Orthologs Set ID: EOG4003HN


Orthology Database
OrthoDB4
Gene Symbol(s)
MVB12B,FAM125B

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 48587 48, 56, 135, 153, 243, 357, 454, 584
Cavia porcellus 11578 249, 357, 454, 584, 713, 808, 864, 924
Dipodomys ordii 11133 249, 357, 454, 584, 713, 808, 864, 924
Gorilla gorilla 16636 119, 249, 357, 454, 584, 713, 808, 864, 924
Homo sapiens 95232 126, 249, 357, 454, 584
Homo sapiens 95233 126, 249, 357, 454, 584, 713, 808, 864, 924
Microcebus murinus 11039 126, 249, 357, 454, 584, 713, 808, 864, 924
Mus musculus 21630 126, 249, 357, 454, 584, 713, 808, 864, 924
Ochotona princeps 2957 249, 357, 454, 584, 713, 808, 864, 924
Oryctolagus cuniculus 19900 120, 249, 357, 454, 584, 713, 808, 864, 924
Otolemur garnettii 9113 197, 249, 357, 454, 584, 713, 808, 864, 924
Pan troglodytes 37656 126, 249, 357, 454, 584, 713, 808, 864, 924
Rattus norvegicus 21570 126, 249, 357, 454, 584, 713
Spermophilus tridecemlineatus 9584 183, 198, 234, 249, 357, 411, 454, 584, 713
Tarsius syrichta 4858 249, 357, 454, 584, 713, 808, 864, 924
Tupaia belangeri 6975 249, 357, 454, 584, 713, 808, 864

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 48587 ENSCJAT00000013818 100392128 ENSCJAG00000007059 MVB12B calJac3
Cavia porcellus 11578 ENSCPOT00000000710 100728526 ENSCPOG00000000705 MVB12B cavPor3
Dipodomys ordii 11133 ENSDORT00000006703 ENSDORG00000006706 Mvb12b dipOrd1
Gorilla gorilla 16636 ENSGGOT00000015486 101132337 ENSGGOG00000015432 MVB12B gorGor3
Homo sapiens 95232 ENST00000436593, NM_001011703 89853 ENSG00000196814 FAM125B hg19,GRCh37
Homo sapiens 95233 ENST00000361171, NM_033446 89853 ENSG00000196814 MVB12B hg19,GRCh37
Microcebus murinus 11039 ENSMICT00000010275 ENSMICG00000010281 MVB12B micMur1
Mus musculus 21630 ENSMUST00000041555, NM_175184 72543 ENSMUSG00000038740 Mvb12b mm9
Ochotona princeps 2957 ENSOPRT00000002996 ENSOPRG00000003004 MVB12B OchPri2.0
Oryctolagus cuniculus 19900 ENSOCUT00000014335 100359243 ENSOCUG00000014336 MVB12B oryCun2.0
Otolemur garnettii 9113 ENSOGAT00000008771 100948889 ENSOGAG00000008766 MVB12B otoGar1
Pan troglodytes 37656 ENSPTRT00000039539 739730 ENSPTRG00000021375 MVB12B panTro2
Rattus norvegicus 21570 ENSRNOT00000023172 362118 ENSRNOG00000017172 Mvb12b rn4
Spermophilus tridecemlineatus 9584 ENSSTOT00000009585 speTri1
Tarsius syrichta 4858 ENSTSYT00000004267 103262061 ENSTSYG00000004283 MVB12B tarSyr1
Tupaia belangeri 6975 ENSTBET00000006976 ENSTBEG00000006986 MVB12B tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 39692 ENSCJAP00000013108 100392128 ENSCJAG00000007059 MVB12B calJac3
Cavia porcellus 9058 ENSCPOP00000000627 100728526 ENSCPOG00000000705 MVB12B cavPor3
Dipodomys ordii 10457 ENSDORP00000006281 ENSDORG00000006706 Mvb12b dipOrd1
Gorilla gorilla 13356 ENSGGOP00000015055 101132337 ENSGGOG00000015432 MVB12B gorGor3
Homo sapiens 71824 ENSP00000354772 89853 ENSG00000196814 MVB12B hg19,GRCh37
Homo sapiens 71826 ENSP00000401379 hg19,GRCh37
Microcebus murinus 9361 ENSMICP00000009357 ENSMICG00000010281 MVB12B micMur1
Mus musculus 1399 ENSMUSP00000048901 72543 ENSMUSG00000038740 Mvb12b mm9
Ochotona princeps 2581 ENSOPRP00000002759 ENSOPRG00000003004 MVB12B OchPri2.0
Oryctolagus cuniculus 8084 ENSOCUP00000012322 100359243 ENSOCUG00000014336 MVB12B oryCun2.0
Otolemur garnettii 7861 ENSOGAP00000007863 100948889 ENSOGAG00000008766 MVB12B otoGar1
Pan troglodytes 22926 ENSPTRP00000036528 739730 ENSPTRG00000021375 MVB12B panTro2
Rattus norvegicus 10941 ENSRNOP00000023172 362118 ENSRNOG00000017172 Mvb12b rn4
Spermophilus tridecemlineatus 8599 ENSSTOP00000008598 speTri1
Tarsius syrichta 4447 ENSTSYP00000003912 103262061 ENSTSYG00000004283 MVB12B tarSyr1
Tupaia belangeri 6036 ENSTBEP00000006025 ENSTBEG00000006986 MVB12B tupBel1

multiple sequence alignment in CLUSTALW format


Dipodomys_ordii|11133              ------------------------------------------------------------
Callithrix_jacchus|48587           ------------------------------------GAGCCCTGTGGGTGGAGCCCCTCA
Ochotona_princeps|2957             ------------------------------------------------------------
Spermophilus_tridecemlineatus|9584 ------------------------------------------------------------
Otolemur_garnettii|9113            ------------------------------------------------------------
Mus_musculus|21630                 ---ATGAGAAGCTGCTTCTGCGTCAGACGGAGCCGGGACCCGCCGCCGCCGCAGCCGCCG
Rattus_norvegicus|21570            ---ATGAGAAGCTGCTTCTGCGTGAGACGGAGCCGGGACCCGCCGCCGCCGCAGCCGCCG
Microcebus_murinus|11039           GGCTCGCGCTCGGGCTGCGGCGCCGGCTCCCGCCGCCTGGGCCCCGGGCCCGGCCCCTCC
Oryctolagus_cuniculus|19900        ---------------------------------------------CCTCCTCAGCCTCCC
Cavia_porcellus|11578              ------------------------------------------------------------
Tarsius_syrichta|4858              ------------------------------------------------------------
Homo_sapiens|95233                 ---ATGAGAAGCTGCTTCTGCGTGAGACGGAGCCGGGACccgccgccgccgcagccaccg
Homo_sapiens|95232                 ---ATGAGAAGCTGCTTCTGCGTGAGACGGAGCCGGGACccgccgccgccgcagccaccg
Pan_troglodytes|37656              ---ATGAGAAGCTGCTTCTGCGTGAGACGGAGCCGGGACccgccgccgccgcagccaccg
Gorilla_gorilla|16636              ------------------------------------------------------CCCCCA
Tupaia_belangeri|6975              ------------------------------------------------------------
                                                                                               

Dipodomys_ordii|11133              ------------------------------------------------------------
Callithrix_jacchus|48587           TGGGTGGGGGCCTGC------------------------------------TGGCTGGTG
Ochotona_princeps|2957             ------------------------------------------------------------
Spermophilus_tridecemlineatus|9584 ------------------------------------------------------------
Otolemur_garnettii|9113            ------------------------------------------------------------
Mus_musculus|21630                 CCG------------------------------------------------CCCCAGCGG
Rattus_norvegicus|21570            CCG------------------------------------------------CCCCAGCGG
Microcebus_murinus|11039           CGCGCCGCCCGGGCGATGAGAAGCTGCTTCTGCGTGAGACGGAGCCGGGACCCGCCGCCG
Oryctolagus_cuniculus|19900        CCT------------------------------------------------GGGCTCCAG
Cavia_porcellus|11578              ---------------------------------------------------CCTTTTCTG
Tarsius_syrichta|4858              ------------------------------------------------------------
Homo_sapiens|95233                 ccgccgccg------------------------------------------ccCCAGCGG
Homo_sapiens|95232                 ccgccgccg------------------------------------------ccCCAGCGG
Pan_troglodytes|37656              ccgccgccg------------------------------------------ccCCAGCGG
Gorilla_gorilla|16636              CCACCGCCC------------------------------------------CCTCCCAGG
Tupaia_belangeri|6975              ------------------------------------------------------------
                                                                                               

Dipodomys_ordii|11133              ------AACCAGTCCACCATGCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Callithrix_jacchus|48587           GGCTACATAGTGGGGAGCAGGAGCTGGCTCAGGTCATGGGCTGGTCCA---CCCTGGAGC
Ochotona_princeps|2957             ------GACCAGCCCACCATGCCTGAAGTGAAAGACCTTTCAGAAGCCTTGCCAGAGACT
Spermophilus_tridecemlineatus|9584 ------------------------------------------GAAGCCTTGCCAGAGACG
Otolemur_garnettii|9113            ------GACCAAGCCACCATGCCTGAAGTCAAAGACCTTTCAGAAGCCTTGCCAGAAACG
Mus_musculus|21630                 GGAACAGACCAAGCCACCATGCCCGAAGTCAAGGAGCTTTCAGAAGCCTTGCCAGAGACA
Rattus_norvegicus|21570            GGAACAGACCAAGCCACCATGCCTGAAGTCAAAGAGCTTTCAGAAGCCTTGCCAGAGACA
Microcebus_murinus|11039           CCGCAGGACCTGTCCACCATGCCTGAAGTCAAAGACCTTTCGGAAGCCTTGCCGGAAACG
Oryctolagus_cuniculus|19900        AACCAGGACCAGTCCACCATGCCTGAAGTGAAAGACCTCTCGGAAGCCTTGCCGGACACC
Cavia_porcellus|11578              AACCAGGAACAATCCACCATGCCTGAAGTTAAAGACCTTTCGGAAGCCTTGCCAGAGATG
Tarsius_syrichta|4858              ------GATCAATCCACCATGCCTGAAGTCAAAGACCTCTCAGAAGCCTTGCCAGAAGCA
Homo_sapiens|95233                 GGAACAGACCAGTCCACCATGCCTGAAGTCAAAGACCTCTCAGAAGCCTTGCCAGAAACG
Homo_sapiens|95232                 GGAACAGACCAGTCCACCATGCCTGAAGTCAAAGACCTCTCAGAAGCCTTGCCAGAAACG
Pan_troglodytes|37656              GGAACAGACCAGTCCACCATGCCTGAAGTCAAAGACCTCTCAGAAGCCTTGCCAGAAACG
Gorilla_gorilla|16636              AACCAGGACCAGTCCACCATGCCTGAAGTCAAAGACCTCTCAGAAGCCTTGCCAGAAACG
Tupaia_belangeri|6975              ------AACCAATCCACCATGCCTGAAGTTAAAGACCTTTCAGAAGCCTTGCCAGACACG
                                                                             .                 

Dipodomys_ordii|11133              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Callithrix_jacchus|48587           TCTCGAGAGACAAAGCCCTCAGTGTCCAGCATTCAGGGGAGGCTGCGGGAAGCAGGAAGG
Ochotona_princeps|2957             TCCCTGGACCCCCTCACAGGGGTCGGGGTGGTAGCCTCACGGAACCGCGCCCCCACAGGC
Spermophilus_tridecemlineatus|9584 TCA------CCCATCACG---GTCGGGGTGGTGGCTTCCCGGAACCGAGCCCAG---GGC
Otolemur_garnettii|9113            TCAATGGACCCCATCACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|21630                 CCGATGGACCCCATCACGGGAGTTGGGGTGGTGGCTTCCCGGAACCGAGCACCAACAGGC
Rattus_norvegicus|21570            CCAATGGACCCCATCACGGGAGTCGGGGTGGTAGCCTCCCGGAACCGAGCGCCGACAGGC
Microcebus_murinus|11039           TCCATGGACCCCATCACAGGCGTCGGGGTGGTGGCTTCTCGGAACCGAGCCCCGACGGGC
Oryctolagus_cuniculus|19900        TCGATGGACCCCCTCACGGGGGTCGGGGTGGTGGCTTCGCGGAACCGCGCCCCGACAGGC
Cavia_porcellus|11578              TCGATGGACCCCATCACGGGAGTCGGGGTGGTGGCTTCCCGGAACCGGGCCCCAACGGGC
Tarsius_syrichta|4858              TCAATGGATCCCATCACGGGAGTTGGGGTGGTGGCTTCTCGGAACCGAGCCCCTACAGGC
Homo_sapiens|95233                 TCAATGGATCCCATCACGGGAGTCGGGGTGGTGGCTTCTCGGAACCGAGCCCCGACAGGC
Homo_sapiens|95232                 TCAATGGATCCCATCACGGGAGTCGGGGTGGTGGCTTCTCGGAACCGAGCCCCGACAGGC
Pan_troglodytes|37656              TCAATGGATCCCATCACGGGAGTCGGGGTGGTGGCTTCTCGGAACCGAGCCCCGACAGGC
Gorilla_gorilla|16636              TCAATGGATCCCATCACGGGAGTCGGGGTGGTGGCTTCTCGGAACCGAGCCCCGACAGGT
Tupaia_belangeri|6975              TCCATGGATCCCATCACGGGAGTCGGGGTGGTGGCTTCTCGGAACCGAGCCCCGACTGGC
                                                        ..        .        ..    . .         . 

Dipodomys_ordii|11133              NNNNNNNNNGTGGCACAGACAGCAGATGGCGTGGATGTTGACCTCGGGAAGGACGGCTTA
Callithrix_jacchus|48587           AGG------GTTGCACAGACAGCAGATGGTGTGGATGCCGACCTCTGGAAAGACGGCTTA
Ochotona_princeps|2957             TACGACGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|9584 TATGATGTAGTGGCACAGACGGCAGATGGCGTGGACGCTGACCTCTGGAAAGACGGCTTG
Otolemur_garnettii|9113            NNNNNNNNNGTTGCACAGACGGCAGATGGTGTGGATGCTGACCTCTGGAAAGACGGCCTA
Mus_musculus|21630                 TACGACGTGGTTGCGCAGACAGCAGATGGCGTGGATGCTGATCTCTGGAAGGACGGCTTA
Rattus_norvegicus|21570            TACGATGTGGTTGCACAGACAGCAGATGGTGTGGACGCTGACCTCTGGAAGGACGGCTTA
Microcebus_murinus|11039           TACGATGTAGTTGCGCAGACGGCAGATGGTGTGGATGCTGACCTCTGGAAAGACGGCTTA
Oryctolagus_cuniculus|19900        TACGACGTGGTCGCACAGACGGCAGATGGCGTGGACGCTGACCTCTGGAAAGACGGCTTA
Cavia_porcellus|11578              TATGATGTAGTTGCGCAGACAGCAGATGGTGTGGACGCTGACCTCTGGAAAGACGGCTTG
Tarsius_syrichta|4858              TATGATGTANNNGCACAGACGGCAGATGGTGTGGATGCTGACCTCTGGAAAGACGGATTA
Homo_sapiens|95233                 TATGACGTAGTTGCACAGACAGCAGATGGTGTGGATGCTGACCTCTGGAAAGACGGCTTA
Homo_sapiens|95232                 TATGACGTAGTTGCACAGACAGCAGATGGTGTGGATGCTGACCTCTGGAAAGACGGCTTA
Pan_troglodytes|37656              TATGATGTAGTTGCACAGACAGCAGATGGTGTGGATGCTGACCTCTGGAAAGACGGCTTA
Gorilla_gorilla|16636              TATGACGTAGTTGCACAGACAGCAGATGGTGTGGATGCTGACCTCTGGAAAGACGGCTTA
Tupaia_belangeri|6975              TACGATGTGGTTGCACAGACGGCAGATGGTGTGGACGCTGACCTCTGGAAAGACGGCTTA
                                            .. .    .   .  . ... ....  .  .   .  ..   .  ..  . 

Dipodomys_ordii|11133              TTCAAGTCCAAGGTTACCAGATACCTGTGTTTCACAAGATCATTGTCCAGAGAAAGTNNN
Callithrix_jacchus|48587           TTTAAATCCAAGGTTACCAGATACCTGTGTTTCACAAGATCATTTTCCAAAGAAAATAGT
Ochotona_princeps|2957             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGC
Spermophilus_tridecemlineatus|9584 TTCAAGTCCAAGGTTACCAGATACCTGTGTTTCACAAGATCGTTTTCAAAAGAAAATNNN
Otolemur_garnettii|9113            TTTAAATCCAAGGTTACCAGATACCTGTGTTTCACAAGATCATTTTCCAAAGAAAATAGC
Mus_musculus|21630                 TTCAAGTCCAAGGTTACCAGATACCTGTGTTTCACAAGATCATTTTCTAAAGAAAATAGT
Rattus_norvegicus|21570            TTCAAATCCAAGGTTACCAGATACCTGTGTTTCACAAGATCATTTTCTAAAGAAAACAGT
Microcebus_murinus|11039           TTTAAATCCAAGGTTACCAGATACCTGTGTTTCACAAGATCATTTTCCAAAGAAAATAGC
Oryctolagus_cuniculus|19900        TTTAAGTCCAAGGTCACCAGATACCTGTGTTTCACGAGATCGTTTTCCAAAGAAAACAGC
Cavia_porcellus|11578              TTCAAGTCCAAGGTTACCAGATACCTGTGTTTCACCAGATCATTCTCCAAAGAAAATAGT
Tarsius_syrichta|4858              TTTAAATCCAAGGTTACCAGATACCTGTGTTTTACAAGATCATTTTCCAAAGAAAATAGT
Homo_sapiens|95233                 TTTAAATCCAAGGTTACCAGATACCTGTGTTTCACAAGATCATTTTCCAAAGAAAATAGT
Homo_sapiens|95232                 TTTAAATCCAAGGTTACCAGATACCTGTGTTTCACAAGATCATTTTCCAAAGAAAATAGT
Pan_troglodytes|37656              TTTAAATCCAAGGTTACCAGATACCTGTGTTTCACAAGATCATTTTCCAAAGAAAATAGT
Gorilla_gorilla|16636              TTTAAATCCAAGGTTACCAGATACCTGTGTTTCACAAGATCATTTTCCAAAGAAAATAGT
Tupaia_belangeri|6975              TTTAAATCCAAGGTTACCAGATACCTGTGTTTCACAAGATCATTTTCCAAAGAAAATAGT
                                   ..    .    ...     . .   .......     . .  .. .     .      . 

Dipodomys_ordii|11133              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Callithrix_jacchus|48587           CATCTGGGGAACGTGTTAGTAGATATGAAGCTCATTGACATCAAGGACACACTGCCTGTG
Ochotona_princeps|2957             CATTTGGGGAACGTGTTAGTGGATATGAAGCTGATTGACATCAAGGACACGCTGCCTGTG
Spermophilus_tridecemlineatus|9584 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTGCCCGTG
Otolemur_garnettii|9113            CATTTGGGGAATGTGTTAGTGGATATGAAGCTCATCGACATCAAGGACACGCTGCCTGTG
Mus_musculus|21630                 CATTTGGGGAATGTGCTGGTGGACATGAAGCTCATCGATGTCAAGGACACATTGCCTGTG
Rattus_norvegicus|21570            CATTTGGGGAATGTGCTGGTGGACATGAAACTCATCGACGTCAAGGACACGTTGCCTGTG
Microcebus_murinus|11039           CATTTGGGGAACGTGTTAGTGGATATGAAGCTCATTGACATCAAGGACACGCTGCCTGTG
Oryctolagus_cuniculus|19900        CACCTGGGGAACGTGTTAGTGGATATGAAGCTCATTGACATCAAGGACACGCTGCCTGTG
Cavia_porcellus|11578              CATTTGGGGAATGTGTTAGTGGACATGAAGCTCATTGACATCAAGGACACGCTGCCCGTG
Tarsius_syrichta|4858              CATTTGGGGAATGTGTTAGTGGATATGAAGCTCATTGACATCAAGGACACGCTGCCTGTG
Homo_sapiens|95233                 CATCTGGGGAACGTGTTAGTAGATATGAAGCTCATTGACATCAAGGACACACTGCCTGTG
Homo_sapiens|95232                 CATCTGGGGAACGTGTTAGTAGATATGAAGCTCATTGACATCAAGGACACACTGCCTGTG
Pan_troglodytes|37656              CATCTGGGGAACGTGTTAGTAGATATGAAGCTCATTGACATCAAGGACACACTGCCTGTG
Gorilla_gorilla|16636              CATCTGGGGAACGTGTTAGTAGATATGAAGCTCATTGACATCAAGGACACACTGCCTGTG
Tupaia_belangeri|6975              CATTTGGGGAATGTGTTAGTGGACATGAAGCTCATTGACATCAAGGACACGCTGCCTGTT
                                       .....   ... . .. .   ..    .  . .   .   ..      ..   .. 

Dipodomys_ordii|11133              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGAGGTGGCTTTTAGGAAGAAGAGG
Callithrix_jacchus|48587           GGCTTCATCCCAATTCAGGAGACAGTGGACACACAGGAAGTGGCTTTTAGGAAGAAGAGG
Ochotona_princeps|2957             GGCTTCATCCCAATTCAGGAGACAGTGGACACACAGGAAGTGGCGTTCCGAAAGAAGAGG
Spermophilus_tridecemlineatus|9584 GGCTTCATCCCGATGCAGGAGACGGTGGACACACAGGAGGTGGCTTTTAGAAAGAAGAGG
Otolemur_garnettii|9113            GGCTTCATCCCCATTCAGGAGACGGTGGACACACAGGAGGTGGCTTTTAGAAAGAAGAGG
Mus_musculus|21630                 GGCTTCATCCCCATCCAAGAGACCGTGGATACACAGGAGGTGGTCTTTAGGAAGAAGCGG
Rattus_norvegicus|21570            GGCTTCATTCCCATCCAGGAGACGGTGGATACACAGGAGGTGGTCTTCAGGAAGAAGAGG
Microcebus_murinus|11039           GGCTTCATCCCGATTCAGGAGACGGTGGACACACAGGAGGTGGCTTTTAGAAAGAAGAGG
Oryctolagus_cuniculus|19900        GGCTTCATCCCGATTCAGGAGACGGTGGACACACAGGAGGTGGCTTTTAGAAAGAAGAGG
Cavia_porcellus|11578              GGCTTCATCCCCATCCAAGAGACGGTGGACACACAGGAGGTGGCTTTTAGGAAGAAGAGG
Tarsius_syrichta|4858              GGCTTCATCCCAATTCAAGAGACAGTGGACACACAGGAAGTGGCTTTTCGAAAGAAGAGG
Homo_sapiens|95233                 GGCTTCATCCCAATTCAGGAGACGGTGGACACACAGGAAGTGGCTTTTAGGAAGAAGAGG
Homo_sapiens|95232                 GGCTTCATCCCAATTCAGGAGACGGTGGACACACAGGAAGTGGCTTTTAGGAAGAAGAGG
Pan_troglodytes|37656              GGCTTCATCCCAATTCAGGAGACGGTGGACACACAGGAAGTGGCTTTTAGGAAGAAGAGG
Gorilla_gorilla|16636              GGCTTCATCCCAATTCAGGAGACAGTGGACACACAGGAAGTGGCTTTTAGGAAGAAGAGG
Tupaia_belangeri|6975              GGCTTCATCCCGATTCAGGAGACAGTGGACACACAGGAAGTGGCCTTTAGAAAGAAGAGG
                                   .. ..  .     .    . .   ....      ****.****  ** .*.******.**

Dipodomys_ordii|11133              CTGTGCATTAAATTTATCCCCCGGGATTCCACAGAAGCGGCCATTTGTGACATCCGAATC
Callithrix_jacchus|48587           CTGTGCATTAAGTTTATTCCACGTGATTCAACGGAAGCTGCAATCTGTGACATTCGGATC
Ochotona_princeps|2957             CTGTGCATCAAGTTTATCCCCCGGGACTCAACAGAAGCCGCCATCTGTGACATTCGCATC
Spermophilus_tridecemlineatus|9584 CTATGCATCAAATTCATCCCCCGGGATTCCACTGAAGCTGCCATCTGTGACATTCGGATC
Otolemur_garnettii|9113            TTGTGCATTAAATTCATTCCACGAGATTCAACTGAAGCTGCAATTTGTGACATTCGGATC
Mus_musculus|21630                 CTCTGCATTAAGTTTATCCCCCGGGATTCAACTGAAGCTGCCATCTGTGACATTCGCATC
Rattus_norvegicus|21570            CTATGCATTAAGTTCATTCCCCGGGATTCAACCGAAGCCGCCATTTGTGACATTCGCATC
Microcebus_murinus|11039           CTGTGCATTAAATTTATTCCACGAGATTCAACGGAAGCCGCAATCTGTGACATTCGGATC
Oryctolagus_cuniculus|19900        CTGTGCATCAAGTTCATCCCCCGGGACTCGACGGAAGCCGCCATCTGTGACATTCGGATC
Cavia_porcellus|11578              CTTTGCATTAAGTTCATCCCCCGGGATTCAACCGAAGCCGCCATCTGCGACATTCGGATC
Tarsius_syrichta|4858              CTATGCATTAAATTTATTCCACGGGATTCAACTGAAGCTGCAATTTGTGACATTCGGATC
Homo_sapiens|95233                 CTGTGCATTAAATTTATTCCACGGGATTCAACGGAAGCTGCGATTTGTGACATTCGGATC
Homo_sapiens|95232                 CTGTGCATTAAATTTATTCCACGGGATTCAACGGAAGCTGCGATTTGTGACATTCGGATC
Pan_troglodytes|37656              CTGTGCATTAAATTTATTCCACGGGATTCAACGGAAGCTGCGATTTGTGACATTCGGATC
Gorilla_gorilla|16636              CTGTGCATTAAATTTATTCCACGGGATTCAACGGAAGCTGCGATTTGTGACATTCGGATC
Tupaia_belangeri|6975              CTGTGTATTAAGTTCATCCCTCGGGATTCAACTGAAGCAGCCATTTGTGACATTCGGATC
                                    * ** ** **.** ** ** ** ** ** ** ***** ** ** ** ***** ** ***

Dipodomys_ordii|11133              ATGGGCCGGACCAAGCAAGCACCTCCTCAGTACACATTTATCGGGGAACTGAACAGCATG
Callithrix_jacchus|48587           ATGGGCCGGACCAAGCAGGCCCCGCCTCAATACACATTTATTGGGGAACTGAACAGCATG
Ochotona_princeps|2957             ATGGGCCGGACCAAGCAGGCCCCTCCTCAGTACACGTTCATTGGGGAACTGAACAGCATG
Spermophilus_tridecemlineatus|9584 ATGGGCCGGACCAAGCAGGCCCCTCCTCAGTACACGTTTATTGGGGAACTGAACAGCATG
Otolemur_garnettii|9113            ATGGGCCGGACCAAGCAGGCCCCACCTCAATACACGTTTATTGGGGAACTGAACAGCATG
Mus_musculus|21630                 ATGGGCCGGACCAAGCAGGCACCGCCCCAGTACACGTTTATCGGGGAACTGAACAGCATG
Rattus_norvegicus|21570            ATGGGCCGGACCAAGCAGGCTCCTCCCCAGTACACATTTATCGGGGAACTGAACAGCATG
Microcebus_murinus|11039           ATGGGCCGCACCAAGCAGGCCCCGCCTCAGTACACGTTTATCGGGGAACTGAACAGCATG
Oryctolagus_cuniculus|19900        ATGGGCCGGACCAAGCAGGCCCCTCCTCAGTACACGTTCATCGGGGAACTGAACAGCATG
Cavia_porcellus|11578              ATGGGCCGGACCAAGCAGGCACCTCCTCAGTACACATTCATTGGGGAACTGAACAGCATG
Tarsius_syrichta|4858              ATGGGCCGGACCAAGCAGGCCCCGCCTCAGTACACGTTTATTGGGGAACTGAACAGCATG
Homo_sapiens|95233                 ATGGGCCGGACCAAGCAGGCCCCGCCTCAGTACACGTTTATTGGGGAACTGAACAGCATG
Homo_sapiens|95232                 ATGGGCCGGACCAAGCAGGCCCCGCCTCAGTACACGTTTATTGGGGAACTGAACAGCATG
Pan_troglodytes|37656              ATGGGCCGGACCAAGCAGGCCCCGCCTCAGTACACGTTTATTGGGGAACTGAACAGCATG
Gorilla_gorilla|16636              ATGGGCCGGACCAAGCAGGCCCCACCTCAGTACACGTTTATTGGGGAACTGAACAGCATG
Tupaia_belangeri|6975              ATGGGCCGGACGAAGCAGGCCCCCCCTCAGTACACGTTTATCGGGGAACTAAACAGCATG
                                   ******** ** *****.** ** ** **.*****.** ** ********.*********

Dipodomys_ordii|11133              GGGATCTGGTACCGAATGGGCAGAGTGCCAAGAAACCACGACTCGTCCCAGCCCACCACG
Callithrix_jacchus|48587           GGGATCTGGTATCGAATGGGCAGAGTACCAAGAAATCATGACTCATCTCAACCCACAACG
Ochotona_princeps|2957             GGGATTTGGTATCGGATGGGCAGAGTGCCAAGATCCCACGCCTCGTCTCAAACCACCACG
Spermophilus_tridecemlineatus|9584 GGGATCTGGTATCGAATGGGCAGAGTGCCTAGAAATCACGACTCATCTCAACCCACAACA
Otolemur_garnettii|9113            GGGATCTGGTATCGAATGGGCAGAGTGCCAAGGAATCATGACTCATCTCAACCCACAACG
Mus_musculus|21630                 GGCATCTGGTACCGAATGGGCAGAGTGCCAAGAAACCATGACTCGTCTCAGCCCACCACG
Rattus_norvegicus|21570            GGCATCTGGTATCGAATGGGCAGAGTGCCAAGAAACCATGACTCATCTCAACCCACCACG
Microcebus_murinus|11039           GGGATCTGGTACCGAATGGGCAGAGTACCGAGAAATCACGACTCATCCCAACCCACAACG
Oryctolagus_cuniculus|19900        GGGATCTGGTATCGAATGGGCAGAGTCCCAAGAAACCATGACTCATCTCAACCCACGACG
Cavia_porcellus|11578              GGGATCTGGTATCGAATGGGCCGAGTGCCAAGAAACCACGACTCATCTCAACCCACGACG
Tarsius_syrichta|4858              GGGATCTGGTATCGAATGGGGAGAGTACCAAGAAATCATGACTCATCTCAACCCACAACA
Homo_sapiens|95233                 GGGATCTGGTATCGAATGGGCAGAGTACCAAGAAATCATGACTCATCTCAACCCACAACG
Homo_sapiens|95232                 GGGATCTGGTATCGAATGGGCAGAGTACCAAGAAATCATGACTCATCTCAACCCACAACG
Pan_troglodytes|37656              GGGATCTGGTATCGAATGGGCAGAGTACCAAGAAATCATGACTCATCTCAACCCACAACG
Gorilla_gorilla|16636              GGGATCTGGTATCGAATGGGCAGAGTACCAAGAAATCATGACTCATCTCAACCCACAACG
Tupaia_belangeri|6975              GGGATCTGGTATCGAATGGGCAGAGTACCAAGAAATCACGACTCATCTCAACCCACAACG
                                   ** ** ***** **.***** .**** ** **.:. ** *.***.** **..**** **.

Dipodomys_ordii|11133              ------CCTTCACAGTCATCGGCCGCCTCCACCCCAGCCCCCAACCTGCCCAGNNNNNNN
Callithrix_jacchus|48587           ------CCTTCCCAGTCATCAGCTGCTTCCACCCCAGCCCCCAACCTTCCCAGG------
Ochotona_princeps|2957             ------CCTTCCCCGTCATCTGCTGCTTCCACCCCAGCCCCCAACTTGCCCAGGCACATC
Spermophilus_tridecemlineatus|9584 ------CCCTCGCAGTCCTCGGCCGCCTCCACCCCAGCCCCCAACCTCCCCAGGCACATC
Otolemur_garnettii|9113            ------CCTTCCCAGTCATCAGCTGCTCCCACCCCAGCCCCCAACCTTCCCAGGCACATC
Mus_musculus|21630                 ------CCCTCCCAGTCATCAGCCTCTTCTACCCCAGCCCCAAACCTTCCCAGGCACATC
Rattus_norvegicus|21570            ------CCCTCCCAGTCATCAGCTGCTTCCACCCCAGCCCCAAACCTTCCCAGGCACATC
Microcebus_murinus|11039           ------CCTTCCCAGTCGTCAGCTGCTTCCACCCCAGCCCCCAACCTGCCCAGNNNNNNN
Oryctolagus_cuniculus|19900        ------CCTTCCCAGTCGTCAGCTGCTTCTACCCCAGCCCCCAACCTGCCCAGGCACATC
Cavia_porcellus|11578              ------CCGTCACAGTCATCAGCTGCTTCCACCCCAGCCCCCAACCTTCCCAGGCACATC
Tarsius_syrichta|4858              ------CCTTCCCAGTCATCAGCTGCTTCCACCCCAGCCCCCAACCTTCCCAGGCACATC
Homo_sapiens|95233                 ------CCTTCCCAGTCATCAGCTGCCTCCACCCCAGCCCCCAACCTTCCCAGGCACATC
Homo_sapiens|95232                 ------CCTTCCCAGTCATCAGCTGCCTCCACCCCAGCCCCCAACCTTCCCAGG------
Pan_troglodytes|37656              ------CCTTCCCAGTCATCAGCTGCCTCCACCCCAGCCCCCAACCTTCCCAGGCACATC
Gorilla_gorilla|16636              ------CCTTCCCAGTCATCAGCTGCCTCCACCCCAGCCCCCAACCTTCCCAGGCACATC
Tupaia_belangeri|6975              CCTTCACCTTCGCAGTCATCTGCCGCGTCCACCCCAGCCCCTAACCTTCCCAGGCACATC
                                         ** ** *.*** ** **  *  * *********** *** * *****.      

Dipodomys_ordii|11133              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Callithrix_jacchus|48587           ------------------------------------------------------------
Ochotona_princeps|2957             TCCCTAACGCTGCCTGCCACCTTCCGCGGCAGGAACAGCACCCGGACGGACTATGAGTAC
Spermophilus_tridecemlineatus|9584 TCTCTAACGCTCCCCGCCACCTTCCGAGGCAGGAACAGCAGCCGGACGGACTATGAGTAC
Otolemur_garnettii|9113            TCTCTAACACTGCCCGCCACCTTCCGAGGCAGAAACAGCACCCGGACGGACTATGAATAC
Mus_musculus|21630                 TCCCTAACACTACCGGCTACCTTCCGGGGCAGAAACAACACCAGCACAGACTATGAGTAC
Rattus_norvegicus|21570            TCCCTGACACTCCCGGCTACCTTCCGAGGCAGAAACAACACCAGCACAGACTATGAGTAC
Microcebus_murinus|11039           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Oryctolagus_cuniculus|19900        TCTCTAACGCTCCCTGCCACCTTCCGAGGCAGGAACAGCGCGCGGACGGACTATGAGTAC
Cavia_porcellus|11578              TCTCTGACACTCCCTGCCACCTTCCGAGGCAGGAACAGCACCCGGACGGACTATGAGTAC
Tarsius_syrichta|4858              TCTCTAACGCTTCCTGCCACCTTCCGAGGCAGGAACAGCACCCGGACAGACTACGAGTAC
Homo_sapiens|95233                 TCCCTAACACTTCCTGCCACCTTCCGAGGCAGGAACAGCACCCGGACGGACTACGAGTAC
Homo_sapiens|95232                 ------------------------------------------------------------
Pan_troglodytes|37656              TCCCTAACACTTCCTGCCACCTTCCGAGGCAGGAACAGCACCCGGACGGACTACGAGTAC
Gorilla_gorilla|16636              TCCCTAACACTTCCTGCCACCTTCCGAGGCAGGAACAGCACCCGGACGGACTACGAGTAC
Tupaia_belangeri|6975              TCTCTAACGCTCCCTGCCACCTTCCGAGGCAGAAACAGCACCCGGACGGACTACGAGTAC
                                                                                               

Dipodomys_ordii|11133              NNNNNNNNNNNNNNNNNNNNNNNNNNNNCAATGGATGGCGTGCCTTTTATGATTTCAGAG
Callithrix_jacchus|48587           ------------------------------------------------------------
Ochotona_princeps|2957             CAGCACTCCAATTTGTATGCCATATCAGCAATGGATGGTGTGCCTTTCATGATATCTGAG
Spermophilus_tridecemlineatus|9584 CAGCACTCCAACTTGTATGCCATATCA---------------------------------
Otolemur_garnettii|9113            CAGCACTCCAATTTGTATGCCATATCAGCAATGGATGGTGTGCCTTTTATGATTTCAGAG
Mus_musculus|21630                 CAGCTCTCCAATCTATATGCCATATCAGCAATGGATGGTGTGCCTTTTATGATTTCAGAG
Rattus_norvegicus|21570            CAGCTCTCCAACCTGTATGCCATATCA---------------------------------
Microcebus_murinus|11039           NNNNNNNNNNNNNNNNNNNNNNNNNNNNCAATGGATGGTGTGCCTTTTATGATTTCCGAG
Oryctolagus_cuniculus|19900        CAGCACTCCAATTTGTATGCCATATCAGCAATGGATGGGGTGCCGTTCATGATATCAGAG
Cavia_porcellus|11578              CAGCACTCCAATTTGTATGCCATATCAGCGATGGATGGCGTGCCTTTTATGATTTCAGAG
Tarsius_syrichta|4858              CAGCATTCCAATTTGTATGCCATATCAGCAATGGATGGTGTGCCTTTTATGATTTCTGAG
Homo_sapiens|95233                 CAGCACTCCAATTTGTATGCCATATCAGCAATGGATGGTGTGCCTTTTATGATTTCAGAG
Homo_sapiens|95232                 ------------------------------------------------------------
Pan_troglodytes|37656              CAGCACTCCAATTTGTATGCCATATCAGCAATGGATGGTGTGCCTTTTATGATTTCAGAG
Gorilla_gorilla|16636              CAGCACTCCAATTTGTATGCCATATCAGCAATGGATGGTGTGCCTTTTATGATTTCAGAG
Tupaia_belangeri|6975              CAGCACTCCAATCTGTATGCCATCTCAGCAATGGATGGTGTGCCTTTCATGATTTCAGAG
                                                                                               

Dipodomys_ordii|11133              AAGTTCTCCTGTGTTCCTGAAAATATGCAGCCCTTTGACCTCCTGGGAATCACCATCAAA
Callithrix_jacchus|48587           ------------------------------------------------------------
Ochotona_princeps|2957             AAGTTTTCTTGTGTTCCAGAAAGTATGCAGCCCTTTGACCTCCTGGGAATCACCATCAAG
Spermophilus_tridecemlineatus|9584 ------------------------------------------------------------
Otolemur_garnettii|9113            AAGTTTTCTTGTGTTCCAGAAAGTATGCAGCCCTTTGATCTCTTGGGGATCACCATCAAA
Mus_musculus|21630                 AAGTTTTCCTGCATTCCAGAAAGTATGCAGCCCTTTGATCTCTTGGGAATCACCATCAAG
Rattus_norvegicus|21570            ------------------------------------------------------------
Microcebus_murinus|11039           AAGTTTTCCTGTGTTCCAGAAAGTATGCAGCCCTTCGACCTCCTGGGGATCACCATCAAG
Oryctolagus_cuniculus|19900        AAGTTTTCGTGCGTTCCAGAAAGTATGCAGCCCTTTGACCTCTTGGGAATCACTATCAAG
Cavia_porcellus|11578              AAGTTTTCGTGTGTTCCAGAAAGTATGCAGCCCTTTGATCTCTTGGGGATCACTATCAAA
Tarsius_syrichta|4858              AAGTTTTCTTGTGTTCCAGAAAGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Homo_sapiens|95233                 AAGTTTTCTTGTGTTCCAGAAAGTATGCAGCCCTTTGATCTCCTGGGAATCACCATCAAA
Homo_sapiens|95232                 ------------------------------------------------------------
Pan_troglodytes|37656              AAGTTTTCTTGTGTTCCAGAAAGTATGCAGCCCTTTGATCTCCTCGGAATCACCATCAAA
Gorilla_gorilla|16636              AAGTTTTCTTGTGTTCCAGAAAGTATGCAGCCCTTTGATCTCCTGGGAATCACCATCAAA
Tupaia_belangeri|6975              AAGTTTTCCTGTGTTCCAGAAAGTATGCAGCCGTTCGATCTCTTGGGAATCACCATCAAA
                                                                                               

Dipodomys_ordii|11133              TCCCTAGCAGAAATTGAAAAAGAGTACGAATACAGCTTCCGCACGGAGCAGAGCGCGGCC
Callithrix_jacchus|48587           ------------------------------------------------------------
Ochotona_princeps|2957             TCTTTGGCAGAAATTGAGAAAGAGTACGAGTACAGCTTCCGCACGGAGCAGAGCGCCGCT
Spermophilus_tridecemlineatus|9584 ------------------------------------------------------------
Otolemur_garnettii|9113            TCTCTAGCAGAAATTGAGAAAGAGTATGAGTACAGCTTCCGCACAGAGCAGAGTGCCGCC
Mus_musculus|21630                 TCTCTGGCAGAAATTGAAAAGGAGTACGAGTACAGCTTCCGCACCGAGCAGAGCGCAGCA
Rattus_norvegicus|21570            ------------------------------------------------------------
Microcebus_murinus|11039           TCTCTGGCAGAGATCGAGAAGGAGTACGAGTACAGCTTCCGCACGGAGCAGAGCGCCGCG
Oryctolagus_cuniculus|19900        TCTTTGGCAGAAATCGAAAAAGAGTACGAGTACAGCTTCCGCACGGAGCAGAGCGCCGCG
Cavia_porcellus|11578              TCTCTAGCAGAAATTGAGAAGGAGTACGAGTACAGCTTCCGCACGGAGCAGAGCGCCGCC
Tarsius_syrichta|4858              NNNNNNNNNNNNNNNNNNNNNNNNTATGAGTACAGCTTCCGCACGGAGCAGAGTGCCGCC
Homo_sapiens|95233                 TCTCTAGCAGAAATCGAAAAAGAGTACGAGTACAGCTTCCGCACAGAGCAGAGCGCAGCC
Homo_sapiens|95232                 ------------------------------------------------------------
Pan_troglodytes|37656              TCTCTAGCAGAAATCGAAAAAGAGTACGAGTACAGCTTCCGCACAGAGCAGAGCGCAGCC
Gorilla_gorilla|16636              TCTCTAGCAGAAATCGAAAAAGAGTACGAGTACAGCTTCCGCACAGAGCAGAGCGCAGCC
Tupaia_belangeri|6975              TCTCTGGCAGAAATTGAAAAGGAG------------------------------------
                                                                                               

Dipodomys_ordii|11133              GCCCGGCTCCCGCCCAGCCCCACCCGATGCCAGCAGATCCCCCAGTCCTGA
Callithrix_jacchus|48587           ------------------------------------------------TGA
Ochotona_princeps|2957             GCCAGGCTCCCGCCCAGCCCCACCCGGTGCCAGCAGGTGCCGCAGTCCTGA
Spermophilus_tridecemlineatus|9584 ---------------------------------------------------
Otolemur_garnettii|9113            GCCCGGCTCCCGCCGAGCCCCACCAGGTGCCAGCAGATCCCTCAGTCCTGA
Mus_musculus|21630                 GCTCGACTCCCACCCAGCCCTACCCGGTGCCAGCAGATCCCCCAATCCTGA
Rattus_norvegicus|21570            ---------------------------------------------------
Microcebus_murinus|11039           GCCCGGCTCCCGCCCAGCCCCACCCGCTGTCAGCAGATCCCCCAGTCCTGA
Oryctolagus_cuniculus|19900        GCCCGGCTGCCGCCCAGCCCTACCAGGTGTCAGCAGGTGCCGCAGTCC---
Cavia_porcellus|11578              GCCAGGCTCCCACCCAGTCCCACCCGGTGCCAGCAGATCCCACAGTCC---
Tarsius_syrichta|4858              GCCAGGCTCCCGCCCAGCCCCACCAGGTGCCAGCAGATCCCGCAGTCC---
Homo_sapiens|95233                 GCCAGGCTCCCGCCCAGCCCCACCAGGTGTCAGCAGATCCCGCAGTCCTGA
Homo_sapiens|95232                 ------------------------------------------------TGA
Pan_troglodytes|37656              GCCAGGCTCCCGCCCAGCCCCACCAGGTGTCAGCAGATCCCGCAGTCCTGA
Gorilla_gorilla|16636              GCCAGGCTCCCGCCCAGCCCCACCAGGTGTCAGCAGATCCCGCAGTCC---
Tupaia_belangeri|6975              ---------------------------------------------------
                                                                                      

multiple sequence alignment in CLUSTALW format


Dipodomys_ordii|10457              ------------------------------------------NQSTMPXXXXXXXXXXXX
Callithrix_jacchus|39692           ------------EPCGWSPSWVGAC------------WLVGYIVGSRSWLRSWAGP-PWS
Ochotona_princeps|2581             ------------------------------------------DQPTMPEVKDLSEALPET
Spermophilus_tridecemlineatus|8599 ------------------------------------------------------EALPET
Otolemur_garnettii|7861            ------------------------------------------DQATMPEVKDLSEALPET
Mus_musculus|1399                  -MRSCFCVRRSRDPPPPQPPP----------------PQRGTDQATMPEVKELSEALPET
Rattus_norvegicus|10941            -MRSCFCVRRSRDPPPPQPPP----------------PQRGTDQATMPEVKELSEALPET
Microcebus_murinus|9361            GSRSGCGAGSRRLGPGPGPSRAARAMRSCFCVRRSRDPPPPQDLSTMPEVKDLSEALPET
Oryctolagus_cuniculus|8084         ---------------PPQPPP----------------GLQNQDQSTMPEVKDLSEALPDT
Cavia_porcellus|9058               -------------------------------------PFLNQEQSTMPEVKDLSEALPEM
Tarsius_syrichta|4447              ------------------------------------------DQSTMPEVKDLSEALPEA
Homo_sapiens|71824                 -MRSCFCVRRSRDPPPPQPPPPP--------------PQRGTDQSTMPEVKDLSEALPET
Homo_sapiens|71826                 -MRSCFCVRRSRDPPPPQPPPPP--------------PQRGTDQSTMPEVKDLSEALPET
Pan_troglodytes|22926              -MRSCFCVRRSRDPPPPQPPPPP--------------PQRGTDQSTMPEVKDLSEALPET
Gorilla_gorilla|13356              ------------------PPPPP--------------PPRNQDQSTMPEVKDLSEALPET
Tupaia_belangeri|6036              ------------------------------------------NQSTMPEVKDLSEALPDT
                                                                                               

Dipodomys_ordii|10457              XXXXXXXXXXXXXXXXXXXXXXXVAQTADGVDVDLGKDGLFKSKVTRYLCFTRSLSRESX
Callithrix_jacchus|39692           SRETKPSVSSIQGRLREAGRR--VAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENS
Ochotona_princeps|2581             SLDPLTGVGVVASRNRAPTGYDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS
Spermophilus_tridecemlineatus|8599 S--PIT-VGVVASRNRAQ-GYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENX
Otolemur_garnettii|7861            SMDPITXXXXXXXXXXXXXXXXXVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENS
Mus_musculus|1399                  PMDPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENS
Rattus_norvegicus|10941            PMDPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENS
Microcebus_murinus|9361            SMDPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENS
Oryctolagus_cuniculus|8084         SMDPLTGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENS
Cavia_porcellus|9058               SMDPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENS
Tarsius_syrichta|4447              SMDPITGVGVVASRNRAPTGYDVXAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENS
Homo_sapiens|71824                 SMDPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENS
Homo_sapiens|71826                 SMDPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENS
Pan_troglodytes|22926              SMDPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENS
Gorilla_gorilla|13356              SMDPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENS
Tupaia_belangeri|6036              SMDPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENS
                                                                                               

Dipodomys_ordii|10457              XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVAFRKKRLCIKFIPRDSTEAAICDIRI
Callithrix_jacchus|39692           HLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRI
Ochotona_princeps|2581             HLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRI
Spermophilus_tridecemlineatus|8599 XXXXXXXXXXXXXXXXXLPVGFIPMQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRI
Otolemur_garnettii|7861            HLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRI
Mus_musculus|1399                  HLGNVLVDMKLIDVKDTLPVGFIPIQETVDTQEVVFRKKRLCIKFIPRDSTEAAICDIRI
Rattus_norvegicus|10941            HLGNVLVDMKLIDVKDTLPVGFIPIQETVDTQEVVFRKKRLCIKFIPRDSTEAAICDIRI
Microcebus_murinus|9361            HLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRI
Oryctolagus_cuniculus|8084         HLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRI
Cavia_porcellus|9058               HLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRI
Tarsius_syrichta|4447              HLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRI
Homo_sapiens|71824                 HLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRI
Homo_sapiens|71826                 HLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRI
Pan_troglodytes|22926              HLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRI
Gorilla_gorilla|13356              HLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRI
Tupaia_belangeri|6036              HLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRI
                                                                   **.*************************

Dipodomys_ordii|10457              MGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTT--PSQSSAASTPAPNLPXXX
Callithrix_jacchus|39692           MGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTT--PSQSSAASTPAPNLPR--
Ochotona_princeps|2581             MGRTKQAPPQYTFIGELNSMGIWYRMGRVPRSHASSQTTT--PSPSSAASTPAPNLPRHI
Spermophilus_tridecemlineatus|8599 MGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTT--PSQSSAASTPAPNLPRHI
Otolemur_garnettii|7861            MGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTT--PSQSSAAPTPAPNLPRHI
Mus_musculus|1399                  MGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTT--PSQSSASSTPAPNLPRHI
Rattus_norvegicus|10941            MGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTT--PSQSSAASTPAPNLPRHI
Microcebus_murinus|9361            MGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTT--PSQSSAASTPAPNLPXXX
Oryctolagus_cuniculus|8084         MGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTT--PSQSSAASTPAPNLPRHI
Cavia_porcellus|9058               MGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTT--PSQSSAASTPAPNLPRHI
Tarsius_syrichta|4447              MGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTT--PSQSSAASTPAPNLPRHI
Homo_sapiens|71824                 MGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTT--PSQSSAASTPAPNLPRHI
Homo_sapiens|71826                 MGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTT--PSQSSAASTPAPNLPR--
Pan_troglodytes|22926              MGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTT--PSQSSAASTPAPNLPRHI
Gorilla_gorilla|13356              MGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTT--PSQSSAASTPAPNLPRHI
Tupaia_belangeri|6036              MGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTTPSPSQSSAASTPAPNLPRHI
                                   *******************************.* ***.**  ** ***:.*******   

Dipodomys_ordii|10457              XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMDGVPFMISEKFSCVPENMQPFDLLGITIK
Callithrix_jacchus|39692           ------------------------------------------------------------
Ochotona_princeps|2581             SLTLPATFRGRNSTRTDYEYQHSNLYAISAMDGVPFMISEKFSCVPESMQPFDLLGITIK
Spermophilus_tridecemlineatus|8599 SLTLPATFRGRNSSRTDYEYQHSNLYAIS-------------------------------
Otolemur_garnettii|7861            SLTLPATFRGRNSTRTDYEYQHSNLYAISAMDGVPFMISEKFSCVPESMQPFDLLGITIK
Mus_musculus|1399                  SLTLPATFRGRNNTSTDYEYQLSNLYAISAMDGVPFMISEKFSCIPESMQPFDLLGITIK
Rattus_norvegicus|10941            SLTLPATFRGRNNTSTDYEYQLSNLYAIS-------------------------------
Microcebus_murinus|9361            XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMDGVPFMISEKFSCVPESMQPFDLLGITIK
Oryctolagus_cuniculus|8084         SLTLPATFRGRNSARTDYEYQHSNLYAISAMDGVPFMISEKFSCVPESMQPFDLLGITIK
Cavia_porcellus|9058               SLTLPATFRGRNSTRTDYEYQHSNLYAISAMDGVPFMISEKFSCVPESMQPFDLLGITIK
Tarsius_syrichta|4447              SLTLPATFRGRNSTRTDYEYQHSNLYAISAMDGVPFMISEKFSCVPESXXXXXXXXXXXX
Homo_sapiens|71824                 SLTLPATFRGRNSTRTDYEYQHSNLYAISAMDGVPFMISEKFSCVPESMQPFDLLGITIK
Homo_sapiens|71826                 ------------------------------------------------------------
Pan_troglodytes|22926              SLTLPATFRGRNSTRTDYEYQHSNLYAISAMDGVPFMISEKFSCVPESMQPFDLLGITIK
Gorilla_gorilla|13356              SLTLPATFRGRNSTRTDYEYQHSNLYAISAMDGVPFMISEKFSCVPESMQPFDLLGITIK
Tupaia_belangeri|6036              SLTLPATFRGRNSTRTDYEYQHSNLYAISAMDGVPFMISEKFSCVPESMQPFDLLGITIK
                                                                                               

Dipodomys_ordii|10457              SLAEIEKEYEYSFRTEQSAAARLPPSPTRCQQIPQS
Callithrix_jacchus|39692           ------------------------------------
Ochotona_princeps|2581             SLAEIEKEYEYSFRTEQSAAARLPPSPTRCQQVPQS
Spermophilus_tridecemlineatus|8599 ------------------------------------
Otolemur_garnettii|7861            SLAEIEKEYEYSFRTEQSAAARLPPSPTRCQQIPQS
Mus_musculus|1399                  SLAEIEKEYEYSFRTEQSAAARLPPSPTRCQQIPQS
Rattus_norvegicus|10941            ------------------------------------
Microcebus_murinus|9361            SLAEIEKEYEYSFRTEQSAAARLPPSPTRCQQIPQS
Oryctolagus_cuniculus|8084         SLAEIEKEYEYSFRTEQSAAARLPPSPTRCQQVPQS
Cavia_porcellus|9058               SLAEIEKEYEYSFRTEQSAAARLPPSPTRCQQIPQS
Tarsius_syrichta|4447              XXXXXXXXYEYSFRTEQSAAARLPPSPTRCQQIPQS
Homo_sapiens|71824                 SLAEIEKEYEYSFRTEQSAAARLPPSPTRCQQIPQS
Homo_sapiens|71826                 ------------------------------------
Pan_troglodytes|22926              SLAEIEKEYEYSFRTEQSAAARLPPSPTRCQQIPQS
Gorilla_gorilla|13356              SLAEIEKEYEYSFRTEQSAAARLPPSPTRCQQIPQS
Tupaia_belangeri|6036              SLAEIEKE----------------------------