGCCGAGGAATTTAATCGAGAGATGTTTTGGAGAAGACTCAATGAAGCAGCA
Dipodomys_ordii|13939              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|1694               CGGGAAACCCCCGAGAAGTTCGATCGGGAGAGGTTTTGGAGAAGACTCAACGAGGCAGCA
Microcebus_murinus|10676           CGGGCGACCACCGAGGAATTTAATCAAGAGGTGTTTTGGAGAAGACTCAATGAGGCAGCT
Otolemur_garnettii|11615           ------------------------------------------------------------
Callithrix_jacchus|24172           CAGGAGACTACTGAGGAGTTTAATCGAGAGATGTTTTGGAGAAGACTCAATGAGACAGCT
Pan_troglodytes|12692              CAGGAGACCACCGAGGAGTTTAATCGAGAGATGTTCTGGAGAAGACTCAATGAGGCAGCT
Homo_sapiens|28510                 CAGGAGACCACCGAGGAGTTTAATCGAGAGATGTTCTGGAGAAGACTCAATGAGGCAGCT
Gorilla_gorilla|14446              CAGGAGACCACCGAGGAGTTTAATCGAGAGATGTTCTGGAGAAGACTCAATGAGGCAGCT
Gorilla_gorilla|14631              ------------------------------------------------------------
                                                                                               

Spermophilus_tridecemlineatus|1036 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|9180             GAGAATGTGTCCCGGGAGGCCACGACTCTGACCACAGCCTTCTGTCGACGTCCACTGCCA
Tupaia_belangeri|17009             GAGAAAGTGTCCAGGGAAGCCACCACCCTGACCATGGTCTTCTCTCGCCTTCCCCCGCCG
Tarsius_syrichta|12399             GTTAAAGTGTCGAGGGAAGCCACGACTCTGACCAAAGTCTTCTCTGGACCTCAACTGCCA
Mus_musculus|23722                 GTGAAAGTGAACGGGGAAGCCACTGTTCTGACAACGCACTTCTCTAAACTTCCATGGCCA
Rattus_norvegicus|22939            ATGAAAGTGTCTGGGGAAGCCACTGTTCTGACCACACTCTTCTCTAAAATTCCATCGCCA
Dipodomys_ordii|13939              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|1694               GTGACAGTGGCAGGGGAAGCCACGACTCTGACCACAGTCTTCTGTCGACCACCGCTACCT
Microcebus_murinus|10676           GTGAAAGTGTCAACGGAGGCCACGGCTCTGACCACAGTCTTCTCTCGACTTCCACTGCCG
Otolemur_garnettii|11615           ------------------------------------------------------------
Callithrix_jacchus|24172           GTGATGGTGTCAAGGGAAGCCACGACTCTGACCACAGTCTTCTCTCAGTTTCCACTGCCA
Pan_troglodytes|12692              GTGACTGTGTCAAGGGAAGCCACGACTCTGACCACAGTCTTCTCTCAGCTTCCACTGCCG
Homo_sapiens|28510                 GTGACTGTGTCAAGGGAAGCCACGACTCTGACCATAGTCTTCTCTCAGCTTCCACTGCCG
Gorilla_gorilla|14446              GTGACTGTGTCAAGGGAAGCCACGACTCTGACCACAGTCTTCTCTCAGCTTCCACTGCCG
Gorilla_gorilla|14631              ------------------------------------------------------------
                                                                                               

Spermophilus_tridecemlineatus|1036 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|9180             GCTCCGCAGGAAACCCAGGGTTTCTGTGAACAAGTCTGTGCTGTTATCACGGCAATCATT
Tupaia_belangeri|17009             TCTCCACAGGAAACCCAGAGATTCTGTGAAAAAGTCCATGAGGCGATCAAGGCCATTATT
Tarsius_syrichta|12399             TCTGCACAG---------------------------------------------------
Mus_musculus|23722                 TCTCCACAGGAAACCCAGAGGATCTGTGAGCAAGTCCGTATTGCCATCGAGGAAATAATT
Rattus_norvegicus|22939            TCTCCACAGGAAACCCAGAGGATCTGTGAGCAAGTCCACATTGCCACTGAGGAAGTAATT
Dipodomys_ordii|13939              NNNNNNNNNGAAACCCAGAGAATCTGTGAGCAGGTCCATGCTGCCATTAAGGCAATTGTT
Cavia_porcellus|1694               TCTTCACAGGAAACCCAGAGGATCTGTGAGCAAGTCCATGCTGCCATCAAGGCACTTACT
Microcebus_murinus|10676           TCTCCACAGGAAACCCAGAGGTTCTGTGGACAAGTCCATGCTGCTATCANNNNNNNNNNN
Otolemur_garnettii|11615           ---------GAAACCCAGAGGTTCTGTGAAAAAGTCCATGCTGCTATCCCGGCAAAAATT
Callithrix_jacchus|24172           TCTCCACAGGAAACCCAGAAGTTCTGTGAACAAGTCCATGCTGCCATCAAGGCATTTATT
Pan_troglodytes|12692              TCTCCACAGGAAACCCAGAAGTTCTGTGAACAAGTCCATGCTGCCATCAAGACATTTATT
Homo_sapiens|28510                 TCTCCACAGGAAACCCAGAAGTTCTGTGAACAAGTCCATGCTGCCATCAAGGCATTTATT
Gorilla_gorilla|14446              TCTCCACAGGAAACCCAGAAGTTCTGTGAACAAGTCCATGCTGCCATCAAGGCATTTATT
Gorilla_gorilla|14631              ---------GAAACCCAGAAGTTCTGTGAACAAGTCCATGCTGCCATCAAGGCATTTATT
                                                                                               

Spermophilus_tridecemlineatus|1036 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|9180             GCAGTGTACTATTCACTTCCCAAGGAGCAAGGGATCACGCTGAGAAAACTGGTTCGAGGT
Tupaia_belangeri|17009             GCAGTATACTATTCACTTCCCAAGGATCAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|12399             ---------------------------------ATCACCTTGAGAAAGCTGGTGCGGGGT
Mus_musculus|23722                 ATAGTGTATTATTCACTTCCTAAGGACCAGGGAATCACCCTGAGAAAGCTGGTACGGAAT
Rattus_norvegicus|22939            GCAGCATACTACACATTTCCTAAGGATCAGGGAATCACCCTGAGAAAGCTGGTACGAAAT
Dipodomys_ordii|13939              GCAGTGTACTATTCTCTTCCTAAGGATCAGGGGATCACCCTGAGAAAGCTGGTCCGCAGC
Cavia_porcellus|1694               GCAGCATACTATTCACTTCCCAAGGACCAGGGGATCACCCTGAGAAAGCTGGTTCGGGGC
Microcebus_murinus|10676           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGATCACCCTGAGAAAGCTGGTACGAGGC
Otolemur_garnettii|11615           GACGTATACTATCCCCTCCCAAAAAAAAAAAGGATCACCCTGAGAAAGCTGGTACGAGGC
Callithrix_jacchus|24172           GCAGTATATTATTTATTTCCAAAGGATCAGGGAATCACTCTGAGAAAGCTGATCCGGGGC
Pan_troglodytes|12692              GCAGTGTACTATTTGCTTCCAAAGGATCAGGGGATCACCCTGAGAAAGCTGGTACGGGGC
Homo_sapiens|28510                 GCAGTGTACTATTTGCTTCCAAAGGATCAGGGGATCACCCTGAGAAAGCTGGTACGGGGC
Gorilla_gorilla|14446              GCAGTGTACTATTTGCTTCCAAAGGATCAGGGGATCACCCTGAGAAAGCTGGTACGGGGC
Gorilla_gorilla|14631              GCAGTGTACTATTTGCTTCCAAAGGATCAGGGGATCACCCTGAGAAAGCTGGTACGGGGC
                                                                     .     .. .     .. .  .    

Spermophilus_tridecemlineatus|1036 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|9180             GCCACTCTGGACATTGTGGACGGCATGGCTCAGCTCGTTGAAGTACTTTCCAACGCTCCA
Tupaia_belangeri|17009             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|12399             GCCGCTCTGGACATTGTGGATGGCATGGCTCAGCTCGTGGAAGTACTTTCCAGCACTCCA
Mus_musculus|23722                 GCTGCCCTGGACATCGTGGACGGCATGGCTCAGCTCCTGGAAGTGCTTCTTACTGCTCCA
Rattus_norvegicus|22939            GCTGTCCTGGACATCGTGGATGGCACGGCTCAGCTCCTGGATGCGCTCCTTGCTGCTCCA
Dipodomys_ordii|13939              TCTGTTCTGGACATCATGGATGGCATGGCTCAACTTGTGGAAGTGCTTCTTACCACCCCA
Cavia_porcellus|1694               ACCACTCTGGACATTGTGGATGGCATGGCTCAGCTCGTGGAAGGACTTCTCATCACTCCA
Microcebus_murinus|10676           ACCACTCTGGATATTGTGGATGGCATGGCTCAGCTCCTGGATGTACTTTTCGCCAGCCCA
Otolemur_garnettii|11615           ACCACTTTGGAAATTGTGGATGGCATGGCTCAGCTTGTGGAAGCACTTTCCATCACTCCA
Callithrix_jacchus|24172           GCCACCCTGGACATCGTGGATGGCATGGCTCAGCTCATGGAAGTACTTTCCATCACTCCA
Pan_troglodytes|12692              GCCACCCTGGACATCGTGGATGGCATGGCTCAGCTCATGGAAGTACTTTCCGTCACTCCA
Homo_sapiens|28510                 GCCACCCTGGACATCGTGGATGGCATGGCTCAGCTCATGGAAGTACTTTCCGTCACTCCA
Gorilla_gorilla|14446              GCCACCCTGGACATCGTGGATGGCATGGCTCAGCTCATGGAAGTACTTTCCGTCACTCCA
Gorilla_gorilla|14631              GCCACCCTGGACATCGTGGATGGCATGGCTCAGCTCATGGAAGTACTTTCCGTCACTCCA
                                          ...   .  ...  ..   .. .    .  . .  .   .             

Spermophilus_tridecemlineatus|1036 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|9180             GCCCAGAGCCCTGAGAACAATGACCTTATTTCCTGCAACAGTGTGTGGGTTGCATGCCAG
Tupaia_belangeri|17009             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|12399             GCTCAGAGCCCTGAGAACAATGACCTTATTTCCTGCAACAGTGTCTGGGTTGCGTGCGAG
Mus_musculus|23722                 TCTCAGAGCACTGAGAATGGTGACCTGATTTCCTGCAATAGTGTCTCAGTCGCATGTCAA
Rattus_norvegicus|22939            TCTCAGAGCCCTGAGAATGGTGACCTGATTTCCTGCAATAGTGTCTCAGTTGCATGCCAA
Dipodomys_ordii|13939              GCTCAGAGCCCTGAGAACAATGACCTTATTTCCTGCAACAGTGTCTGGGTTGCATGTGAG
Cavia_porcellus|1694               ACTCAGAGCCCTGAGAACAGTACCCTTATTTCCTACAACAGTGTCTGGGTTATGTGCCAG
Microcebus_murinus|10676           GCTCAGAGCCCTGAAAACAATGACCTTATTTCCTGCAACAGTGTCTGGGTTGCGTGCCAG
Otolemur_garnettii|11615           GCTCAGAGCCCTGAGAACAAGGACTTTATTTCCTGCAACAGTGTCTGGGTTGCGTGCCAG
Callithrix_jacchus|24172           ACTCAGAGCCCTGAGAACAATGACCTTATTTCCTACAACAGTGTCTGGGTTGCATGCCAG
Pan_troglodytes|12692              ACTCAGAGCCCTGAGAACAATGACCTTATTTCCTACAACAGTGTCTGGGTTGCATGCCAG
Homo_sapiens|28510                 ACTCAGAGCCCTGAGAACAATGACCTTATTTCCTACAACAGTGTCTGGGTTGCGTGCCAG
Gorilla_gorilla|14446              ACTCAGAGCCCTGAGAACAATGACCTTATTTCCTACAACAGTGTCTGGGTTGCGTGCCAG
Gorilla_gorilla|14631              ACTCAGAGCCCTGAGAACAATGACCTTATTTCCTACAACAGTGTCTGGGTTGCGTGCCAG
                                        . .   ..            .  ...  .      .... .  ..    ..    

Spermophilus_tridecemlineatus|1036 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|9180             CGGGTGCCTCAGATACCTAAAGATAACAAGGCTGCAGCTCTATTAATGCTGACCAACAGT
Tupaia_belangeri|17009             NNNNNNNNNNNNNNNNNNNNNNACAACAAGGCTGCAGCCCTTCTAACACTGACAAAGAAT
Tarsius_syrichta|12399             CAGGTGCCTCGGATACCAAGAGATAATAAAGCTGCAGCTCTTTTAATGCTGACGAAGAGT
Mus_musculus|23722                 CAGGTGCCTGAGATCCCAAAAGATAACAAAGCCGCAGCCCTTTTGATGCTGACCAAGAGT
Rattus_norvegicus|22939            CAGGTGGCTGAGATCCCAAAAGATAACAAAGCTGCAGCCCTTTTGATGCTGACAAAGAGT
Dipodomys_ordii|13939              CAAGTGCCTCGAATACCAACAGATAACAAAGCTGCAGCCCTTCTAATGCTGACCAAGAGT
Cavia_porcellus|1694               CAAGTTCCTCAGATGCCAAAAGATAACAAAGCTGCAGCTCTTTCAGTGCTAACAAAGAGT
Microcebus_murinus|10676           CAGGTGCCTCGGATACCAAGAGATAACAAAGCTGCAGCCCTTTTAATGCTGACAAAGAGT
Otolemur_garnettii|11615           CAGGTGCCTCGGATACCAAGAGATAACAAAGCTGCAGCCCTTTTAACACTGACAAAGAAT
Callithrix_jacchus|24172           CAGATGCCTAAGATACCAAGAGATAACAAAGCTGCAGCTCTTTTGATGCTGACCAAGAAT
Pan_troglodytes|12692              CAGATGCCTCAGATACCAAGAGATAACAAAGCTGCAGCTCTTTTGATGCTGACCAAGAAT
Homo_sapiens|28510                 CAGATGCCTCAGATACCAAGAGATAACAAAGCTGCAGCTCTTTTGATGCTGACCAAGAAT
Gorilla_gorilla|14446              CAGATGCCTCAGATACCAAGAGATAACAAAGCTGCAGCTCTTTTGATGCTGACCAAGAAT
Gorilla_gorilla|14631              CAGATGCCTCAGATACCAAGAGATAACAAAGCTGCAGCTCTTTTGATGCTGACCAAGAAT
                                       .   .    .       .        .  .  .   .        .         .

Spermophilus_tridecemlineatus|1036 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCTGTGGAAGAATGTGACCCT
Ochotona_princeps|9180             GTGGATTTTGTGAAGGATGCACATGAAGAAATGGAACGGNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17009             GTGGATTTTGTGAAAGATGCCCATGAGGAAATGGAGCGGGCTGTGGAAGAATGTAATCTT
Tarsius_syrichta|12399             GTAGATTTTGTGAAGGATGCACATGAAGAAATGGAGCAGGCTGTGGAAGAATGTGACCCT
Mus_musculus|23722                 GTGGATTTTGTGAAAGATGCACATGAAGAAATGGAGCAGGCTGTAGAAGAATGTGACCCG
Rattus_norvegicus|22939            GTGGATCTTGTGAAAGACGCTCATGAAGAAATGGAGCAGGCCGTGGAAGAATGTGACCCT
Dipodomys_ordii|13939              GTAGATTTTGTGAAGGATGCACATGAAGAAATGGAGCAGGCTGTCGAGGAATGTGATCCT
Cavia_porcellus|1694               GTGGATTTTGTGAAAGATGCACATGAAGAAATGGAGCAGGCTGTGGAAGAATGCGACCCT
Microcebus_murinus|10676           GTGGATCTTGTGAAGGATGCACATGAAGAAGTGGAACAGGCTGTGGAAGAATGTGACCCT
Otolemur_garnettii|11615           GTGGATTTTGTGAAGGATGCACATGAAGAAATGGAGAAGGCTGTGGAAGAATGTGACCCT
Callithrix_jacchus|24172           GTGGACTTTGTGAAGGATGCATATGAAGAAATGGAGCGGGCTGTGGAAGAATGCGACCCT
Pan_troglodytes|12692              GTGGATTTTGTGAAGGATGCACATGAAGAAATGGAGCAGGCTGTGGAAGAATGTGACCCT
Homo_sapiens|28510                 GTGGATTTTGTGAAGGATGCACATGAAGAAATGGAGCAGGCTGTGGAAGAATGTGACCCT
Gorilla_gorilla|14446              GTGGATTTTGTGAAGGATGCACATGAAGAAATGGAGCAGGCTGTGGAAGAATGTGACCCT
Gorilla_gorilla|14631              GTGGATTTTGTGAAGGATGCACATGAAGAAATGGAGCAGGCTGTGGAAGAATGTGACCCT
                                   .. .   .....   .  .    ..  .   ...    ..  .. .  .  ..       

Spermophilus_tridecemlineatus|1036 TACTGTGGTCTCTTGAATGATTCTGAGGAG---------GACAACCACAGCAATGAAGAT
Ochotona_princeps|9180             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17009             TACTGTGGC---CTCAATGACTCTGAGGAC---AACTCCGACAATCAT---GATGAAGAT
Tarsius_syrichta|12399             TACTGTGGCCTATTGAATGACACTGGGGAGGACAACTCTGAAAACCACAATGATGACGAT
Mus_musculus|23722                 TACAGCGGCCTCTTGAATGATTCTGAAGAC---AACTCCGACAGCCACAGTGATGAGGAT
Rattus_norvegicus|22939            TACTGTGGCCTCTTGGATGATTCTGAGGAC---AACTCCGACAGCCACCATAATGAGGAT
Dipodomys_ordii|13939              TACCGTGGCCTCTTGAATGATTCTGAGGAAGACAACTCTGACAACCACAGTAATGAGGAT
Cavia_porcellus|1694               TATTCTGGACTCTTGAATGATTCTGAGGAAGGCAGTGCT---------------GAGGAG
Microcebus_murinus|10676           TACTCTGGCCTCTTGAATGACACTGAAGAGGACTCCTCTGACAACTACAACAATGAGGAT
Otolemur_garnettii|11615           TACTGCGGCCTCTTGAATGACAGTGAGGAC---ACCTCTGACCACCATAATGATGAGGAT
Callithrix_jacchus|24172           TACTCTGGCCTCTTGAATGATACTGAGGAGAACAACTCCGACAACCACAATGATGAGGAT
Pan_troglodytes|12692              TACTCTGGCCTCTTGAATGATACTGAGGAGAACAACTCTGACAACCACAATCATGAGGAT
Homo_sapiens|28510                 TACTCTGGCCTCTTGAATGATACTGAGGAGAACAACTCTGACAACCACAATCATGAGGAT
Gorilla_gorilla|14446              TACTCTGGCCTCTTGAATGATACTGAGGAGAACAACTCTGACAACCACAATGATGAGGAT
Gorilla_gorilla|14631              TACTCTGGCCTCTTGAATGATACTGAGGAGAACAACTCTGACAACCACAATGATGAGGAT
                                   .     ..     .   ..    ..  .                          .  .  

Spermophilus_tridecemlineatus|1036 ---GTGTTGGGGTTTCCAAGCAATCGAGACTTATATTGGTCTGAGGAAGATCAAGAGCTC
Ochotona_princeps|9180             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17009             GATCTACTGGGGTTCCCAAGCAATCAGGACTTATACTGGTCAGAAGAAGATCAAGAGCTC
Tarsius_syrichta|12399             GATGTGTTGGGGTTTCCAAGC---CAGGACTTATACTGGTCAGAGGAAAGTCATGAGCTC
Mus_musculus|23722                 GGTGTGTTAGGGCTTCCCAGCAATCGGGACTCATACTGGTCAGAGGAAGATCAAGAACTC
Rattus_norvegicus|22939            GGTGTA---GGGCTTCCCAGCAATCGGGACTCATACTGGTCAGAGGAAGATCAAGCACTC
Dipodomys_ordii|13939              GATGCATTGGGGTTTCCAAGCAATCGGGACTCATATTGGTCAGAGGAGGACCAAGAGCTC
Cavia_porcellus|1694               GAAGTGTTGGGGTTTCCGAGCAATCGGGATGTATATTGGTCTGAGGAAGATCAGGAGCTC
Microcebus_murinus|10676           GATGTGTTGGGGTTTCCAACCAATCAGGACTTATATTGGTCAGAGGAAGATCAAGAGCTC
Otolemur_garnettii|11615           GATGTGTTGGGGTCTCCAACCAATCAGGACTTATACTGGTCAGAGGAAGACCAAGAGCTC
Callithrix_jacchus|24172           GATGTGTTGGGGTTTCCAAGCAATCAGGACTTGTATTGGTCAGAGGATGATCAAGAACTC
Pan_troglodytes|12692              GATGTGTTGGGGTTTCCCAGCAATCAGGACTTGTATTGGTCAGAGGACGATCAAGAGCTC
Homo_sapiens|28510                 GATGTGTTGGGGTTTCCCAGCAATCAGGACTTGTATTGGTCAGAGGACGATCAAGAGCTC
Gorilla_gorilla|14446              GATGTGTTGGGGTTTCCCAGCAATCAGGACTTGTATTGGTCAGAGGACGATCAAGAGCTC
Gorilla_gorilla|14631              GATGTGTTGGGGTTTCCCAGCAATCAGGACTTGTATTGGTCAGAGGACGATCAAGAGCTC
                                            ...               .     .  ....  .  .        .   . 

Spermophilus_tridecemlineatus|1036 ATAATCCCATGTCTTGCACTGGTGAGATCATCCAAAGCTTGCCTGAAGAAAATACGGATC
Ochotona_princeps|9180             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|17009             ATAATCCCATGCCTGGCGCTGGTGAGAGCATCCAAAGCCTGCCTGATAAAAATTCGGATC
Tarsius_syrichta|12399             ATAGTCCCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|23722                 ATAATCCCGTGCCTGGCGCTGGTGAGAGCATCCCGAGCTTCACTCAAGAAAATCCGGATC
Rattus_norvegicus|22939            ATAACTCCGTGCCTTGCATTGGTGAGAGCTTCCCGAGCTTCCCTCAAGAAAATCCGGATC
Dipodomys_ordii|13939              ATAGTGCCATGCCTTGCACTGGTGAAAGCATCCAAGGCCTGCCTGAAGAAAATTCGGCTC
Cavia_porcellus|1694               ATAGTCCCGTGCCTCGCACTAGTGAGAGCGTCTAAAGCCTGCCTGAAGAAAATCCGGATC
Microcebus_murinus|10676           ATAATCCCATGCCTAGCACTGGTGAGAGCATCCAAAGCTTGCCTGAAGAAAATTCGGATC
Otolemur_garnettii|11615           ATCATCCCATGCCTTGCACTAGTGAGGGCCTCCAAAGCCTGCCTGAAGAAAATCCGGATC
Callithrix_jacchus|24172           ATAATCCCATGCCTTGCACTGGTGAGAGCATCCAAAGCCTGCCTGAAGAAAATCCGGATC
Pan_troglodytes|12692              ATAATCCCATGCCTTGCGCTGGTGAGAGCATCCAAAGCCTGCCTGAAGAAAATTCGGATG
Homo_sapiens|28510                 ATAATCCCATGCCTTGCGCTGGTGAGAGCATCCAAAGCCTGCCTGAAGAAAATTCGGATG
Gorilla_gorilla|14446              ATAATCCCATGCCTTGCGCTGGTGAGAGCATCCAAAGCCTGCCTGAAGAAAATTCGGATC
Gorilla_gorilla|14631              ATAATCCCATGCCTTGCGCTGGTGAGAGCATCCAAAGCCTGCCTGAAGAAAATTCGGATC
                                    .       ..  . .   . ...      .     .  .   .        .  .. . 

Spermophilus_tridecemlineatus|1036 TTAGTGGCAGAGAATGGGAAGAAGGATCAGGTGGCTCAGCTGGATGACATTGTGGATATT
Ochotona_princeps|9180             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGATGACATTGTGGACATT
Tupaia_belangeri|17009             TTAGTGGCGGAAAATGGGAAGAAGGATCAGGTGGCCCAGCTGGATGACATTGTGGACATT
Tarsius_syrichta|12399             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|23722                 TTGGTGGCTGAGAATGGAAAGAAGGATGAGGTGGCCCAGCTGGATGACATTGTGGACATT
Rattus_norvegicus|22939            TTGGTGGCTGAGAATGGAAGGAAGGATCAGGTCGCCCAGCTGGATGACATTGTGGATATT
Dipodomys_ordii|13939              TTAGTGGCAGAGAATGGGAAGAAGGACCAGGTGGCCCAGCTAGATGACATTGTGGATATT
Cavia_porcellus|1694               CTAGTGGCAGAGAATGGCAAGAAGGATCAGGTGGCTCAACTAGATGACATTGTGGACATT
Microcebus_murinus|10676           TTAGTGGCAGAGAATGGGAAGAAAGATCAGGTGGCCCAGCTGGATGACATTGTGGATATT
Otolemur_garnettii|11615           TTAGTGGCAGAGAATGGGAAGAAAGATCAGGTGGCCCAGCTGGATGACATTGTGGATATT
Callithrix_jacchus|24172           TTAGTGGCAGAGAATGGGAAGAAGGATCAGGTTGCACAGCTGGATGACATTGTGGATATT
Pan_troglodytes|12692              TTAGTGGCAGAGAATGGGAAGAAGGATCAGGTGGCACAGCTGGATGACATTGTGGATATT
Homo_sapiens|28510                 TTAGTGGCAGAGAATGGGAAGAAGGATCAGGTGGCACAGCTGGATGACATTGTGGATATT
Gorilla_gorilla|14446              TTAGTGGCAGAGAATGGGAAGAAGGATCAGGTGGCACAGCTGGACGACATTGTGGATATT
Gorilla_gorilla|14631              TTAGTGGCAGAGAATGGGAAGAAGGATCAGGTGGCACAGCTGGACGACATTGTGGATATT
                                    . ....  .    ...   .   .    ... .      . .  .   ......   ..

Spermophilus_tridecemlineatus|1036 TCTGATGAGATCAGCCCTAGCGTGGATGATTTGGCTCTGAGCATATATCCACCTATGTGC
Ochotona_princeps|9180             TCTGTCGAGCTTAGCCCCAGTGTGGATGATTTGGCTCTGAGTGTCTATCCACCTATGTGC
Tupaia_belangeri|17009             TCTGATGAGATCAGCCCCAGCGTGGATGATTTGGCTCTGAGCGTATATCCACCTATGTGC
Tarsius_syrichta|12399             NNNNNNNNNNNNNNNNNNNNTGTGGATGATTTGGCTCTGAGCATATATCCACCCATGTGC
Mus_musculus|23722                 TCTGATGAGATCAGCCCCAGTGTGGATGACTTGGTTCTGAGCATATACCCACCTGTGTGC
Rattus_norvegicus|22939            TCTGATGAGATCAGCCCCAGTGTGGATGACTTGGTTCTCAGCGTATATCCACCTGTGTGT
Dipodomys_ordii|13939              TGTGATGAGATCAGCCCCAGTGTGGATGATTTGGCCCTAAGTATATATCCACCTGTGTGC
Cavia_porcellus|1694               TCTGAGGAGATCAGCCCCAGTGTGGATGATTTGGCTCTAAGCATATATCCACCCATGTGC
Microcebus_murinus|10676           TCTGATGAAATCAGCCCCAGTGTGGATGATTTGGCTCTGAGCATATATCCACCTATGTGC
Otolemur_garnettii|11615           TCTGATGAAATCAGCCCCAGTGTGGATGATTTGGCTCTGAGCATATATCCACCTGTGTGC
Callithrix_jacchus|24172           TCTGATGAAATCAGCCCTAGTGTGGATGATTTGGCTCTGAGCATATATCCACCTATGTGT
Pan_troglodytes|12692              TCTGATGAAATCAGCCCTAGTGTGGATGATTTGGCTCTGAGCATATATCCACCTATGTGT
Homo_sapiens|28510                 TCTGATGAAATCAGCCCTAGTGTGGATGATTTGGCTCTGAGCATATATCCACCTATGTGT
Gorilla_gorilla|14446              TCTGATGAAATCAGCCCTAGTGTGGATGATTTGGCTCTGAGCATATATCCACCTATGTGT
Gorilla_gorilla|14631              TCTGATGAAATCAGCCCTAGTGTGGATGATTTGGCTCTGAGCATATATCCACCTATGTGT
                                   . ..  .   .  .     . ******** ****  ** ** .*.** ***** .**** 

Spermophilus_tridecemlineatus|1036 CACCTGACTGTGCGAATCAATTCTGCAAAACTTGTATCTGTTTTAAGGAAGGCACTCGAA
Ochotona_princeps|9180             CATCTGACAGTGCGAATCAACTCTGCAAAGCTTGTTTCTGTTTTAAAGAAGGCACTTGAA
Tupaia_belangeri|17009             CATCTGACTGTGCGAATCAATTCTGCGAAACTTGTATCTGTTTTAAAGAAGGCACTTGAA
Tarsius_syrichta|12399             CACCTGACTGTGCGTATCAATTCTGCGAAACTTGTATCTGTTTTAAAGAAGGCACTTGAA
Mus_musculus|23722                 CACCTCACTGTGCGGATCAGTTCTGCGAAATTGGTGTCTGTTTTAATAAAGGCTCTTGAA
Rattus_norvegicus|22939            CACCTCACCGTGCGGATCACTTCTGCGAAACTGGTGTCTGTTTTAATAAAGGCTCTTGAG
Dipodomys_ordii|13939              CAACTCACTGTGCGACTCAATTCTGCAAAACTTGTATCTGTTTTAAAGAAGGCACTTGAA
Cavia_porcellus|1694               CACCTGACTGTGCGAATGAATTCTGCAAAACTTCTATCTGTCTTGAGGAAGGCACTTGAG
Microcebus_murinus|10676           CACCTGACTGTGCGAATCAATTCTGCAAAACTTGTATCTGTTTTAAAGAAGGCACTTGAA
Otolemur_garnettii|11615           CACCCAACCGTGCGAATTAATTCTGCGAAACTTGTATCTGTTTTAAAGAAGGCACTTGAA
Callithrix_jacchus|24172           CACCTGACTGTGCGAATCAATTCTGCGAAACTTGTGGCTGTCTTAAAGAAGGTGCTTGAA
Pan_troglodytes|12692              CACCTCACCGTGCGAATCAATTCTGCGAAACTTGTATCTGTTTTAAAGAAGGCACTTGAA
Homo_sapiens|28510                 CACCTGACCGTGCGAATCAATTCTGCGAAACTTGTATCTGTTTTAAAGAAGGCACTTGAA
Gorilla_gorilla|14446              CACCTGACCGTGCGAATCAATTCTGCGAAACTTGTATCTGTTTTAAAGAAGGCACTTGAA
Gorilla_gorilla|14631              CACCTGACCGTGCGAATCAATTCTGCGAAACTTGTATCTGTTTTAAAGAAGGCACTTGAA
                                   ** *  ** ***** .* *  *****.**. *  *  **** **.* .****  ** **.

Spermophilus_tridecemlineatus|1036 ATTACAAAAGCAAGTCATGTGACCCCTCAGCCAGAAGATAGTTGGATCCCTTTACTCATT
Ochotona_princeps|9180             ATTACAAAAGCAAGTCATGTGACCCCCCAGCCAGAAGACAGTTGGATCCCTTTACTGATG
Tupaia_belangeri|17009             ATTACAAAAGCGAGTCATGTGACCCCTCAGCCAGAAGATAGTTGGATCCCTTTACTCATT
Tarsius_syrichta|12399             ATTACAAAAGCAAGTCATGTGACCCCTCAGCCAGAAGATAGTTGGATCCCTTTACTTGTT
Mus_musculus|23722                 ATTACAAAAGCAAGTCACGTGAGCCCCCACCCAGGAGATAGCTGGATTCCTTTACTCATT
Rattus_norvegicus|22939            ATTACAAAAGCAAGTCACGTGAGCCCCCAGCCAGGAGATAGCTGGATCCCTTTACTCATT
Dipodomys_ordii|13939              ATTACAAAAGCAAGTCATGTGACCTCTCAGCCAGAAGATAGTTGGATCCTTTTACTCATT
Cavia_porcellus|1694               GTTACAAAAGCAAGTCATGTGACCCCTCAGCCGGAAGACAGTTGGATCCCTTTACTCATT
Microcebus_murinus|10676           ATTACAAAAGCAAGTCATGTGACCCCTCAGCCAGAAGATAGTTGGATTCCTTTACTTATT
Otolemur_garnettii|11615           ATTACAAAAGCAAGCCATGTGACCCCTCAGCCAGAAGATAGCTGGATCCCTTTACTTATT
Callithrix_jacchus|24172           ATCACAAAAGCAAGTCATGTGACCCCTCAGCCAGAAGATAGTTGGATCCCTTTACTTATT
Pan_troglodytes|12692              ATTACAAAAGCAAGTCATGTGACCCCTCAGCCAGAAGATAGTTGGATCCCTTTACTTATT
Homo_sapiens|28510                 ATTACAAAAGCAAGTCATGTGACCCCTCAGCCAGAAGATAGTTGGATCCCTTTACTTATT
Gorilla_gorilla|14446              ATTACAAAAGCAAGTCATGTGACCCCTCAGCCAGAAGATAGTTGGATCCCTTTACTTATT
Gorilla_gorilla|14631              ATTACAAAAGCAAGTCATGTGACCCCTCAGCCAGAAGATAGTTGGATCCCTTTACTTATT
                                   .* ********.** ** **** * * ** **.*.*** ** ***** * ****** .* 

Spermophilus_tridecemlineatus|1036 AATGCTGTTGATCATTGCATGAACAGAATTAAGGAGCTCACTCAGAGTGAAATT---TTA
Ochotona_princeps|9180             AATGCCATTGATCACTGCATGAACAGAATCAAGGACCTCACTCAGAGAGAAATCGAACTA
Tupaia_belangeri|17009             AATGCTGTAGATCATTGCATGAACAGAATCAAGGAGCTCACTCAGAATGAACTTGAATCA
Tarsius_syrichta|12399             AATGCCATTGATCACTGCATGAACAGAATCAAGGAATTCACTCAGAGTGAACTTGAACTA
Mus_musculus|23722                 AATGCCGTTGACCATTGCATGAACAGAATTAAGGCGCTCACTCAGCGTGCAGCTGAACTG
Rattus_norvegicus|22939            AATGCCGTTGACCATTGCATGGACAGAATTAAGGAGCTCACTCAGCGTGCAGTTGAGCTG
Dipodomys_ordii|13939              AATGCCATTGACCACTGCATGAACAGAGTTAAGGAACTCACTCAGAGTGCAGCTGAATTA
Cavia_porcellus|1694               AATGCTGTTGATGATTGCATGAACAAAATTAAGGAACTCACGCAGAGTGAAATTGAACTA
Microcebus_murinus|10676           AATGCTGTTGATCATTGCATGAACAGAATCAAGGAACTCACTCAGGGTGAACTTGAATTA
Otolemur_garnettii|11615           AATGCTGTTGATCATTGCATGAACAGAATCAAGGAACTCACTCAGGGAGAACTTGAATTA
Callithrix_jacchus|24172           AATGCCATTGATCATTGCATGAATAGAATCAAGGAGCTCACACAAAGAGAACTTGAATTA
Pan_troglodytes|12692              AATGCCATTGATCATTGCTTGAATAGAATCAAGGAGCTCACTCAGAGTGAACTTGAATTA
Homo_sapiens|28510                 AATGCCATTGATCATTGCATGAATAGAATCAAGGAGCTCACTCAGAGTGAACTTGAATTA
Gorilla_gorilla|14446              AATGCCATTGATCACTGCATGAATAGAATCAAGGAGCTCACTCAGAGTGAACTTGAATTA
Gorilla_gorilla|14631              AATGCCATTGATCACTGCATGAATAGAATCAAGGAGCTCACTCAGAGTGAACTTGAATTA
                                   ***** .*:**  * ***:**.* *.*.* ****.  **** **. .:*.*        .

Spermophilus_tridecemlineatus|1036 TGA
Ochotona_princeps|9180             TAA
Tupaia_belangeri|17009             TGA
Tarsius_syrichta|12399             TGA
Mus_musculus|23722                 TGA
Rattus_norvegicus|22939            TGA
Dipodomys_ordii|13939              TGA
Cavia_porcellus|1694               TGA
Microcebus_murinus|10676           TGA
Otolemur_garnettii|11615           TGA
Callithrix_jacchus|24172           TGA
Pan_troglodytes|12692              TGA
Homo_sapiens|28510                 TGA
Gorilla_gorilla|14446              TGA
Gorilla_gorilla|14631              TGA
                                   *.*

multiple sequence alignment in CLUSTALW format


Spermophilus_tridecemlineatus|924 MASETASAASVLTLAPPLEQLRHLAAELRLLLPGVRXXXXXXXXXXXXXXXXXXXXXXXX
Ochotona_princeps|7995            MGDMAAPAAAASTSAPPVEQLRRLAVELRLLLPRVRVGEARGTLEEFNRELFWRRLIEAA
Tupaia_belangeri|14793            MDNAVAPAAADHPLASPLEQLRRLAVELRLLLPRVRVGEARETTEEFNREVFWRRLKEEA
Tarsius_syrichta|11380            MASTATSAAAVPTLASPVEQLRHLAAELRLLLPRVRVGEARETTQEFNREIFWRRLNEAA
Mus_musculus|12744                ---MASSTAAVPFLAPPLEQLRHLAEELRSLLPRVRVGEAQETAEEFNREMFWRRLNEAA
Rattus_norvegicus|15453           ---MASSTTPVSFLAPPLEQLRHLAEELRSLLPRVRVGEAQETAEEFNREMFWRRLNEAA
Dipodomys_ordii|13111             --------MAGVAAVPTREQLQHLAAELRLLLPRVRXXXXXXXXXXXXXXXXXXXXXXXX
Cavia_porcellus|1318              MASTAAPATSAPAHALSLEQLRRLAAELRLLAAQVRVGEARETPEKFDRERFWRRLNEAA
Microcebus_murinus|9061           ----------MASLAPPLEQLRHLAVELRLLLPRVRVGEARATTEEFNQEVFWRRLNEAA
Otolemur_garnettii|9991           ------------------------------------------------------------
Callithrix_jacchus|16389          MASAGAPATAVPTLAPPLEQLRHLAVELRLLLPRVRVGEAQETTEEFNREMFWRRLNETA
Pan_troglodytes|4893              MASATAPAAAVPTLASPLEQLRYLAEELRLLLPRVRVGEAQETTEEFNREMFWRRLNEAA
Homo_sapiens|74026                MASATAPAAAVPTLASPLEQLRHLAEELRLLLPRVRVGEAQETTEEFNREMFWRRLNEAA
Gorilla_gorilla|11740             MASATAPAAAVPTLASPLEQLRHLAEELRLLLPRVRVGEAQETTEEFNREMFWRRLNEAA
Gorilla_gorilla|11876             ------------------------------------------------------------
                                                                                              

Spermophilus_tridecemlineatus|924 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Ochotona_princeps|7995            ENVSREATTLTTAFCRRPLPAPQETQGFCEQVCAVITAIIAVYYSLPKEQGITLRKLVRG
Tupaia_belangeri|14793            EKVSREATTLTMVFSRLPPPSPQETQRFCEKVHEAIKAIIAVYYSLPKDQXXXXXXXXXX
Tarsius_syrichta|11380            VKVSREATTLTKVFSGPQLPSAQ----------------------------ITLRKLVRG
Mus_musculus|12744                VKVNGEATVLTTHFSKLPWPSPQETQRICEQVRIAIEEIIIVYYSLPKDQGITLRKLVRN
Rattus_norvegicus|15453           MKVSGEATVLTTLFSKIPSPSPQETQRICEQVHIATEEVIAAYYTFPKDQGITLRKLVRN
Dipodomys_ordii|13111             XXXXXXXXXXXXXXXXXXXXXXXETQRICEQVHAAIKAIVAVYYSLPKDQGITLRKLVRS
Cavia_porcellus|1318              VTVAGEATTLTTVFCRPPLPSSQETQRICEQVHAAIKALTAAYYSLPKDQGITLRKLVRG
Microcebus_murinus|9061           VKVSTEATALTTVFSRLPLPSPQETQRFCGQVHAAIXXXXXXXXXXXXXXXITLRKLVRG
Otolemur_garnettii|9991           -----------------------ETQRFCEKVHAAIPAKIDVYYPLPKKKRITLRKLVRG
Callithrix_jacchus|16389          VMVSREATTLTTVFSQFPLPSPQETQKFCEQVHAAIKAFIAVYYLFPKDQGITLRKLIRG
Pan_troglodytes|4893              VTVSREATTLTTVFSQLPLPSPQETQKFCEQVHAAIKTFIAVYYLLPKDQGITLRKLVRG
Homo_sapiens|74026                VTVSREATTLTIVFSQLPLPSPQETQKFCEQVHAAIKAFIAVYYLLPKDQGITLRKLVRG
Gorilla_gorilla|11740             VTVSREATTLTTVFSQLPLPSPQETQKFCEQVHAAIKAFIAVYYLLPKDQGITLRKLVRG
Gorilla_gorilla|11876             -----------------------ETQKFCEQVHAAIKAFIAVYYLLPKDQGITLRKLVRG
                                                                                              

Spermophilus_tridecemlineatus|924 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Ochotona_princeps|7995            ATLDIVDGMAQLVEVLSNAPAQSPENNDLISCNSVWVACQRVPQIPKDNKAAALLMLTNS
Tupaia_belangeri|14793            XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNKAAALLTLTKN
Tarsius_syrichta|11380            AALDIVDGMAQLVEVLSSTPAQSPENNDLISCNSVWVACEQVPRIPRDNKAAALLMLTKS
Mus_musculus|12744                AALDIVDGMAQLLEVLLTAPSQSTENGDLISCNSVSVACQQVPEIPKDNKAAALLMLTKS
Rattus_norvegicus|15453           AVLDIVDGTAQLLDALLAAPSQSPENGDLISCNSVSVACQQVAEIPKDNKAAALLMLTKS
Dipodomys_ordii|13111             SVLDIMDGMAQLVEVLLTTPAQSPENNDLISCNSVWVACEQVPRIPTDNKAAALLMLTKS
Cavia_porcellus|1318              TTLDIVDGMAQLVEGLLITPTQSPENSTLISYNSVWVMCQQVPQMPKDNKAAALSVLTKS
Microcebus_murinus|9061           TTLDIVDGMAQLLDVLFASPAQSPENNDLISCNSVWVACQQVPRIPRDNKAAALLMLTKS
Otolemur_garnettii|9991           TTLEIVDGMAQLVEALSITPAQSPENKDFISCNSVWVACQQVPRIPRDNKAAALLTLTKN
Callithrix_jacchus|16389          ATLDIVDGMAQLMEVLSITPTQSPENNDLISYNSVWVACQQMPKIPRDNKAAALLMLTKN
Pan_troglodytes|4893              ATLDIVDGMAQLMEVLSVTPTQSPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKN
Homo_sapiens|74026                ATLDIVDGMAQLMEVLSVTPTQSPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKN
Gorilla_gorilla|11740             ATLDIVDGMAQLMEVLSVTPTQSPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKN
Gorilla_gorilla|11876             ATLDIVDGMAQLMEVLSVTPTQSPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKN
                                                                                              

Spermophilus_tridecemlineatus|924 XXXXXXXXXXXXXAVEECDPYCGLLNDSEE---DNHSNED-VLGFPSNRDLYWSEEDQEL
Ochotona_princeps|7995            VDFVKDAHEEMERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tupaia_belangeri|14793            VDFVKDAHEEMERAVEECNLYCG-LNDSED-NSDNH-DEDDLLGFPSNQDLYWSEEDQEL
Tarsius_syrichta|11380            VDFVKDAHEEMEQAVEECDPYCGLLNDTGEDNSENHNDDDDVLGFPS-QDLYWSEESHEL
Mus_musculus|12744                VDFVKDAHEEMEQAVEECDPYSGLLNDSED-NSDSHSDEDGVLGLPSNRDSYWSEEDQEL
Rattus_norvegicus|15453           VDLVKDAHEEMEQAVEECDPYCGLLDDSED-NSDSHHNEDGV-GLPSNRDSYWSEEDQAL
Dipodomys_ordii|13111             VDFVKDAHEEMEQAVEECDPYRGLLNDSEEDNSDNHSNEDDALGFPSNRDSYWSEEDQEL
Cavia_porcellus|1318              VDFVKDAHEEMEQAVEECDPYSGLLNDSEEGSA-----EEEVLGFPSNRDVYWSEEDQEL
Microcebus_murinus|9061           VDLVKDAHEEVEQAVEECDPYSGLLNDTEEDSSDNYNNEDDVLGFPTNQDLYWSEEDQEL
Otolemur_garnettii|9991           VDFVKDAHEEMEKAVEECDPYCGLLNDSED-TSDHHNDEDDVLGSPTNQDLYWSEEDQEL
Callithrix_jacchus|16389          VDFVKDAYEEMERAVEECDPYSGLLNDTEENNSDNHNDEDDVLGFPSNQDLYWSEDDQEL
Pan_troglodytes|4893              VDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSNQDLYWSEDDQEL
Homo_sapiens|74026                VDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSNQDLYWSEDDQEL
Gorilla_gorilla|11740             VDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNDEDDVLGFPSNQDLYWSEDDQEL
Gorilla_gorilla|11876             VDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNDEDDVLGFPSNQDLYWSEDDQEL
                                                                                              

Spermophilus_tridecemlineatus|924 IIPCLALVRSSKACLKKIRILVAENGKKDQVAQLDDIVDISDEISPSVDDLALSIYPPMC
Ochotona_princeps|7995            XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDIVDISVELSPSVDDLALSVYPPMC
Tupaia_belangeri|14793            IIPCLALVRASKACLIKIRILVAENGKKDQVAQLDDIVDISDEISPSVDDLALSVYPPMC
Tarsius_syrichta|11380            IVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDDLALSIYPPMC
Mus_musculus|12744                IIPCLALVRASRASLKKIRILVAENGKKDEVAQLDDIVDISDEISPSVDDLVLSIYPPVC
Rattus_norvegicus|15453           ITPCLALVRASRASLKKIRILVAENGRKDQVAQLDDIVDISDEISPSVDDLVLSVYPPVC
Dipodomys_ordii|13111             IVPCLALVKASKACLKKIRLLVAENGKKDQVAQLDDIVDICDEISPSVDDLALSIYPPVC
Cavia_porcellus|1318              IVPCLALVRASKACLKKIRILVAENGKKDQVAQLDDIVDISEEISPSVDDLALSIYPPMC
Microcebus_murinus|9061           IIPCLALVRASKACLKKIRILVAENGKKDQVAQLDDIVDISDEISPSVDDLALSIYPPMC
Otolemur_garnettii|9991           IIPCLALVRASKACLKKIRILVAENGKKDQVAQLDDIVDISDEISPSVDDLALSIYPPVC
Callithrix_jacchus|16389          IIPCLALVRASKACLKKIRILVAENGKKDQVAQLDDIVDISDEISPSVDDLALSIYPPMC
Pan_troglodytes|4893              IIPCLALVRASKACLKKIRMLVAENGKKDQVAQLDDIVDISDEISPSVDDLALSIYPPMC
Homo_sapiens|74026                IIPCLALVRASKACLKKIRMLVAENGKKDQVAQLDDIVDISDEISPSVDDLALSIYPPMC
Gorilla_gorilla|11740             IIPCLALVRASKACLKKIRILVAENGKKDQVAQLDDIVDISDEISPSVDDLALSIYPPMC
Gorilla_gorilla|11876             IIPCLALVRASKACLKKIRILVAENGKKDQVAQLDDIVDISDEISPSVDDLALSIYPPMC
                                                                                 ****.**:***:*

Spermophilus_tridecemlineatus|924 HLTVRINSAKLVSVLRKALEITKASHVTPQPEDSWIPLLINAVDHCMNRIKELTQSEI-L
Ochotona_princeps|7995            HLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLMNAIDHCMNRIKDLTQREIEL
Tupaia_belangeri|14793            HLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAVDHCMNRIKELTQNELES
Tarsius_syrichta|11380            HLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLVNAIDHCMNRIKEFTQSELEL
Mus_musculus|12744                HLTVRISSAKLVSVLIKALEITKASHVSPHPGDSWIPLLINAVDHCMNRIKALTQRAAEL
Rattus_norvegicus|15453           HLTVRITSAKLVSVLIKALEITKASHVSPQPGDSWIPLLINAVDHCMDRIKELTQRAVEL
Dipodomys_ordii|13111             QLTVRLNSAKLVSVLKKALEITKASHVTSQPEDSWILLLINAIDHCMNRVKELTQSAAEL
Cavia_porcellus|1318              HLTVRMNSAKLLSVLRKALEVTKASHVTPQPEDSWIPLLINAVDDCMNKIKELTQSEIEL
Microcebus_murinus|9061           HLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAVDHCMNRIKELTQGELEL
Otolemur_garnettii|9991           HPTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAVDHCMNRIKELTQGELEL
Callithrix_jacchus|16389          HLTVRINSAKLVAVLKKVLEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQRELEL
Pan_troglodytes|4893              HLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCLNRIKELTQSELEL
Homo_sapiens|74026                HLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQSELEL
Gorilla_gorilla|11740             HLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQSELEL
Gorilla_gorilla|11876             HLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQSELEL
                                  : ***:.****::** *.**:******:.:* **** **:**:*.*::::* :**