Orthologs Set ID: EOG4003HM


Orthology Database
OrthoDB4
Gene Symbol(s)
OR1A1

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Dipodomys ordii 279
Dipodomys ordii 842
Gorilla gorilla 35143
Homo sapiens 32901
Ochotona princeps 10800
Oryctolagus cuniculus 11080
Otolemur garnettii 658
Pan troglodytes 15206
Rattus norvegicus 6243
Spermophilus tridecemlineatus 9004
Tupaia belangeri 10243
Tupaia belangeri 3035
Tupaia belangeri 7292

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Dipodomys ordii 279 ENSDORT00000000044 ENSDORG00000000045 dipOrd1
Dipodomys ordii 842 ENSDORT00000000857 ENSDORG00000000857 dipOrd1
Gorilla gorilla 35143 ENSGGOT00000032058 101143345 ENSGGOG00000022344 LOC101143345 gorGor3
Homo sapiens 32901 ENST00000304094 8383 ENSG00000172146 OR1A1 hg19,GRCh37
Ochotona princeps 10800 ENSOPRT00000014429 101530559 ENSOPRG00000014441 OchPri2.0
Oryctolagus cuniculus 11080 ENSOCUT00000023847 ENSOCUG00000024781 oryCun2.0
Otolemur garnettii 658 ENSOGAT00000000633 ENSOGAG00000000633 OR1A2 otoGar1
Pan troglodytes 15206 ENSPTRT00000015791 468149 ENSPTRG00000008560 OR1A1 panTro2
Rattus norvegicus 6243 ENSRNOT00000043016 287513 ENSRNOG00000034227 Olr1513 rn4
Spermophilus tridecemlineatus 9004 ENSSTOT00000009005 speTri1
Tupaia belangeri 10243 ENSTBET00000010244 ENSTBEG00000010262 tupBel1
Tupaia belangeri 7292 ENSTBET00000007293 ENSTBEG00000007311 tupBel1
Tupaia belangeri 3035 ENSTBET00000003036 ENSTBEG00000003058 tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Dipodomys ordii 260 ENSDORP00000000036 ENSDORG00000000045 dipOrd1
Dipodomys ordii 792 ENSDORP00000000805 ENSDORG00000000857 dipOrd1
Gorilla gorilla 27050 ENSGGOP00000020226 101143345 ENSGGOG00000022344 LOC101143345 gorGor3
Homo sapiens 54451 ENSP00000305207 8383 ENSG00000172146 OR1A1 hg19,GRCh37
Ochotona princeps 9400 ENSOPRP00000013171 101530559 ENSOPRG00000014441 OchPri2.0
Oryctolagus cuniculus 15038 ENSOCUP00000020156 ENSOCUG00000024781 oryCun2.0
Otolemur garnettii 569 ENSOGAP00000000569 ENSOGAG00000000633 OR1A2 otoGar1
Pan troglodytes 32939 ENSPTRP00000014611 468149 ENSPTRG00000008560 OR1A1 panTro2
Rattus norvegicus 32918 ENSRNOP00000047137 287513 ENSRNOG00000034227 Olr1513 rn4
Spermophilus tridecemlineatus 8087 ENSSTOP00000008069 speTri1
Tupaia belangeri 8881 ENSTBEP00000008862 ENSTBEG00000010262 tupBel1
Tupaia belangeri 2645 ENSTBEP00000002623 ENSTBEG00000003058 tupBel1
Tupaia belangeri 6317 ENSTBEP00000006300 ENSTBEG00000007311 tupBel1

multiple sequence alignment in CLUSTALW format


Dipodomys_ordii|279                ATGAGAGAAGAAAACCAGTCTGCTGCCACAGAGTTCATCCTCCTGGGAGTGACTGGACAG
Dipodomys_ordii|842                ATGAGAGAAGAAAACCAGTCTGCTACCACAGATTTCATCCTTCTGGGAGTGACTGGACAG
Rattus_norvegicus|6243             ATGAGAGAAGAAAACGAGTCTTCTACCACAGAGTTCACTCTCCTGGGAGTTACAAGGCAG
Tupaia_belangeri|10243             ATGAGAGAAGTAAATCAGTCATATACCTCAGAATTCATCCTCTTGGGAGTTAATGATCAA
Tupaia_belangeri|7292              ATGAGAGAAGTAAATCAGTCATACACCTTGGAATTCATCCTCCTGGGAGTTAATGATCAA
Spermophilus_tridecemlineatus|9004 ATGAGGGAAGGAAACCAGTCTTCTACCATGGAGTTCATCCTCTTGGGAGTCACGGGTCAG
Gorilla_gorilla|35143              ATGAGGGAAAATAACCAGTCCTCTACACTGGAATTCATCCTCCTGGGAGTTACTGGTCAG
Homo_sapiens|32901                 ATGAGGGAAAATAACCAGTCCTCTACACTGGAATTCATCCTCCTGGGAGTTACTGGTCAG
Pan_troglodytes|15206              ATGAGGGAAAATAACCAGTCCTCTACACTGGAATTCATCCTCCTGGGAGTTACTGGTCAG
Ochotona_princeps|10800            ------------------------------------------------------------
Oryctolagus_cuniculus|11080        ATGAGGGAAGAAAACCAGTCCTCTACCCTGGATTTCATCCTCCTGGGAATAACTGGTCGG
Tupaia_belangeri|3035              ATGAAGGAAGAAAACCAATCCTCTGTCCTAGAGTTCATCCTCCTTGGAGTTACTGGTCAG
Otolemur_garnettii|658             ATGAGGGAAGAAAACCAATCCTCTACCCTGGAATTTATCCTCCTGGGTGTTACAGATCAG
                                                                                               

Dipodomys_ordii|279                CAGGAACAAGAAGACATCTTCTTCATTCTCTTCCTGCTCATTTACCCCATCACACTGGTT
Dipodomys_ordii|842                CAGGAACAAGAAGACATCTTCTTCATCCTCTTCCTGCTCATTTACCCCATCACACTGGTT
Rattus_norvegicus|6243             CGGGAGCAGGAATATTTCTTCTTCATCCTCTTCCTGTTCATTTACCCCATCACGGTGTTT
Tupaia_belangeri|10243             CAGGAACAGGAAGAC---TTCTTCATCCTCTTCCTGTTTATTTACCCCATCACACTGATT
Tupaia_belangeri|7292              CAGGAACAGGAAGAC---TTCTTTATCTTCTTCCTATTTACTTACCCCATCACACTGATT
Spermophilus_tridecemlineatus|9004 CAGGAGCAGGAGGATTTCTTCTTCATCCTCTTCCTGTTCATTTACCCCATCACAGTCGTG
Gorilla_gorilla|35143              CAGGAACAGGAAGATTTCTTCTACATCCTCTTCCTGTTCATTTACCCCATCACATTGATT
Homo_sapiens|32901                 CAGGAACAGGAAGATTTCTTCTACATCCTCTTCTTGTTCATTTACCCCATCACATTGATT
Pan_troglodytes|15206              CAGGAACAGGAAGATTTCTTCTACATCCTCTTCCTGTTCATTTACCCCATCACATTGATT
Ochotona_princeps|10800            ------------------TTCTTCATCCTCTTCCTCCTCATTTACCCCATCACATTGATT
Oryctolagus_cuniculus|11080        CAGGAACAGGAAGACTTTTTCTTCATCCTCTTCCTCTTCATTTACCCCATCACTTTGATT
Tupaia_belangeri|3035              AAAAAACAGGAAAATTTCTTCTTCATCCTCTTCCTCTTCATTTACCCCATCACAGTGACT
Otolemur_garnettii|658             CAGAAGCAGGAAGATTTCTTCTTCTTCCTTTTCCTGTTCATTTACCCCATCACATTGACT
                                                     ****: :*  * *** *  * * ************  *    

Dipodomys_ordii|279                GGAAACATGCTCATCATCCTGGCCATTCTCTCTGATGGTCGCCTCCACAACCCCATGTAC
Dipodomys_ordii|842                GGAAACATGCTCATCATCCTGGCCATTCTCTCTGATGGTCGCCTCCACAACCCCATGTAC
Rattus_norvegicus|6243             GGGAACACGCTCATCATCCTAGCCATTCACTCTGACATTCGCCTTCATAACCCCATGTAC
Tupaia_belangeri|10243             GGAAATCTGCTCATCATCTTGGCCGTCTACTCAGACAGTCACCTTCACAACCCCATGTAC
Tupaia_belangeri|7292              GGAAACCTGCTCATCATCTTGGCCATCTACTCGGATAGTCACCTTCACAACCCCATGTAC
Spermophilus_tridecemlineatus|9004 GGAAACTTGCTCATCATCCTCGCCATTCTCTCTGACAGTCACCTCCACAACCCCATGTAT
Gorilla_gorilla|35143              GGAAACCTGCTCATCGTCCTAGCCATTTGCTCCGATGTTCACCTTCACAACCCCATGTAT
Homo_sapiens|32901                 GGAAACCTGCTCATCGTCCTAGCCATTTGCTCTGATGTTCGCCTTCACAACCCCATGTAT
Pan_troglodytes|15206              GGAAACCTGCTCATCGTCCTAGCCATTTGCTCTGATGTTCACCTTCACAACCCCATGTAT
Ochotona_princeps|10800            GGAAACACACTCATCATCCTGGCCATTCACTCCGACACGCGCCTGCACAACCCCATGTAC
Oryctolagus_cuniculus|11080        GGAAACATGCTCATCATCCTAGCCATTCGCTCTGACATTCGCCTTCACAACCCCATGTAC
Tupaia_belangeri|3035              GGAAACCTGCTCATCATCTTGGCCATTCACGCAGACAGTCGCCTTCACAATCCCATGTAT
Otolemur_garnettii|658             GGAAACCTGCTCATCATCTTGGCTATTCATTCTGACATTCGCCTTCACAACCCTATGTAT
                                   **.**   .******.** * ** .*     * ** .  *.*** ** ** ** ***** 

Dipodomys_ordii|279                TTCTTCCTTGCCAACCTCTCTCTGGTTGACATCTTCTTCTCATCTGTCACCATCCCCAAG
Dipodomys_ordii|842                TTCTTCCTTGCCAACCTCTCTCTGGTTGACATCTTCTTCTCATCTGTCACCATCCCCAAG
Rattus_norvegicus|6243             TTTTTCCTCGCCAACCTCTCCCTTGTTGACATCTTCTTCTCCTCTGTAACTATCCCCAAG
Tupaia_belangeri|10243             TTTTTCCTTGCCAACCTCTCATTGGTTGATATCTTCTTCTCATCTGTAACTCTCCCTAAG
Tupaia_belangeri|7292              TTTTTCCTTGCCAACCTCTCATTGGTTGATATCTTCTTCTCATCTGTAACTGTCCCTAAG
Spermophilus_tridecemlineatus|9004 TTCCTCCTGGCCAACCTCTCCTTTGTTGATATCTTCTTCTCCTCTGTAACCATCCCTAAG
Gorilla_gorilla|35143              TTTCTCCTTGCCAACCTCTCCTTGGTTGACATCTTCTTCTCATCGGTAACCATCCCTAAG
Homo_sapiens|32901                 TTTCTCCTTGCCAACCTCTCCTTGGTTGACATCTTCTTCTCATCGGTAACCATCCCTAAG
Pan_troglodytes|15206              TTTCTCCTTGCCAACCTCTCCTTGGTTGACATCTTCTTCTCATCCGTAACCATCCCTAAG
Ochotona_princeps|10800            TTTCTGCTTGCCAACCTCTCCCTTGTTGACATCTTTTTCTCCTCTGTAACCGTCCCTAAG
Oryctolagus_cuniculus|11080        TTTTTCCTTGCCAATCTCTCCCTTGTTGACATCTTTTTCTCATCTGTAACCATCCCTAAA
Tupaia_belangeri|3035              TTTTTCCTTGCCAACCTCTCCTTTGTTGACATCTTCTTCTCATCTGTAAGCATCCCTAAG
Otolemur_garnettii|658             TTTTTCCTTGCCAACCTGTCCTTAGTTGACATCTTCTTCTCATCTGTAACCATCCCTAAG
                                   **  * ** ***** ** **  * ***** ***** *****.** **.*   **** **.

Dipodomys_ordii|279                ATGCTGGTCAACCACCTCGTGGGTAGCAGAGTCATCTCCTTTGCTGGATGTTTCACACAG
Dipodomys_ordii|842                ATGCTGGCCAACTATTTTCTGGAGAGTAAAACCATTTCTTATGCTGGATGCTTCACACAG
Rattus_norvegicus|6243             ATGTTGGCCAACCATCTCCTGGGTAGCAAGGCCATCTCCTTTGGGGGATGTATGGCACAG
Tupaia_belangeri|10243             ATGCTAACTGGCCACCTCTGGGGCAGCAAAGCTATCTCCTTTGGAGGATGCATGACACAG
Tupaia_belangeri|7292              ATGCTAACTGGCCACCTCTCAGGAAGCAAAGCTATCTCCTTTGGAGGATGCATGACACAG
Spermophilus_tridecemlineatus|9004 ATGCTGGCCAATCATCTCCTGGGCAGCAAAGCCATCTCCTTTGAGGGATGCCTGACACAG
Gorilla_gorilla|35143              ATGCTGGCCAACCATCTCTCGGGCAGCAAATCCATCTCTTTTGGGGGATGCCTAACGCAG
Homo_sapiens|32901                 ATGCTGGCCAACCATCTCTTGGGCAGCAAATCCATCTCTTTTGGGGGATGCCTAACGCAG
Pan_troglodytes|15206              ATGCTGGCCAACCATCTCTTGGGCAGCAAATCCATCTCTTTTGGGGGATGCCTAACGCAG
Ochotona_princeps|10800            ATGTTGGCCAACCATCTCCTGGGGAGCAAAGCCATCTCCTTTGCAGGATGCCTAACACAG
Oryctolagus_cuniculus|11080        ATGTTGGTCAACCACCTCTTGGGTAGTAAAGCCATCTCCTTTGGAGGATGCCTAACACAG
Tupaia_belangeri|3035              ATGTTAATCAACCATCTCTTGGGTAGTAAAACCATCTCCTTTGAAGGATGCCTAACACAG
Otolemur_garnettii|658             ATGCTGGTCAACCATCTCTTGGGCAGCAAATCCATCTCCTTTGGGGGATGCCTAACACAG
                                   *** *..  ..  *  *   .*. ** *..   ** ** *:**  *****  * .*.***

Dipodomys_ordii|279                ATGGATTTCATGATATTCTTGGCTAACACAGACAGCTATATCCTGGCTGTGATGGCAGTA
Dipodomys_ordii|842                ATGGACTTCATGTTAGCTTTTGGTAACACTGACAGCTATGTCTTGGCTGCAATGGCAATT
Rattus_norvegicus|6243             ATGTTCTTCATGATAGGATTGGGAAACACAGACAGTTACATACTAGCTGCAATGGCATAT
Tupaia_belangeri|10243             ATGTATTTCATGCTTGCCATGGCTAACACAGACAGCTATATCTTGGCTGTGATGGCGTAT
Tupaia_belangeri|7292              ATGTATTTCATGCTTGCCCTGGGTAACACAGACAGCTATATCTTGGCTGTGATGGCGTAT
Spermophilus_tridecemlineatus|9004 ATGTATTTCATGATAGCTTTAGCCAACACAGATAGCTACATACTGGCGGCCATGGCATAT
Gorilla_gorilla|35143              ATGTATTTCATGATAGACTTGGGTAACACAGACAGCTATACCTTGGCTGCAATGGCATAT
Homo_sapiens|32901                 ATGTATTTCATGATAGCCTTGGGTAACACAGACAGCTATATTTTGGCTGCAATGGCATAT
Pan_troglodytes|15206              ATGTATTTCATGATAGCCTTGGGTAACACAGACAGCTATATTTTGGCTGCAATGGCATAT
Ochotona_princeps|10800            ATGTATTTCATGATCGCCCTGGGTAACACTGACAGCTACATCTTGGCTGCAATGGCCTAT
Oryctolagus_cuniculus|11080        ATGTATTTCATGATAGCCTTGGGTAACACAGATAGCTACATCTTAGCTGCAATGGCCTAT
Tupaia_belangeri|3035              ATGTATTTCATGATATCCTTGGGAAACACAGACAGCTATATTTTGGCTGCAATGGCATAT
Otolemur_garnettii|658             ATGTATTTCATGATAGCTTTGGGTAACACAGACAGCTATATTTTGGCTGCCATGGCATAT
                                   *** : ****** *     * *  *****:** ** ** .   *.** *  *****  ::

Dipodomys_ordii|279                GATCGAGCTGTGGCCATCAGCCGCCCTCTTCATTATACAATGATTATGAGACCCTGTTCT
Dipodomys_ordii|842                GATCGAGCTGTGGCCATCAGCCGTCCTCTTCATTATACCACAATTATGAGCCCAAGATTG
Rattus_norvegicus|6243             GATCGAGCTGTGGCCATCAGCCGCCCACTTCATTATGCAACAATTATGAGTCCACAACTT
Tupaia_belangeri|10243             GACCGGGCTGTGGCCATCAGCCGCCCACTTCATTACATGACGATTATGAGTCTGCGATCT
Tupaia_belangeri|7292              GACCGAGCTGTGGCCATCAGCCGCCCACTTCATTACATGACGATTATGAGTCTGCGATCT
Spermophilus_tridecemlineatus|9004 GACCGAGCCATGGCCATCAGCCGCCCTCTTCATTATACAACCATCATGAGTCCAAGGTCC
Gorilla_gorilla|35143              GATCGAGCTGTGGCCATCAGCCGCCCACTTCACTACACAACAATTATGAGTCCACGGTCT
Homo_sapiens|32901                 GATCGAGCTGTGGCCATCAGCCGCCCACTTCACTACACAACAATTATGAGTCCACGGTCT
Pan_troglodytes|15206              GATCGAGCTGTGGCCATCAGCCGCCCACTTCACTACACAACAATTATGAGTCCACGGTCT
Ochotona_princeps|10800            GACAGGGCTGTAGCCATCAGCCGCCCACTTCACTACACAACAATTATGAGCCCGTGCTCT
Oryctolagus_cuniculus|11080        GATCGAGCCATAGCCATCAGCCGCCCACTTCATTATACAACAATTATGAGTCCACGCTCT
Tupaia_belangeri|3035              GATAGAGCTGTGGCCATCAGTCGCCCACTTCATTATGTAACAATTATAAGCCCACGGTCT
Otolemur_garnettii|658             GATCGTGCTGTGGCCATCAGCCGCCCACTTCATTACACAACAATTATAAGCCCGAAGACT
                                   ** .* ** .*.******** ** **:***** ** .  *  ** **.** *   .    

Dipodomys_ordii|279                TGTGTCCTGATGCTTGTTGCATCTTGGGCAGTTGCCACCATCAATTCTATTCCCCATGCT
Dipodomys_ordii|842                TGTGTTGTGATGGTTGTTGGGTCTTGGGTGGTTGGAAATGCCAATTCACTTTCTCATGCC
Rattus_norvegicus|6243             TGTATCCTGATGGTTGCTGGGTCCTGGGTGGTTGGAAATGGCAACTCACTGCCCCACACC
Tupaia_belangeri|10243             TGTGTCCTGCTAGTTGTTGGGTCTTGGGTGGCTGGAATTGCCAATTCCCTCCCCCACACT
Tupaia_belangeri|7292              TGTGTCCTGCTAGTTGTTGGGTCTTGGGTGGCTGGAATTGCCAATTCCCTCCCCCACACT
Spermophilus_tridecemlineatus|9004 TGTGTCCTGCTGGTGGTTGCTTCCTGGGTGATTGGAAACGCCAATGCCCTTCCTCACACT
Gorilla_gorilla|35143              TGTATCTGGCTTATTGCTGGGTCTTGGGTGATTGGAAATGCCAATGCCCTCCCCCACACT
Homo_sapiens|32901                 TGTATCTGGCTTATTGCTGGGTCTTGGGTGATTGGAAATGCCAATGCCCTCCCCCACACT
Pan_troglodytes|15206              TGTATCTGGCTTATTGCTGGGTCTTGGGTGATTGGAAATGCCAATGCCCTCCCCCACACT
Ochotona_princeps|10800            TGTGTCCTGCTCGTTGCTGGGTCTTGGGTGGTTGGAAACACCAACGCTCTCCCCCACACT
Oryctolagus_cuniculus|11080        TGTATCCTGCTAGTTGTTGGGTCTTGGGTGGTTGGAAACTCCAATGCTCTCCCCCACACT
Tupaia_belangeri|3035              TGTGTCCTACTGGTTGTTGGGTCTTGGGTGGTTGCAAATGCTAATGCCCTCCCCCACACT
Otolemur_garnettii|658             TGTGTTCTGTTAGTTGTTGGGTCTTGGGTGGTTGGGAATGCCAATGCCCTCCCCCACACT
                                   ***.*   . *  * * **  ** **** .. **  *     **  * .*  * ** .* 

Dipodomys_ordii|279                GTATTTACAGCTAGTCTGTCTTTCTGTGAAAACAGGGAAGTGGACAACTTCTACTGTGAC
Dipodomys_ordii|842                CTGCTTACAGCTAGTCTTTCTTTTTGTGGCAACAAGGAAGTGGCCAACTTCTACTGTGAC
Rattus_norvegicus|6243             ATACTCACAGCTAGATTGTCCTTCTGTGGCAACAGGGATGTGGCTAACTTCTACTGTGAC
Tupaia_belangeri|10243             CTCCTCACTGCTAGTCTATCCTTTTGTGGCAACAAGGAAGTCGTCAACTTCTACTGTGAC
Tupaia_belangeri|7292              CTCCTCACTGCTAGTCTGTCCTTTTGTGGCAACAAGGAAGTTGCTAACTTCTACTGTGAC
Spermophilus_tridecemlineatus|9004 CTGCTCACAGCTAGTCTGTCCTTCTGTGGCAGCAAGGAAGTGGCCAACTTCTACTGTGAT
Gorilla_gorilla|35143              CTGCTCACAGCTAGTCTGTCCTTCTGTGGCAACCAGGAAGTGGCCAACTTCTACTGTGAC
Homo_sapiens|32901                 CTGCTCACAGCTAGTCTGTCCTTCTGTGGCAACCAGGAAGTGGCCAACTTCTACTGTGAC
Pan_troglodytes|15206              CTGCTCACAGCTAGTCTGTCCTTCTGTGGCAACCAGGAAGTGGCCAACTTCTACTGTGAC
Ochotona_princeps|10800            CTGCTCACAGCACATCTGTCCTTCTGCGGCAACAGGGAAGTGGCCAATTTCTACTGTGAC
Oryctolagus_cuniculus|11080        CTACTCACAGCTCATCTGTCTTTCTGTGGCAACAGGGAAGTGGCCAACTTCTACTGTGAC
Tupaia_belangeri|3035              CTGCTCACAGCAAGACTGTCTTTCTGTGGCAACAACAAAGTAGCCAATTTCTACTGTGAC
Otolemur_garnettii|658             CTGCTCACAGCTAATCTATCCTTCTGTGGCAACCAGGTGGTGGCCAACTTCTACTGTGAC
                                    *  * **:**:..: * ** ** ** *..*.*.. .: ** *  ** *********** 

Dipodomys_ordii|279                GTTGCTGCTTTGATCAAGCTGGCCTGCTCTGACAACCACTTGAATGTGAAGATGTTGCAC
Dipodomys_ordii|842                ATTATCCCTTTGCTCAAGCTGTCCTGTTCAGACATCCACTTCAATGTGAAGATAATGTAC
Rattus_norvegicus|6243             ATTACGCCTTTGCTCCAGCTGTCCTGTTCTGACATTCGCTTCAATGTGAAGATGATGTAC
Tupaia_belangeri|10243             ATTGCCTCTTTGCTCAAACTGTCCTGTTCTGACATCCGCTTTAACGTGAAGATTATGTAC
Tupaia_belangeri|7292              ATTGCCTCTTTGCTCAAACTGTCCTGTTCTGATATCCGCTTTAATATAAAGATGATGTAT
Spermophilus_tridecemlineatus|9004 ATTTCTCCCTTGCTCAAGCTGTCCTGTTCTGACATACACTTGAACGTGAAGATGATGTAC
Gorilla_gorilla|35143              ATTACCCCCTTGCTGAAGTTATCCTGTTCTGACATCCACTTTCATGTGAAGATGATGTAC
Homo_sapiens|32901                 ATTACCCCCTTGCTGAAGTTATCCTGTTCTGACATCCACTTTCATGTGAAGATGATGTAC
Pan_troglodytes|15206              ATTACCCCCTTGCTGAAGTTATCCTGTTCTGACATCCACTTTCACGTGAAGATGATGTAC
Ochotona_princeps|10800            ATCACCCCTTTGCTCAAGCTTTCCTGCTCTGACACCACCTTTAACGTAAAGATGATGTAT
Oryctolagus_cuniculus|11080        ATTACCCCTTTGCTCAAGCTGTCCTGTTCTGACATAAGCTTTAATGTGAAAATGATGTAT
Tupaia_belangeri|3035              ATCACCCCTTTACTCAAGCTGTCCTGTTCTGACATCCATTTTAACGTGAAGATGATGTAC
Otolemur_garnettii|658             ATTACCCCTTTGCTCAAGCTGTCCTGCTCTGACATCCACTTTAATGTGAAGATGATGTAT
                                   .*     * **..* .*. *  **** **:** *  .  ** .* .*.**.** :** * 

Dipodomys_ordii|279                CTTGGAGCTAGTATTTTCTCATTGCCCTTTCTGTGTATCATTATCTCCTATGTTTGGGTC
Dipodomys_ordii|842                CTTGGGGTTGGCATTTTCTCATTGCCACTGTTTTGCATCATTATCTCCTATGTTCGGGTC
Rattus_norvegicus|6243             TTTGGTGTGGGTGTTTTCTCAGTACCACTGCTATTCATCATCATCTCCTATGTCCGGGTC
Tupaia_belangeri|10243             CTAGGTGCTGGTGTTTTCTCTGTGCCATTACTATGCATCATTATCTCCTATGTCCGAGTC
Tupaia_belangeri|7292              TTAGGTGCTGGTGTTTTCTCTGTGCCTTTACTATGCATCATTATCTCCTATGTCCGAGTC
Spermophilus_tridecemlineatus|9004 CTAGGGGTTGCTGTTTTCTCTGTGCCATTACTGTGCATCGTTGTCTCCTATATTCGTGTC
Gorilla_gorilla|35143              CTAGGGGTTGGCATTTTCTCTGTGCCATTACTATGCATCATTGTCTCCTATATTCGAGTC
Homo_sapiens|32901                 CTAGGGGTTGGCATTTTCTCTGTGCCATTACTATGCATCATTGTCTCCTATATTCGAGTC
Pan_troglodytes|15206              CTAGGGGTTGGCATTTTCTCTGTGCCATTACTATGCATCATTGTCTCCTATATTCGAGTC
Ochotona_princeps|10800            CTAGGGGTTTGTGTTTTCTCAGCACCATTGCTATGTATCATTGTCTCCTACATTCGAGTC
Oryctolagus_cuniculus|11080        CTAGGGGTCGGTGTTTTCTCCGTGCCACTGCTATGCATCGTTATCTCCTATGTCCGAGTC
Tupaia_belangeri|3035              CTAGGGGTTGGTGTTTTCTCTGTGCCATTACTATGCATCATTATCTCCTATATTCATGTC
Otolemur_garnettii|658             CTAGGGGTTGGTGTTTTCTCTATTCCCTTATTGTTCATAATTATCTCTTACATTCATGTC
                                    *:** *     .*******    **  *  * *  **..* .**** ** .*  . ***

Dipodomys_ordii|279                TTTGCCACTGTCTTACGGGTTCCATCTACTAAGGGCATACTCAAAGCCTTCTCCACCTGT
Dipodomys_ordii|842                TTTGCCACTGTCTTAAGGGTTCCATCTACTAAGGGCATACTCAAAGCCTTCTCCACCTGT
Rattus_norvegicus|6243             TTTTCCACAGTCTTGCGGGTTCCATCCACCAAGGGCTTCCTCAAGGCCTTGTCCACCTGT
Tupaia_belangeri|10243             TTTTCCACAGTCTTACGAGTTCCATCCACCAAGGGTGTGCTCAAAGCCTTCTCCACCTGT
Tupaia_belangeri|7292              TTTTCCACAGTCTTACGAGTTCCATCCACCAAGGGTGTGCTCAAAGCCTTCTCCACCTGT
Spermophilus_tridecemlineatus|9004 TTTTCCACGGTCCTTCGTGTTCCATCCACGAAGGGTGTACGCAAAGCCTTCTCCACCTGT
Gorilla_gorilla|35143              TTCTCCACAGTCTTCCAGGTTCCTTCCACCAAGGGCGTGCTCAAGGCCTTCTCCACCTGT
Homo_sapiens|32901                 TTCTCCACAGTCTTCCAGGTTCCTTCCACCAAGGGCGTGCTCAAGGCCTTCTCCACCTGT
Pan_troglodytes|15206              TTCTCCACAGTCTTTCAGGTTCCTTCCACCAAGGGCGTGCTCAAGGCCTTCTCCACCTGT
Ochotona_princeps|10800            TTTTCCACAGTCTTACGGGTTCCTTCCACGAAGGGTGTACTGAAAGCCTTCTCCACCTGC
Oryctolagus_cuniculus|11080        TTTGCCACAGTCTTACGGGTTCCCTCCACTAAGGGTATACTTAAAGCCTTCTCCACCTGT
Tupaia_belangeri|3035              TTTTCCACAGTCTTACGAGTTCCATCCACCAAGGGTGTGCTCAAAGCCTTCTCCACCTGT
Otolemur_garnettii|658             TTTTCCACAGTCTTGCAGGTTCCATCCACTAAGGGTGTTCTCAAAGCTTTCTCCACCTGT
                                   **  **** *** * .. ***** ** ** *****  * *  **.** ** ******** 

Dipodomys_ordii|279                GGCTCTCACCTCACTGTGGTTTCTTTGTATTATGGGACGGTCATGGGCATGTATTTACGG
Dipodomys_ordii|842                GGCTCTCACCTCACTGTGGTTTCTTTGTATTATGGGACAATCATGGGCATGTACTCCCGA
Rattus_norvegicus|6243             GGCTCACACCTGACAGTGGTGTCTTTGTATTATGGGACAGTCATGGGCATGTATTTCAGG
Tupaia_belangeri|10243             GGATCTCACCTCACAGTAGTTTCTTTGTATTATGGAACAGTCATGGGCATGTATTGCCGT
Tupaia_belangeri|7292              GGCTCCCACCTCACAGTAGTTTCTTTGTATTATGGGACAGTCATGGGCATGTATTTCCGC
Spermophilus_tridecemlineatus|9004 GGATCTCACCTCACAGCTGTTTCCTTGTACTATGGGACAGTCATGGGCATGTATTTCCGA
Gorilla_gorilla|35143              GGTTCCCACCTCACGGTTGTCTCTTTGTATTATGGTACAGTCATGGGCATGTATTTCCGC
Homo_sapiens|32901                 GGTTCCCACCTCACGGTTGTCTCTTTGTATTATGGTACAGTCATGGGCACGTATTTCCGC
Pan_troglodytes|15206              GGTTCCCACCTCACGGTTGTCTCTTTGTATTATGGTACAGTCATGGGCATGTATTTCCGC
Ochotona_princeps|10800            GGTTCCCACCTCACAGTCGTCTCTCTGTACTACGGGACAGTCATGGGCATGTATTTCCGC
Oryctolagus_cuniculus|11080        GGTTCCCACCTTACAGTTGTTTCTTTGTACTATGGGACAGTCATGGGCATGTATTTCCGC
Tupaia_belangeri|3035              GGATCCCACCTCACAGTAGTTTCTTTGTATTATGGGACAGTCATGGGCATGTATTTCCGT
Otolemur_garnettii|658             GGTTCTCACCTCACAGTTGTTTCATTGTATTATGGGACAGTCATGGGCATGTATTTCCGC
                                   ** ** ***** ** *  ** **  **** ** ** **..********* *** * ..* 

Dipodomys_ordii|279                CCTCTGACCAGTTACAGCCAGAAAGATGCAGTGATTACTGTGATGTACACAGCAGTGACC
Dipodomys_ordii|842                CCTCTGACCAGTTACAGCCTGAAGGATGCAGTGATTACTGTGATGTACACAGCTGTGACC
Rattus_norvegicus|6243             CCTCTGGCTAGTTACAGTCTGAAGCATGCACTGATAACTGTGATGTACACAACAGTGACC
Tupaia_belangeri|10243             CCTCTGACCAGTTACAGCCTAAAGGATGCAGTGATAACTGTGATGTACATTGCAGTGACC
Tupaia_belangeri|7292              CCTCTGACCAATTACAGCCTGAAGGATGCAGTGATAACTGTGATGTACATTGCAGTGACC
Spermophilus_tridecemlineatus|9004 CCTCTGACCACTTACAGCCTAAAGGATGCTGTGCTTGCTGTGATGTACATGACAGTGACC
Gorilla_gorilla|35143              CCTTTGACCAATTATAGCCTAAAAGACGCAGTGATCACTGTAATGTGCACGGCAGTGACC
Homo_sapiens|32901                 CCTTTGACCAATTATAGCCTAAAAGACGCAGTGATCACTGTAATGTACACGGCAGTGACC
Pan_troglodytes|15206              CCTTTGACCAATTATAGCCTAAAAGACGCAGTGATCACTGTAATGTACACGGCAGTGACC
Ochotona_princeps|10800            CCCCTGACCACTTACAGCCTGAAACACGCAGTGATCACTGTGATGTACATGGCAGTGACC
Oryctolagus_cuniculus|11080        CCCCTGACCAGTTACAGCCTAAAGGATGCAGTGGTGACTGTGATGTACATGGCAGTGACC
Tupaia_belangeri|3035              CCTCTTACCAGTTACAGCCTGAAGGATGCAGTGATAACTGTGATGTATATGGCAGTGACC
Otolemur_garnettii|658             CCTCTGACCAGTTACAGTCTAAAAGATGCAGTGCTAACTGTGATGTATATGGCAGTGACC
                                   **  * .* * *** ** *:.**. * **: ** * .****.****. *  .*:******

Dipodomys_ordii|279                CCAATGTTAAATCCTTTCATCTACAGTCTGAGAAACCGGGACATGAAGGCAGCTGTGGGG
Dipodomys_ordii|842                CCAATGTTAAATCCTTTCATTTACAGTCTGAGAAACCGGGACATGAAGGCAGCTCTGGGG
Rattus_norvegicus|6243             CCAATGCTGAACCCTTTCATCTACAGCCTTAGGAACCGTGACATGAAGGCTGCTTTGAAG
Tupaia_belangeri|10243             CCAATGCTAAATCCTTTCATCTACAGTCTGAGAAACCGGGACATGAAAGCTGCCCTATGG
Tupaia_belangeri|7292              CCAATGCTAAATCCTTTCATCTATAGTCTGAGAAACCGGGACATGAAGGCTGCCCTGTGG
Spermophilus_tridecemlineatus|9004 CCAATGTTAAATCCTTTCATCTACAGTCTGAGAAACCAAGACATGAAGGCTGCTCTGAAG
Gorilla_gorilla|35143              CCAATGTTAAATCCTTTCATCTGCAGTCTGAGAAATCGGGACATGAAGGCTGCCCTGCGG
Homo_sapiens|32901                 CCAATGTTAAATCCTTTCATCTACAGTCTGAGAAATCGGGACATGAAGGCTGCCCTGCGG
Pan_troglodytes|15206              CCAATGTTAAATCCTTTCATCTACAGTCTGAGAAATCGGGACGTGAAGGCTGCCCTGCGG
Ochotona_princeps|10800            CCAATGCTAAATCCTTTCATCTACAGTCTGAGGAACCGGGACATGAAGGCTGCTCTGGGA
Oryctolagus_cuniculus|11080        CCAATGTTAAATCCTTTCATCTATAGCCTGAGAAACCAGGACATGAAAGCTGCTCTGGGA
Tupaia_belangeri|3035              CCAATGTTAAATCCTTTCATCTATAGTCTGAGAAACCGGGACATGAAGGCAGCTCTATAT
Otolemur_garnettii|658             CCAATGTTAAATCCTTTCATTTATAGTCTCAGAAATAGGGACATGAAGTCTTCTTTGAGA
                                   ****** *.** ******** *. ** ** **.** .. ***.****. *: *  *. . 

Dipodomys_ordii|279                AAACTCTTTAGTAGAAGT------TCTTCATCC------
Dipodomys_ordii|842                AAACTCTTTGGCAGAACT------TCTTCATCT------
Rattus_norvegicus|6243             AAACTTTTCCACCGCACCTCCTTCTTATCCCCCATGTGA
Tupaia_belangeri|10243             AAACTCTTCAGCAAGAAA------ATCTCCTCA---TAA
Tupaia_belangeri|7292              AAACTCCTAAGCAAGAAA------TTCTCCTCAGAA---
Spermophilus_tridecemlineatus|9004 AAACTCTTTCACAGAAGA------AGCTCTTCA---TAA
Gorilla_gorilla|35143              AAACTCTTCAACAAGAGA------ATCTCCTCG---TAA
Homo_sapiens|32901                 AAACTCTTCAACAAGAGA------ATCTCCTCG---TAA
Pan_troglodytes|15206              AAACTCTTCAACAAGAGA------ATCTCCTCG---TAA
Ochotona_princeps|10800            AAGCTCGTCAGGAAGAGA------ACCTCAGCACAG---
Oryctolagus_cuniculus|11080        AAACTCTTCAGTAAGAGA------ACTTCTTCA---TAA
Tupaia_belangeri|3035              AAACTCTTCAGCAAGAAA------ATATCCTCACAA---
Otolemur_garnettii|658             AAACTCTTCAGCATGAGA------ATCTCCACA---TAA
                                   **.**  *  . .  *        :  **  *       

multiple sequence alignment in CLUSTALW format


Dipodomys_ordii|260                MREENQSAATEFILLGVTGQQEQEDIFFILFLLIYPITLVGNMLIILAILSDGRLHNPMY
Dipodomys_ordii|792                MREENQSATTDFILLGVTGQQEQEDIFFILFLLIYPITLVGNMLIILAILSDGRLHNPMY
Rattus_norvegicus|32918            MREENESSTTEFTLLGVTRQREQEYFFFILFLFIYPITVFGNTLIILAIHSDIRLHNPMY
Tupaia_belangeri|8881              MREVNQSYTSEFILLGVNDQQEQED-FFILFLFIYPITLIGNLLIILAVYSDSHLHNPMY
Tupaia_belangeri|6317              MREVNQSYTLEFILLGVNDQQEQED-FFIFFLFTYPITLIGNLLIILAIYSDSHLHNPMY
Spermophilus_tridecemlineatus|8087 MREGNQSSTMEFILLGVTGQQEQEDFFFILFLFIYPITVVGNLLIILAILSDSHLHNPMY
Gorilla_gorilla|27050              MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVHLHNPMY
Homo_sapiens|54451                 MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVRLHNPMY
Pan_troglodytes|32939              MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVHLHNPMY
Ochotona_princeps|9400             --------------------------FFILFLLIYPITLIGNTLIILAIHSDTRLHNPMY
Oryctolagus_cuniculus|15038        MREENQSSTLDFILLGITGRQEQEDFFFILFLFIYPITLIGNMLIILAIRSDIRLHNPMY
Tupaia_belangeri|2645              MKEENQSSVLEFILLGVTGQKKQENFFFILFLFIYPITVTGNLLIILAIHADSRLHNPMY
Otolemur_garnettii|569             MREENQSSTLEFILLGVTDQQKQEDFFFFLFLFIYPITLTGNLLIILAIHSDIRLHNPMY
                                                             *:::**: ****: ** **:**: :* :******

Dipodomys_ordii|260                FFLANLSLVDIFFSSVTIPKMLVNHLVGSRVISFAGCFTQMDFMIFLANTDSYILAVMAV
Dipodomys_ordii|792                FFLANLSLVDIFFSSVTIPKMLANYFLESKTISYAGCFTQMDFMLAFGNTDSYVLAAMAI
Rattus_norvegicus|32918            FFLANLSLVDIFFSSVTIPKMLANHLLGSKAISFGGCMAQMFFMIGLGNTDSYILAAMAY
Tupaia_belangeri|8881              FFLANLSLVDIFFSSVTLPKMLTGHLWGSKAISFGGCMTQMYFMLAMANTDSYILAVMAY
Tupaia_belangeri|6317              FFLANLSLVDIFFSSVTVPKMLTGHLSGSKAISFGGCMTQMYFMLALGNTDSYILAVMAY
Spermophilus_tridecemlineatus|8087 FLLANLSFVDIFFSSVTIPKMLANHLLGSKAISFEGCLTQMYFMIALANTDSYILAAMAY
Gorilla_gorilla|27050              FLLANLSLVDIFFSSVTIPKMLANHLSGSKSISFGGCLTQMYFMIDLGNTDSYTLAAMAY
Homo_sapiens|54451                 FLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAY
Pan_troglodytes|32939              FLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAY
Ochotona_princeps|9400             FLLANLSLVDIFFSSVTVPKMLANHLLGSKAISFAGCLTQMYFMIALGNTDSYILAAMAY
Oryctolagus_cuniculus|15038        FFLANLSLVDIFFSSVTIPKMLVNHLLGSKAISFGGCLTQMYFMIALGNTDSYILAAMAY
Tupaia_belangeri|2645              FFLANLSFVDIFFSSVSIPKMLINHLLGSKTISFEGCLTQMYFMISLGNTDSYILAAMAY
Otolemur_garnettii|569             FFLANLSLVDIFFSSVTIPKMLVNHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAY
                                   *:*****:********::**** .::  *: **: **::** **: :.***** **.** 

Dipodomys_ordii|260                DRAVAISRPLHYTMIMRPCSCVLMLVASWAVATINSIPHAVFTASLSFCENREVDNFYCD
Dipodomys_ordii|792                DRAVAISRPLHYTTIMSPRLCVVMVVGSWVVGNANSLSHALLTASLSFCGNKEVANFYCD
Rattus_norvegicus|32918            DRAVAISRPLHYATIMSPQLCILMVAGSWVVGNGNSLPHTILTARLSFCGNRDVANFYCD
Tupaia_belangeri|8881              DRAVAISRPLHYMTIMSLRSCVLLVVGSWVAGIANSLPHTLLTASLSFCGNKEVVNFYCD
Tupaia_belangeri|6317              DRAVAISRPLHYMTIMSLRSCVLLVVGSWVAGIANSLPHTLLTASLSFCGNKEVANFYCD
Spermophilus_tridecemlineatus|8087 DRAMAISRPLHYTTIMSPRSCVLLVVASWVIGNANALPHTLLTASLSFCGSKEVANFYCD
Gorilla_gorilla|27050              DRAVAISRPLHYTTIMSPRSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCD
Homo_sapiens|54451                 DRAVAISRPLHYTTIMSPRSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCD
Pan_troglodytes|32939              DRAVAISRPLHYTTIMSPRSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCD
Ochotona_princeps|9400             DRAVAISRPLHYTTIMSPCSCVLLVAGSWVVGNTNALPHTLLTAHLSFCGNREVANFYCD
Oryctolagus_cuniculus|15038        DRAIAISRPLHYTTIMSPRSCILLVVGSWVVGNSNALPHTLLTAHLSFCGNREVANFYCD
Tupaia_belangeri|2645              DRAVAISRPLHYVTIISPRSCVLLVVGSWVVANANALPHTLLTARLSFCGNNKVANFYCD
Otolemur_garnettii|569             DRAVAISRPLHYTTIISPKTCVLLVVGSWVVGNANALPHTLLTANLSFCGNQVVANFYCD
                                   ***:********  *:    *: ::..**. .  *::.*:::** **** .. * *****

Dipodomys_ordii|260                VAALIKLACSDNHLNVKMLHLGASIFSLPFLCIIISYVWVFATVLRVPSTKGILKAFSTC
Dipodomys_ordii|792                IIPLLKLSCSDIHFNVKIMYLGVGIFSLPLFCIIISYVRVFATVLRVPSTKGILKAFSTC
Rattus_norvegicus|32918            ITPLLQLSCSDIRFNVKMMYFGVGVFSVPLLFIIISYVRVFSTVLRVPSTKGFLKALSTC
Tupaia_belangeri|8881              IASLLKLSCSDIRFNVKIMYLGAGVFSVPLLCIIISYVRVFSTVLRVPSTKGVLKAFSTC
Tupaia_belangeri|6317              IASLLKLSCSDIRFNIKMMYLGAGVFSVPLLCIIISYVRVFSTVLRVPSTKGVLKAFSTC
Spermophilus_tridecemlineatus|8087 ISPLLKLSCSDIHLNVKMMYLGVAVFSVPLLCIVVSYIRVFSTVLRVPSTKGVRKAFSTC
Gorilla_gorilla|27050              ITPLLKLSCSDIHFHVKMMYLGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTC
Homo_sapiens|54451                 ITPLLKLSCSDIHFHVKMMYLGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTC
Pan_troglodytes|32939              ITPLLKLSCSDIHFHVKMMYLGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTC
Ochotona_princeps|9400             ITPLLKLSCSDTTFNVKMMYLGVCVFSAPLLCIIVSYIRVFSTVLRVPSTKGVLKAFSTC
Oryctolagus_cuniculus|15038        ITPLLKLSCSDISFNVKMMYLGVGVFSVPLLCIVISYVRVFATVLRVPSTKGILKAFSTC
Tupaia_belangeri|2645              ITPLLKLSCSDIHFNVKMMYLGVGVFSVPLLCIIISYIHVFSTVLRVPSTKGVLKAFSTC
Otolemur_garnettii|569             ITPLLKLSCSDIHFNVKMMYLGVGVFSIPLLFIIISYIHVFSTVLQVPSTKGVLKAFSTC
                                   : .*::*:***  :::*::::*. :** *:: *::**: **:**::******. **:***

Dipodomys_ordii|260                GSHLTVVSLYYGTVMGMYLRPLTSYSQKDAVITVMYTAVTPMLNPFIYSLRNRDMKAAVG
Dipodomys_ordii|792                GSHLTVVSLYYGTIMGMYSRPLTSYSLKDAVITVMYTAVTPMLNPFIYSLRNRDMKAALG
Rattus_norvegicus|32918            GSHLTVVSLYYGTVMGMYFRPLASYSLKHALITVMYTTVTPMLNPFIYSLRNRDMKAALK
Tupaia_belangeri|8881              GSHLTVVSLYYGTVMGMYCRPLTSYSLKDAVITVMYIAVTPMLNPFIYSLRNRDMKAALW
Tupaia_belangeri|6317              GSHLTVVSLYYGTVMGMYFRPLTNYSLKDAVITVMYIAVTPMLNPFIYSLRNRDMKAALW
Spermophilus_tridecemlineatus|8087 GSHLTAVSLYYGTVMGMYFRPLTTYSLKDAVLAVMYMTVTPMLNPFIYSLRNQDMKAALK
Gorilla_gorilla|27050              GSHLTVVSLYYGTVMGMYFRPLTNYSLKDAVITVMCTAVTPMLNPFICSLRNRDMKAALR
Homo_sapiens|54451                 GSHLTVVSLYYGTVMGTYFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDMKAALR
Pan_troglodytes|32939              GSHLTVVSLYYGTVMGMYFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDVKAALR
Ochotona_princeps|9400             GSHLTVVSLYYGTVMGMYFRPLTTYSLKHAVITVMYMAVTPMLNPFIYSLRNRDMKAALG
Oryctolagus_cuniculus|15038        GSHLTVVSLYYGTVMGMYFRPLTSYSLKDAVVTVMYMAVTPMLNPFIYSLRNQDMKAALG
Tupaia_belangeri|2645              GSHLTVVSLYYGTVMGMYFRPLTSYSLKDAVITVMYMAVTPMLNPFIYSLRNRDMKAALY
Otolemur_garnettii|569             GSHLTVVSLYYGTVMGMYFRPLTSYSLKDAVLTVMYMAVTPMLNPFIYSLRNRDMKSSLR
                                   *****.*******:** * ***:.** *.*:::**  :********* ****:*:*::: 

Dipodomys_ordii|260                KLFSRS--SSS-
Dipodomys_ordii|792                KLFGRT--SSS-
Rattus_norvegicus|32918            KLFHRTSFLSPM
Tupaia_belangeri|8881              KLFSKK--ISS-
Tupaia_belangeri|6317              KLLSKK--FSSE
Spermophilus_tridecemlineatus|8087 KLFHRR--SSS-
Gorilla_gorilla|27050              KLFNKR--ISS-
Homo_sapiens|54451                 KLFNKR--ISS-
Pan_troglodytes|32939              KLFNKR--ISS-
Ochotona_princeps|9400             KLVRKR--TSAQ
Oryctolagus_cuniculus|15038        KLFSKR--TSS-
Tupaia_belangeri|2645              KLFSKK--ISSQ
Otolemur_garnettii|569             KLFSMR--IST-
                                   **.      *.