Orthologs Set ID: EOG4003HP


Orthology Database
OrthoDB4
Gene Symbol(s)
ETFA

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 46819 39, 186, 268, 351, 451, 562, 670, 739, 822, 888, 969
Cavia porcellus 24855 186, 268, 351, 451, 562, 670, 739, 822, 888, 969
Dipodomys ordii 15863 351, 451, 562, 670, 739, 822, 888
Gorilla gorilla 16944 39, 186, 268, 351, 451, 562
Homo sapiens 29494 39, 268, 351, 451, 562, 670, 739, 822, 888, 969
Microcebus murinus 1027 268, 351, 451, 562, 670, 739, 822, 888, 969
Mus musculus 44063 39, 186, 268, 351, 451, 562, 670, 739, 822, 888, 969
Ochotona princeps 15352 39, 186, 268, 351, 451, 562, 578, 603, 615, 625, 670, 739, 822, 888
Oryctolagus cuniculus 21891 39, 186, 268, 351, 451, 562, 670, 739, 822, 888, 969
Otolemur garnettii 9647 39, 186, 268, 351, 451, 562, 670, 739, 777, 822, 888, 969
Pan troglodytes 13246 39, 186, 268, 351, 451, 562, 670, 739, 822, 888, 969
Rattus norvegicus 33960 39, 186, 268, 351, 451, 562, 670, 739, 822, 888, 969
Spermophilus tridecemlineatus 5957 186, 268, 351, 451, 562, 670, 739, 822, 888, 969
Tarsius syrichta 3133 39, 138, 186, 268, 351, 451, 562, 670, 739, 822, 888, 969
Tupaia belangeri 12555 268, 351, 451, 562, 642, 651, 670, 739, 822, 888, 969, 997

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 46819 ENSCJAT00000021134 100404521 ENSCJAG00000010791 ETFA calJac3
Cavia porcellus 24855 ENSCPOT00000006245 100722688 ENSCPOG00000006181 ETFA cavPor3
Dipodomys ordii 15863 ENSDORT00000000236 ENSDORG00000000236 Etfa dipOrd1
Gorilla gorilla 16944 ENSGGOT00000009073 101126616 ENSGGOG00000009032 LOC101126616 gorGor3
Homo sapiens 29494 ENST00000433983 2108 ENSG00000140374 ETFA hg19,GRCh37
Microcebus murinus 1027 ENSMICT00000000961 ENSMICG00000000961 ETFA micMur1
Mus musculus 44063 ENSMUST00000034866 110842 ENSMUSG00000032314 Etfa mm9
Ochotona princeps 15352 ENSOPRT00000000758 ENSOPRG00000000755 ETFA OchPri2.0
Oryctolagus cuniculus 21891 ENSOCUT00000000770 100339351 ENSOCUG00000000769 ETFA oryCun2.0
Otolemur garnettii 9647 ENSOGAT00000009275 100966215 ENSOGAG00000009271 ETFA otoGar1
Pan troglodytes 13246 ENSPTRT00000013491 453769 ENSPTRG00000007314 ETFA panTro2
Rattus norvegicus 33960 ENSRNOT00000020544 300726 ENSRNOG00000015233 Etfa rn4
Spermophilus tridecemlineatus 5957 ENSSTOT00000005958 101955331 ENSSTOG00000005955 Etfa speTri1
Tarsius syrichta 3133 ENSTSYT00000007893 ENSTSYG00000007890 ETFA tarSyr1
Tupaia belangeri 12555 ENSTBET00000012556 ENSTBEG00000012552 ETFA tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 38007 ENSCJAP00000020000 100404521 ENSCJAG00000010791 ETFA calJac3
Cavia porcellus 19709 ENSCPOP00000005574 100722688 ENSCPOG00000006181 ETFA cavPor3
Dipodomys ordii 14914 ENSDORP00000000217 ENSDORG00000000236 Etfa dipOrd1
Gorilla gorilla 13582 ENSGGOP00000008833 101126616 ENSGGOG00000009032 LOC101126616 gorGor3
Homo sapiens 22700 ENSP00000399273 2108 ENSG00000140374 ETFA hg19,GRCh37
Microcebus murinus 869 ENSMICP00000000870 ENSMICG00000000961 ETFA micMur1
Mus musculus 27950 ENSMUSP00000034866 110842 ENSMUSG00000032314 Etfa mm9
Ochotona princeps 13380 ENSOPRP00000000691 ENSOPRG00000000755 ETFA OchPri2.0
Oryctolagus cuniculus 7367 ENSOCUP00000000668 100339351 ENSOCUG00000000769 ETFA oryCun2.0
Otolemur garnettii 8302 ENSOGAP00000008303 100966215 ENSOGAG00000009271 ETFA otoGar1
Pan troglodytes 16968 ENSPTRP00000012506 453769 ENSPTRG00000007314 ETFA panTro2
Rattus norvegicus 21880 ENSRNOP00000020544 300726 ENSRNOG00000015233 Etfa rn4
Spermophilus tridecemlineatus 5329 ENSSTOP00000005330 101955331 ENSSTOG00000005955 Etfa speTri1
Tarsius syrichta 2878 ENSTSYP00000007231 ENSTSYG00000007890 ETFA tarSyr1
Tupaia belangeri 10879 ENSTBEP00000010881 ENSTBEG00000012552 ETFA tupBel1

multiple sequence alignment in CLUSTALW format


Ochotona_princeps|15352            ATGTTCCGAGCAGTGGCTCCTGGGCAGCTCCGGCGGGCGGCCTCTCTGCTGAGGTTCCAG
Spermophilus_tridecemlineatus|5957 ---------------------------------------GCTTCATTGCTCCGATTTCAG
Oryctolagus_cuniculus|21891        ATGCTGCGAGCGGTAGCTCCTGGGCAGCTGCGGCGGGCGGCCTCACTGCTGCGATTTCAG
Cavia_porcellus|24855              ---------------------------------------GCCGCTTTGCTCCGATTTCAG
Mus_musculus|44063                 ATGTTTCGAGCAGCGGCGCCTGGGCAGCTCCGGCGGGCGGCCTCATTGCTCCGTTTTCAG
Rattus_norvegicus|33960            ATGTTTCGAGCAGCGGCGCCTGGGCAGCTCCGGCGGGCGGCCTCGTTGCTCCGTTTTCAG
Microcebus_murinus|1027            ------------------------------------------------------------
Callithrix_jacchus|46819           ATGTTCCGAGCGGCGGCTCCGGGGCAGCTCAGGAGGGCGGCCTCACTGCTACGATTTCAG
Gorilla_gorilla|16944              ATGTTCCGAGCGGCGGCTCCGGGGCAGCTCCGGCGGGCGGCCTCATTGCTACGATTTCAG
Homo_sapiens|29494                 ATGTTCCGAGCGGCGGCTCCGGGGCAGCTCCGGCGGGCG---------------------
Pan_troglodytes|13246              ATGTTCCGAGCGGCGGCTCCGGGGCAGCTCCGGCGGGCGGCCTCATTGCTACGATTTCAG
Dipodomys_ordii|15863              ------------------------------------------------------------
Tarsius_syrichta|3133              ATGTTCCGAGTGGCGGCTCCGGGGCAGCTCCGGCGGGCGGCCTCACTGCTACGATTTCAG
Otolemur_garnettii|9647            ATGTTCCGAGCGGTGTTTCCAGGGCAGCTCCGGCGGGCGNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|12555             ------------------------------------------------------------
                                                                                               

Ochotona_princeps|15352            AGTACACTGGTGATAGCCGAGCACGCCAATGATTCCCTGGCCCCCATCACTCTAAACGCC
Spermophilus_tridecemlineatus|5957 AGTACCCTGGTAATAGCTGAGCATGCAGATGACTCGCTAGCACCTATTACCTTAAATACC
Oryctolagus_cuniculus|21891        AGTACTCTGGTAATAGCCGAACACGCGAATGACTCCCTAGCACCCATTACTTTAAACACC
Cavia_porcellus|24855              AGTACCCTTGTAATAGCTGAGCATGCGAATGACTCCCTGGCACCTATTACTTTGAACACT
Mus_musculus|44063                 AGTACCTTGGTAATAGCTGAGCATGCAAATGATTCCCTAGCACCCATTACTCTAAATACT
Rattus_norvegicus|33960            AGCACCTTGGTAATAGCTGAGCATGCGAATGATTCTCTAGCACCCATTACTCTAAACACT
Microcebus_murinus|1027            ------------------------------------------------------------
Callithrix_jacchus|46819           AGTACCCTGGTAATAGCTGAACATGCAAATGATTCCCTAGCACCCATTACTTTAAATACC
Gorilla_gorilla|16944              AGTACCCTGGTAATAGCTGAGCATGCAAATGATTCCCTAGCACCCATTACTTTAAATACC
Homo_sapiens|29494                 ------------------------------------------------------------
Pan_troglodytes|13246              AGTACCCTGGTAATAGCTGAGCATGCAAATGATTCCCTAGCACCCATTACTTTAAATACC
Dipodomys_ordii|15863              ------------------------------------------------------------
Tarsius_syrichta|3133              AGCACCCTGGTAATAGCTGAGCATGCAAATGATTCCCTAGCACCCATTACTTTAAATACC
Otolemur_garnettii|9647            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|12555             ------------------------------------------------------------
                                                                                               

Ochotona_princeps|15352            ATCACGGCAGCCAAGCGCCTGGGAGGAGATGTGTCCTGCCTAGTGGCTGGAACCAAATGT
Spermophilus_tridecemlineatus|5957 ATCACTGCAGCCAAACATCTTGGAGGTGAAGTGTCTTGCTTAGTTGCTGGAACCAAATGT
Oryctolagus_cuniculus|21891        ATCACTGCAGCCAAGCGTCTGGGAGGAGACGTGTCCTGCTTAGTGGCTGGAACCAAATGT
Cavia_porcellus|24855              ATCACTGCAGCCAGACGCCTTGGAGGTGAGGTGTCCTGTTTAGTAGCTGGAACCAAATGT
Mus_musculus|44063                 ATCACTGCAGCTGGACGTCTTGGAGGTGAAGTGTCCTGCTTAGTAGCTGGAACCAAGTGT
Rattus_norvegicus|33960            ATCACTGCAGCTGGACGTCTTGGAGGTGAAGTGTCCTGCTTAGTAGCTGGAACAAAATGT
Microcebus_murinus|1027            ------------------------------------------------------------
Callithrix_jacchus|46819           ATTACGGCAGCCAAACGTCTTGGAGGTGAAGTGTCCTGCTTAGTAGCTGGAACCAAATGT
Gorilla_gorilla|16944              ATTACTGCAGCCACACGCCTTGGAGGTGAAGTGTCCTGCTTAGTAGCTGGAACCAAATGT
Homo_sapiens|29494                 ------------------------------------------------------------
Pan_troglodytes|13246              ATTACTGCAGCCACACGCCTTGAAGGTGAAGTGTCCTGCTTAGTAGCTGGAACCAAATGT
Dipodomys_ordii|15863              ------------------------------------------------------------
Tarsius_syrichta|3133              ATCACTGCAGCCAAACGT---GGAGGAGAAGGGTCCTGCTTATTAGCTGGAACCAAATGT
Otolemur_garnettii|9647            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|12555             ------------------------------------------------------------
                                                                                               

Ochotona_princeps|15352            GACAAGGTGGCACAAGAGCTGTGTAAAGTGGAAGGTGTGGCCAAAGTCCTGGTGGCTCAG
Spermophilus_tridecemlineatus|5957 GACAAGGTGGCACAAGATCTCTGTAAAGTAGCAGGTGTAGCAAAAGTTCTGGTGGCTCAG
Oryctolagus_cuniculus|21891        GACAAGGTGGCTCAAGATCTCTGTAAAGTGGAAGGTGTCACGAAAGTGCTGGTGGCGCAG
Cavia_porcellus|24855              GACAAGGTGGTACAAGATCTCTGTAAAGTAGCAGGGATAGCGAAAGTTCTGGTGGCTCAG
Mus_musculus|44063                 GACAAGGTGGTACAGGATCTATGTAAAGTAGCTGGCGTAGCAAAGGTTCTGGTGGCTCAG
Rattus_norvegicus|33960            GACAAGGTGGTACAGGATCTCTGTAAAGTAGCAGGCGTGGCAAAGGTTCTGGTGGCTCAG
Microcebus_murinus|1027            ------GTGACACAAGATCTCTGTAAAGTAGCAGGTGTAGCAAAAGTTCTGGTGGCTCAA
Callithrix_jacchus|46819           GACAAGGTGGCACAAGATCTGTGTAAAGTAGCAGGCATAGGAAGGGTTCTGGTGGCTCAG
Gorilla_gorilla|16944              GACAAGGTGGCACAAGATCTCTGTAAAGTAGCAGGCATAGCAAAAGTTCTGGTGGCTCAG
Homo_sapiens|29494                 ------GTGGCACAAGATCTCTGTAAAGTAGCAGGCATAGCAAAAGTTCTGGTGGCTCAG
Pan_troglodytes|13246              GACAAGGTGGCACAAGATCTCTGTAAAGTAGCAGGCATAGCAAAAGTTCTGGTGGCTCAG
Dipodomys_ordii|15863              ------------------------------------------------------------
Tarsius_syrichta|3133              GACAAGGTGGCAGAAGATCTCTGTAAAGTGGCAGGTGTAGCAAAAGTTCTGCTGGCTCAG
Otolemur_garnettii|9647            NNNNNNGTGGCACAAGATCTTTGTAAAGTAGCAGGTGTAGCAAAAGTTCTAGTGGCTCAA
Tupaia_belangeri|12555             ------GTGGCACAGGAGCTCTGTAAAGTAGCGGGCGTTGGGAAGGTCCTGGTAGCTCAG
                                                                                               

Ochotona_princeps|15352            CACGATGCGTACAAGGGCCTGCTTCCAGAGGAGCTGACACCATTGATCCTGGCAACGCAG
Spermophilus_tridecemlineatus|5957 CATGATGCTTACAAAGGCCTCCTTCCAGAGGAACTAACACCACTGATTTTGGCAACTCAG
Oryctolagus_cuniculus|21891        CATGATGCGTACAAAGGCCTCCTCCCAGAGGAGCTGACGCCACTGATTCTGGCAACGCAG
Cavia_porcellus|24855              CATGATGCCTACCAAGGCCTGCTTCCAGAGGAGCTAACACCATTGGTCATGGCCACGCAG
Mus_musculus|44063                 CATGATGCATACAAAGGCCTTCTTCCAGAGGAACTCACACCATTGATTTTGGAAACTCAG
Rattus_norvegicus|33960            CATGATGCGTACAAAGGCCTTCTTCCAGAGGAACTCACACCATTGATTTTGGAAACTCAG
Microcebus_murinus|1027            CACGATGCATACAAAGGCCTCCTTCCAGAGGAACTGACGCCATTGATTTTGGCAACTCAG
Callithrix_jacchus|46819           CATGATGCATACAAAGGCCTACTTCCAGAGGAACTGACACCATTGATTTTGGCAACTCAG
Gorilla_gorilla|16944              CATGATGTGTACAAAGGCCTACTTCCAGAGGAGCTGACACCATTGATTTTGGCAACTCAG
Homo_sapiens|29494                 CATGATGTGTACAAAGGCCTACTTCCAGAGGAACTGACACCATTGATTTTGGCAACTCAG
Pan_troglodytes|13246              CATGATGTGTACAAAGGCCTACTTCCAGAGGAACTGACACCATTGATTTTGGCAACTCAG
Dipodomys_ordii|15863              ------------------------------------------------------------
Tarsius_syrichta|3133              CATGATGCATACAAAGGCCTCCTTCCAGAGGAACTGACACCATTGATTTTGGCAACGCAG
Otolemur_garnettii|9647            CATGATGCATACAAAGGCCTCCTTCCAGAGGAGTTGACGCCACTGATTTTAGCAACTCAG
Tupaia_belangeri|12555             CAGGACGTGTACAAAGGCCTGCTTCCAGAGGAGCTGACGCCGCTGATCCTGGCAACCCAG
                                                                                               

Ochotona_princeps|15352            AAGCAGTTCAATTACACACACATCTGTGCCGGAGCATCTGCCTTTGGGAAGAACCTTCTG
Spermophilus_tridecemlineatus|5957 AAGCAATTCAATTACACACACATCTGTGCTGGAGCATCTGCCTTTGGAAAGAACCTTCTG
Oryctolagus_cuniculus|21891        AAGCAGTTCAATTACACACACATCTGTGCCGGAGCATCTGCCTTCGGAAAGAACCTTTTA
Cavia_porcellus|24855              AAGCAGTTCAGCTACACACACATCTGTGCTGGAGCCTCTGCCTTTGGAAAGAATCTTTTG
Mus_musculus|44063                 AAGCAGTTCAGTTACACACACATCTGTGCTGGAGCGTCTGCTTTTGGAAAGAACCTTCTG
Rattus_norvegicus|33960            AAGCAGTTCAGTTACACACACATCTGTGCTGGAGCATCTGCTTTTGGAAAGAACCTTCTG
Microcebus_murinus|1027            AACCAGTTCAATTACACACACATCTGTGCTGGAGCATCTGCCTTTGGAAAGAACCTTTTG
Callithrix_jacchus|46819           AAGCAATTCAATTACACCCACATCTGTGCTGGAGCATCTGCTTTCGGAAAGAACCTTTTG
Gorilla_gorilla|16944              AAGCAGTTCAATTACACACACATCTGTGCTGGAGCATCTGCCTTCGGAAAGAACCTTTTG
Homo_sapiens|29494                 AAGCAGTTCAATTACACACACATCTGTGCTGGAGCATCTGCCTTCGGAAAGAACCTTTTG
Pan_troglodytes|13246              AAGCAGTTCAATTACACACACATCTGTGCTGGAGCATCTGCCTTCGGAAAGAACCTTTTG
Dipodomys_ordii|15863              ------------------------TGTGCCGGAGCATCTGCCTTCGGGAAGAACCTGTTG
Tarsius_syrichta|3133              AAGCAGTTCAATTACACACACATCTGTGCTGGAGCATCTGCCTTTGGAAAGAACCTTTTG
Otolemur_garnettii|9647            AAGCAGTTCAATTACACACACATCTGTGCTGGAGCATCTGCTTTTGGAAAGAACCTTTTG
Tupaia_belangeri|12555             AAGCAGTTCAATTACACACACATCTGCGCGGGAGCGTCTGCCTTCGGAAAGAACATTCTG
                                                           ** ** ***** ***** ** **.***** .*  *.

Ochotona_princeps|15352            CCTAGAGTAGCGGCCAAGCTTGATGTTGCCCCCATTTCTGACATCATTGCCATCAAGTCT
Spermophilus_tridecemlineatus|5957 CCCAGAATAGCAGCAAAACTTGATGTTGCCCCAATTTCTGACATCATTGCAATCAAGTCA
Oryctolagus_cuniculus|21891        CCCAGAGTAGCGGCCAAACTTGATGTTGCCCCAATTTCTGACATCATTGCCATCAAGTCC
Cavia_porcellus|24855              CCTAGAATAGCAGCCAAACTTGATGTTGCCCCAATTTCTGACATCATTGAGATCAAGTCA
Mus_musculus|44063                 CCCAGAGTAGCTGCCAAACTTAATGTTGCTCCAGTTTCTGACATCATTGAGATCAAGTCA
Rattus_norvegicus|33960            CCCAGAGTAGCAGCCAAACTTAATGTTGCCCCAGTTTCTGACATCATTGAGATCAAGTCA
Microcebus_murinus|1027            CCCAGAGTAGCAGCCAAACTTGATGTTGCCCCAGTTTCTGATATCATTGCAATTAAGTCA
Callithrix_jacchus|46819           CCCAGAGTAGCAGCCAAACTTGAGGTTGCCCCAATTTCTGACATCATTGCAATCAAGTCA
Gorilla_gorilla|16944              CCCAGAGTAGCAGCCAAACTTGAGGTTGCCCCGATTTCTGACATCATTGCAATCAAGTCA
Homo_sapiens|29494                 CCCAGAGTAGCAGCCAAACTTGAGGTTGCCCCGATTTCTGACATCATTGCAATCAAGTCA
Pan_troglodytes|13246              CCCAGAGTAGCGGCCAAACTTGAGGTTGCCCCGATTTCTGACATCATTGCAATCAAGTCA
Dipodomys_ordii|15863              CCCAGAGTAGCAGCTAAACTTGATGTTGCCCCAATTTCTGATATCATTGCAATCAAGTCA
Tarsius_syrichta|3133              CCCAGAATAGCAGCCAAACTTGATGTTGCCCCAATTTCTGATATCATTGCAATCAAGTCA
Otolemur_garnettii|9647            CCCAGGGTAGCAGCCAAACTTGATGTTGCCCCAATTTCTGATATCATTGCAATCAAGTCA
Tupaia_belangeri|12555             CCCAGAATAGCAGCCAAACTTGACGTCGCCCCAATTTCCGACATCATTGAGATCAAGTCT
                                   ** **..**** ** **.***.* ** ** ** .**** ** *******. ** ***** 

Ochotona_princeps|15352            CCCGACACGTTTGTGAGGACTATTTATGCAGGAAATGCTTTGTGTACGGTGAAGTGTGAT
Spermophilus_tridecemlineatus|5957 CCTGACACATTTGTGAGAACTATTTATGCAGGAAATGCTTTATGTACAGTGAAGTGTGAT
Oryctolagus_cuniculus|21891        CCCGACACGTTTGTGAGGACCATTTACGCAGGAAATGCTTTGTGTACGGTGAAGTGTGAT
Cavia_porcellus|24855              CCTGACACATTTGTGAGAACTATTTATGCAGGAAATGCTTTATGTACCGTGAAGTGTGAT
Mus_musculus|44063                 CCTGACACATTTGTGAGAACTATCTATGCAGGAAATGCGTTGTGTACAGTAAAGTGTGAT
Rattus_norvegicus|33960            CCTGACACATTTGTGAGAACTATCTATGCAGGAAATGCATTGTGTACAGTGAAATGTGAT
Microcebus_murinus|1027            CCTGACACATTTGTGAGAACTATTTATGCAGGAAATGCTTTGTGTACAGTGAAGTGTGAT
Callithrix_jacchus|46819           CCTGACACATTTGTGAGAACTATTTATGCAGGAAATGCTGTATGTACAGTGAAGTGTGAT
Gorilla_gorilla|16944              CCTGACACATTTGTGAGAACTATTTATGCAGGAAATGCTCTATGTACAGTGAAGTGTGAT
Homo_sapiens|29494                 CCTGACACATTTGTGAGAACTATTTATGCAGGAAATGCTCTATGTACAGTGAAGTGTGAT
Pan_troglodytes|13246              CCTGACACATTTGTGAGAACTATTTATGCAGGAAATGCTCTATGTACAGTGAAGTGTGAT
Dipodomys_ordii|15863              CCTGACACATTTGTAAGAACTATTTATGCAGGCAATGCGCTGTGCACCGTGAAGTGTGAC
Tarsius_syrichta|3133              CCTGACACATTTGTGAGAACTATTTATGCAGGAAATGCCTTATGTACAGTGAAGTGTGAT
Otolemur_garnettii|9647            CCTGACACATTCGTGAGAACGGTTTATGCAGGAAATGCTTTGTGTACAGTGAAGTGTGAT
Tupaia_belangeri|12555             CCTGACACATTTGTGAGAACTATTTATGCAGGAAATGCTATATGTACCGTGAAGTGTGAT
                                   ** *****.** **.**.** .* ** *****.*****  *.** ** **.**.***** 

Ochotona_princeps|15352            GAGCAAGTGAAGGTGTTTTCTGTTCGAGGAACGGCTTTCGAAGCTGCAGCAACAAGTGGA
Spermophilus_tridecemlineatus|5957 GAGAAAGTGAAGGTGTTTTCTGTCCGAGGAACATCTTTTGAAGCTGCAGCAACAAGTGGA
Oryctolagus_cuniculus|21891        GAGAAAGTGAAGGTGTTCTCTGTCCGGGGAACGTCTTTTGAAGCTGCGGCAACAAGTGGA
Cavia_porcellus|24855              GAGAAAGTGAAGGTGTTTTCTGTCCGAGGAACATCTTTTGAAGCTGCAGCAACAAGTGGA
Mus_musculus|44063                 GAGAAAGTAAAGGTGTTTTCTGTTCGAGGAACATCTTTTGAGGCTGCAGCAACAAGTGGA
Rattus_norvegicus|33960            GAGAAAGTGAAGGTGTTTTCTGTTCGAGGAACATCTTTTGAGGCTGCAGCAGCAAGTGGA
Microcebus_murinus|1027            GAGAAAGTGAAGGTGTTTTCTGTTCGAGGAACATCTTTTGAAGCTGCAACAACAAGTGAA
Callithrix_jacchus|46819           GAGAAAGTGAAAGTGTTTTCAGTCCGTGGAACATCTTTTGAAGCTGCAGCAACAAGTGGC
Gorilla_gorilla|16944              GAGAAAGTGAAAGTGTTTTCTGTCCGTGGAACATCCTTTGAAGCTGCAGAAACAAGTGGC
Homo_sapiens|29494                 GAGAAAGTGAAAGTGTTTTCTGTCCGTGGAACATCCTTTGATGCTGCAGCAACAAGTGGC
Pan_troglodytes|13246              GAGAAAGTGAAAGTGTTTTCTGTCCGTGGAACATCCTTTGAAGCTGCAGCAACAAGTGGC
Dipodomys_ordii|15863              GAGAAAGTGAAGGTGTTCTCCGTCCGAGGAACATCTTTTGAAGCTGCAGCGGCGAGTGGA
Tarsius_syrichta|3133              GAAAAAGTGAAGGTGTTTTCTGTCCGAGGAACATCTTTTGAAGCTGTGACAACAAGTGGA
Otolemur_garnettii|9647            GAGAAAGTGAAGGTGTTTTCTGTTAGAGGAACATCTTTTGAGGCTGCGGCAGCAGGTGGA
Tupaia_belangeri|12555             GAGAAAGTGAAGGTGTTTTCCGTCCGAGGAACATCTTTTGAAGCTGCGGCGACAAGTGGA
                                   **..****.**.***** ** ** .* *****. * ** ** **** .....*..***..

Ochotona_princeps|15352            GGTAGTGCCAGTTCAGAAAACGCTTCTAGTACCTCACCGGTGGGGGTGTCCGAGTGCCTC
Spermophilus_tridecemlineatus|5957 GGTAGTGCCAGTTCAGAAAAGGCATCAAGTACTTCGCCAGTGGGAGTGTCAGAGTGGCTT
Oryctolagus_cuniculus|21891        GGCAGTGCCAGTTCAGAAAATGCTTCAAGTACTTCCCCAGTGGGAATATCGGAGTGGCTC
Cavia_porcellus|24855              GGTAGTGCCAGTTCAGAGAATGCACCAAGTTCTTCACCAGTGGGAATATCACAATGGCTT
Mus_musculus|44063                 GGTAGTGCTAGTTCAGAAAAGGCACCAAGTTCTTCATCAGTGGGAATATCAGAGTGGCTT
Rattus_norvegicus|33960            GGTAGTGCCAGTTCAGAAAAGGCACCAAGTTCTTCATCAGCAGGAATATCAGAGTGGCTT
Microcebus_murinus|1027            GGTAGTGCTGGTTCAGAAAAGGCATCAAGTACTTCACCAGTGGGAATATCAGAGTGGCTT
Callithrix_jacchus|46819           GGTAGTGGCAGTTCAGAAAAGGCATCAAGTACTTCACCAGTAGGAATATCAGAGTGGCTT
Gorilla_gorilla|16944              GGTAGTGCCAGTTCAGAAAAGGCATCAAGTACTTCACCAGTGGAAATATCAGAGTGGCTT
Homo_sapiens|29494                 GGTAGTGCCAGTTCAGAAAAGGCATCAAGTACTTCACCAGTGGAAATATCAGAGTGGCTT
Pan_troglodytes|13246              GGTAGTGCCAGTTCAGAAAAGGCATCAAGTACTTCACCAGTGGAAATATCAGAGTGGCTT
Dipodomys_ordii|15863              GGCAGTGCTGGCTCAGAGAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|3133              GGTAGTGCCAGTTCAGAAAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|9647            GGTAGTGCCAGTTCTGAAAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|12555             GGTAGTGCCAGTTCAGAAAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                   ** ****  .* **:**.** *      ..   .     .  .   . .     ..  . 

Ochotona_princeps|15352            GACAAA------CTACAGAGCGACCGG------CCAGAGCTGACGGGTNNNNNNNNNNNN
Spermophilus_tridecemlineatus|5957 GACCAGAAATTAACGAAAAGTGATCGA------CCAGAGCTAACTGGTGCCAAAGTAGTG
Oryctolagus_cuniculus|21891        GAACAGAAACTAACCAAAAGTGATCGA------CCAGAGCTAACTGGTGCCAAAGTAGTG
Cavia_porcellus|24855              GACCAGAAGTTAACAAAAAGTGATCGG------CCAGAGCTGACTGGTGCCAAAGTGGTT
Mus_musculus|44063                 GACCAGAAATTGACAAAAAGTGACCGA------CCAGAACTAACTGGTGCCAAAGTGGTG
Rattus_norvegicus|33960            GACCAGAAATTGACAAAAAGTGACCGA------CCAGAGCTAACTGGTGCCAAAGTGGTG
Microcebus_murinus|1027            GACCAGAAATTAACGAAAAGTGATCGA------CCAGAGCTAATAGGTGCCAAAGTGGTG
Callithrix_jacchus|46819           GACCAGAAATTAACAAAAAGTGATCGA------CCAGAGTTAACAGGTGCCAAAGTGGTG
Gorilla_gorilla|16944              GACCAGAAATTAACAAAAAGTGATCGA------CCAGAGCTAACAGGTGCCAAAGTGGTG
Homo_sapiens|29494                 GACCAGAAATTAACAAAAAGTGATCGA------CCAGAGCTAACAGGTGCCAAAGTGGTG
Pan_troglodytes|13246              GACCAGAAATTAACAAAAAGTGATCGA------CCAGAGCTAACAGGTGCCAAAGTGGTG
Dipodomys_ordii|15863              NNNNNNNNNNNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|3133              NNNNNNNNNNNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|9647            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNNNNNNNNNNN
Tupaia_belangeri|12555             NNNNNNNNNNNNNNNAAAAGTGACCGA------CCGGAGCTA------GGTAAAGTGGTA
                                   .                  . .   .          .   .       .     .. .. 

Ochotona_princeps|15352            NNNNNNNNNNGTCGGGGCTTGAAGAGTGGAGAGAACTTTAAGCTGCTGTATGACCTGGCA
Spermophilus_tridecemlineatus|5957 GTGTCTGGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Oryctolagus_cuniculus|21891        GTCTCTGGTGGTCGGGGTTTGAAGAGTGGAGAGAACTTCAAGTTGCTGTATGACCTGGCA
Cavia_porcellus|24855              GTATCTGGTGGTCGTGGTTTGAAGAGTGGAGAGAATTTTAAGTTGTTATATGACTTGGCA
Mus_musculus|44063                 GTATCTGGTGGTCGGGGTTTGAAGAGTGGAGAGAACTTTAAACTGCTGTATGACCTGGCA
Rattus_norvegicus|33960            GTATCTGGTGGTCGGGGCTTGAAGAGTGGAGAGAACTTTAAACTGCTGTATGACTTGGCA
Microcebus_murinus|1027            GTATCTGGTGGCCGGGGTTTGAAGAGTGGAGAGAACTTTAAGCTGTTATATGACTTGGCA
Callithrix_jacchus|46819           GTATCTGGTGGTCGAGGCTTGAAGAGTGGAGAGAACTTTAAGTTGTTATATGACTTGGCA
Gorilla_gorilla|16944              GTATCTGGT---------------------------------------------------
Homo_sapiens|29494                 GTATCTGGTGGTCGAGGCTTGAAGAGTGGAGAGAACTTTAAGTTGTTATATGACTTGGCA
Pan_troglodytes|13246              GTATCTGGTGGTCGAGGCTTGAAGAGTGGAGAGAACTTTAAGTTGTTATATGACTTGGCA
Dipodomys_ordii|15863              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|3133              NNNNNNNNNNGTCGGGGTTTGAAGAGTGGAGAGAACTTTAAGTTGCTATATGACTTGGCA
Otolemur_garnettii|9647            NNNNNNNNNNGTCGGGGTTTGAAGAGTGGAGAGAACTTCAAGTTGTTATATGATTTGGCA
Tupaia_belangeri|12555             GTATCTGGTGGCCGGGGTTTGAAGAGTGGCGAGAACTTTAAGTTGCTATATGACTTGGCA
                                   .. . ....                                                   

Ochotona_princeps|15352            GATCAGCTGCATGCCGCAGTTGGTGCTTCTCGAGCTGCTGTTGATGCTGGCTTTGTTCCC
Spermophilus_tridecemlineatus|5957 NNNNNNNNNNNNNNNNNNNTTGGTGCTTCCCGTGCTGCTGTTGATGCTGGCTTTGTTCCC
Oryctolagus_cuniculus|21891        GATGAACTGCACGCTGCAGTTGGTGCTTCCCGCGCTGCTGTTGATGCTGGCTACGTTCCC
Cavia_porcellus|24855              GATCAACTACATGCTGCAGTTGGTGCATCCCGAGCGGCTGTTGATGCTGGCTTCGTTCCC
Mus_musculus|44063                 GATCAACTACATGCTGCAGTTGGTGCTTCCCGAGCTGCTGTTGATGCTGGCTTTGTTCCC
Rattus_norvegicus|33960            GATCAGCTGCATGCTGCAGTTGGTGCTTCCCGTGCTGCTGTTGATGCTGGCTTTGTTCCC
Microcebus_murinus|1027            GATCAACTGCATGCTGCAGTTGGTGCTTCCCGTGCTGCTGTTGATGCTGGCTTTGTTCCC
Callithrix_jacchus|46819           GATCAACTACATGCAGCAGTTGGTGCTTCCCGTGCTGCTGTTGATGCTGGCTTTGTTCCC
Gorilla_gorilla|16944              ------------------------------------------------------------
Homo_sapiens|29494                 GATCAACTACATGCTGCAGTTGGTGCTTCCCGTGCTGCTGTTGATGCTGGCTTTGTTCCC
Pan_troglodytes|13246              GATCAACTACATGCTGCAGTTGGTGCTTCCCGTGCCGCTGTTGATGCTGGCTTTGTTCCC
Dipodomys_ordii|15863              NNNNNNNNNNNNNNNNNNNTTGGAGCCTCCCGTGCTGCTGTGGATGCTGGCTTTGTCCCC
Tarsius_syrichta|3133              GATCAGCTACATGCTGCAGTTGGTGCTTCCCGTGCTGCTGTTGATGCTGGCTTTGTTCCT
Otolemur_garnettii|9647            GATCAGTTGCATGCAGCAGTTGGTGCTTCCCGGGCTGCTGTTGATGCTGGCTTTGTT---
Tupaia_belangeri|12555             GATCAACTACATGCTGCAGTTGGTGCTTCCCGTGCTGCCGTCGACGCCGGCTTTGTCCCC
                                                                                               

Ochotona_princeps|15352            AATGACATGCAAGTTGGACAGACGGGAAAAATTGTAGCACCANNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|5957 AATGACATGCAAGTTGGTCAGACAGGAAAAATAGTAGCACCANNNNNNNNNNNNNNNNNN
Oryctolagus_cuniculus|21891        AATGACATGCAAGTCGGACAGACAGGAAAAATAGTAGCACCAGAGCTTTATATTGCTGTT
Cavia_porcellus|24855              AATGATATGCAAGTTGGTCAGACAGGAAAAATTGTAGCACCAGAACTTTATATTGCTGTT
Mus_musculus|44063                 AATGACATGCAAGTTGGTCAGACAGGAAAAATAGTAGCTCCAGAACTTTATATTGCTGTA
Rattus_norvegicus|33960            AATGACATGCAAGTTGGTCAGACAGGAAAAATAGTAGCTCCAGAACTTTATATTGCTGTT
Microcebus_murinus|1027            AATGATATGCAAGTTGGACAGACAGGAAAAATAGTAGCACCAGAACTTTATATTGCTGTT
Callithrix_jacchus|46819           AATGACATGCAAGTTGGACAGACAGGAAAAATAGTAGCACCAGAACTTTACATTGCTGTT
Gorilla_gorilla|16944              ------------------------------------------------------------
Homo_sapiens|29494                 AATGACATGCAAGTTGGACAGACGGGAAAAATAGTAGCACCAGAACTTTATATTGCTGTT
Pan_troglodytes|13246              AATGACATGCAAGTTGGACAGACGGGAAAAATAGTAGCACCAGAACTTTATATTGCTGTT
Dipodomys_ordii|15863              AATGACATGCAAGTCGGTCAGACAGGAAAAATAGTAGCACCTGAACTTTATATTGCTGTT
Tarsius_syrichta|3133              AATGACATGCAAGTTGGACAAACAGGAAAAATAGTAGCACCAGAACTTTACATTGCTGTT
Otolemur_garnettii|9647            AATGATATGCAAGTTGGACAGACAGGAAAAATAGTAGCACCAGAACTTTATATTGCTGTT
Tupaia_belangeri|12555             AATGACATGCAGGTTGGACAGACTGGAAAAATAGTAGCCCCGNNNNNNNNNNNNNNNNNN
                                                                                               

Ochotona_princeps|15352            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACAATTGTGGCT
Spermophilus_tridecemlineatus|5957 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Oryctolagus_cuniculus|21891        GGAATATCTGGAGCCATCCAACATTTAGCTGGAATGAAAGACAGCAAGACAATTGTGGCT
Cavia_porcellus|24855              GGAATCTCTGGAGCCATCCAGCATTTAGCTGGGATGAAGGATAGCAAGACAATTGTGGCT
Mus_musculus|44063                 GGAATATCTGGAGCCATTCAACATTTAGCTGGGATGAAGGACAGCAAGACAATCGTGGCT
Rattus_norvegicus|33960            GGAATATCTGGAGCCATCCAGCATTTAGCTGGGATGAAGGACAGCAAGACAATTGTGGCT
Microcebus_murinus|1027            GGGATATCCGGAGCCATCCAACATTTAGCTGGGATGAAAGACAGCAAGACAATTGTGGCT
Callithrix_jacchus|46819           GGAATATCTGGAGCCATCCAGCATTTAGCTGGGATGAAAGACAGCAAGACAATTGTGGCT
Gorilla_gorilla|16944              ------------------------------------------------------------
Homo_sapiens|29494                 GGAATATCTGGAGCCATCCAACATTTAGCTGGGATGAAAGACAGCAAGACAATTGTGGCA
Pan_troglodytes|13246              GGAATATCTGGAGCCATCCAACATTTAGCTGGAATGAAAGACAGCAAGACAATTGTGGCT
Dipodomys_ordii|15863              GGGATTTCTGGAGCCATCCAACATTTGGCTGGAATGAAAGACAGCAAGACAATTGTGGCT
Tarsius_syrichta|3133              GGAATATCTGGAGCCATCCAACATTTAGCTGGGATGAAAGACAGCAAGACAATTGTGGCT
Otolemur_garnettii|9647            GGAATATCTGGAGCCATTCAGCATCTAGCTGGGATGAAGGACAGCAAGNNNNNNNNNNNN
Tupaia_belangeri|12555             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                                                                               

Ochotona_princeps|15352            ATTAACAAAGACCCAGAAGCCCCCATTTTCCAGGTGGCTGACTATGGAATCGTCGCAGAC
Spermophilus_tridecemlineatus|5957 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Oryctolagus_cuniculus|21891        ATTAACAAAGACCCCGAAGCACCCATATTCCAAGTGGCCGATTATGGAATAGTCGCAGAC
Cavia_porcellus|24855              ATTAACAAAGACCCAGAAGCCCCAATTTTCCAGGTGGCAGATTATGGAATAGTTGCAGAT
Mus_musculus|44063                 ATTAACAAAGATCCAGAAGCTCCAATTTTCCAGGTGGCAGATTATGGAATAGTTGCAGAT
Rattus_norvegicus|33960            ATTAACAAAGACCCAGAAGCTCCAATTTTCCAAGTGGCAGATTATGGAATAGTTGCAGAT
Microcebus_murinus|1027            ATTAATAAAGACCCAGAAGCTCCAATTTTCCAAGTGGCAGATTATGGAATAGTTGCAGAT
Callithrix_jacchus|46819           ATTAATAAAGACCCAGAGGCTCCAATTTTCCAGGTGGCAGATTATGGAATAGTGGCGGAT
Gorilla_gorilla|16944              ------------------------------------------------------------
Homo_sapiens|29494                 ATTAATAAAGACCCAGAAGCTCCAATTTTCCAAGTGGCAGATTATGGAATAGTTGCAGAT
Pan_troglodytes|13246              ATTAATAAAGACCCAGAAGCTCCAATTTTCCAAGTGGCAGATTATGGAATAGTTGCAGAT
Dipodomys_ordii|15863              ATTAACAAAGACCCAGAAGCTCCAATTTTCCAAGTGGCAGATTATGGCATAGTGGCAGAT
Tarsius_syrichta|3133              ATTAATAAAGACCCAGAAGCTCCAATTTTTCAAGTGGCAGATTATGGAATAGTCGCAGAT
Otolemur_garnettii|9647            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|12555             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                                                                               

Ochotona_princeps|15352            TTGTTTAAG---------------------------------------
Spermophilus_tridecemlineatus|5957 NNNNNNNNNGTGGTTCCTGAAATGACCGAACTATTGAAGAAAAAATGA
Oryctolagus_cuniculus|21891        TTATTTAAGGTAGTTCCTGAAATGACTGAGCTGCTGAAGAAGAAG---
Cavia_porcellus|24855              TTATTTAAGGTAGTACCTGAAATGACTGAGCTATTGAAGAAAAAG---
Mus_musculus|44063                 TTATTTAAGGTGGTTCCTGAAATGACAGAAATACTGAAGAAAAAATAA
Rattus_norvegicus|33960            TTATTTAAGGTGGTTCCTGAAATGACAGAAATACTGAAGAAAAAATAA
Microcebus_murinus|1027            TTATTTAAGGTAGTTCCTGAAATGACTGAGATATTGAAGAAAAAATGA
Callithrix_jacchus|46819           TTATTTAAGGTTGTTCCTGAAATGACTGAGATATTGAAGAAAAAA---
Gorilla_gorilla|16944              ------------------------------------------------
Homo_sapiens|29494                 TTATTTAAGGTAGTTCCTGAAATGACTGAGATATTGAAGAAAAAATGA
Pan_troglodytes|13246              TTATTTAAGGTAGTTCCTGAAATGACTGAGATATTGAAGAAAAAATGA
Dipodomys_ordii|15863              CTGTTTAAG---------------------------------------
Tarsius_syrichta|3133              TTATTTAAGGTAGTTCCTGAAATGACTGAGCTATTGAAGAAGAAATGA
Otolemur_garnettii|9647            NNNNNNNNNGTAGTTCCTGAAATGACTGAGATTTTGAAGAAAAAATGA
Tupaia_belangeri|12555             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGAAAAAGTGA
                                                                                   

multiple sequence alignment in CLUSTALW format


Ochotona_princeps|13380            MFRAVAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNAITAAKRLGGDVSCLVAGTKC
Spermophilus_tridecemlineatus|5329 -------------ASLLRFQSTLVIAEHADDSLAPITLNTITAAKHLGGEVSCLVAGTKC
Oryctolagus_cuniculus|7367         MLRAVAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNTITAAKRLGGDVSCLVAGTKC
Cavia_porcellus|19709              -------------AALLRFQSTLVIAEHANDSLAPITLNTITAARRLGGEVSCLVAGTKC
Mus_musculus|27950                 MFRAAAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNTITAAGRLGGEVSCLVAGTKC
Rattus_norvegicus|21880            MFRAAAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNTITAAGRLGGEVSCLVAGTKC
Microcebus_murinus|869             ------------------------------------------------------------
Callithrix_jacchus|38007           MFRAAAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNTITAAKRLGGEVSCLVAGTKC
Gorilla_gorilla|13582              MFRAAAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNTITAATRLGGEVSCLVAGTKC
Homo_sapiens|22700                 MFRAAAPGQLRRA-----------------------------------------------
Pan_troglodytes|16968              MFRAAAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNTITAATRLEGEVSCLVAGTKC
Dipodomys_ordii|14914              ------------------------------------------------------------
Tarsius_syrichta|2878              MFRVAAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNTITAAKR-GGEGSCLLAGTKC
Otolemur_garnettii|8302            MFRAVFPGQLRRAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tupaia_belangeri|10879             ------------------------------------------------------------
                                                                                               

Ochotona_princeps|13380            DKVAQELCKVEGVAKVLVAQHDAYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLL
Spermophilus_tridecemlineatus|5329 DKVAQDLCKVAGVAKVLVAQHDAYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLL
Oryctolagus_cuniculus|7367         DKVAQDLCKVEGVTKVLVAQHDAYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLL
Cavia_porcellus|19709              DKVVQDLCKVAGIAKVLVAQHDAYQGLLPEELTPLVMATQKQFSYTHICAGASAFGKNLL
Mus_musculus|27950                 DKVVQDLCKVAGVAKVLVAQHDAYKGLLPEELTPLILETQKQFSYTHICAGASAFGKNLL
Rattus_norvegicus|21880            DKVVQDLCKVAGVAKVLVAQHDAYKGLLPEELTPLILETQKQFSYTHICAGASAFGKNLL
Microcebus_murinus|869             --VTQDLCKVAGVAKVLVAQHDAYKGLLPEELTPLILATQNQFNYTHICAGASAFGKNLL
Callithrix_jacchus|38007           DKVAQDLCKVAGIGRVLVAQHDAYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLL
Gorilla_gorilla|13582              DKVAQDLCKVAGIAKVLVAQHDVYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLL
Homo_sapiens|22700                 --VAQDLCKVAGIAKVLVAQHDVYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLL
Pan_troglodytes|16968              DKVAQDLCKVAGIAKVLVAQHDVYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLL
Dipodomys_ordii|14914              ------------------------------------------------CAGASAFGKNLL
Tarsius_syrichta|2878              DKVAEDLCKVAGVAKVLLAQHDAYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLL
Otolemur_garnettii|8302            XXVAQDLCKVAGVAKVLVAQHDAYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLL
Tupaia_belangeri|10879             --VAQELCKVAGVGKVLVAQQDVYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNIL
                                                                                   **********:*

Ochotona_princeps|13380            PRVAAKLDVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEQVKVFSVRGTAFEAAATSG
Spermophilus_tridecemlineatus|5329 PRIAAKLDVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFEAAATSG
Oryctolagus_cuniculus|7367         PRVAAKLDVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFEAAATSG
Cavia_porcellus|19709              PRIAAKLDVAPISDIIEIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFEAAATSG
Mus_musculus|27950                 PRVAAKLNVAPVSDIIEIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFEAAATSG
Rattus_norvegicus|21880            PRVAAKLNVAPVSDIIEIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFEAAAASG
Microcebus_murinus|869             PRVAAKLDVAPVSDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFEAATTSE
Callithrix_jacchus|38007           PRVAAKLEVAPISDIIAIKSPDTFVRTIYAGNAVCTVKCDEKVKVFSVRGTSFEAAATSG
Gorilla_gorilla|13582              PRVAAKLEVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFEAAETSG
Homo_sapiens|22700                 PRVAAKLEVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFDAAATSG
Pan_troglodytes|16968              PRVAAKLEVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFEAAATSG
Dipodomys_ordii|14914              PRVAAKLDVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFEAAAASG
Tarsius_syrichta|2878              PRIAAKLDVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFEAVTTSG
Otolemur_garnettii|8302            PRVAAKLDVAPISDIIAIKSPDTFVRTVYAGNALCTVKCDEKVKVFSVRGTSFEAAAAGG
Tupaia_belangeri|10879             PRIAAKLDVAPISDIIEIKSPDTFVRTIYAGNAICTVKCDEKVKVFSVRGTSFEAAATSG
                                   **:****:***:**** **********:*****:*******:*********:*:*. :. 

Ochotona_princeps|13380            GSASSENASSTSPVGVSECLDK--LQSDR--PELTGXXXXXXXXRGLKSGENFKLLYDLA
Spermophilus_tridecemlineatus|5329 GSASSEKASSTSPVGVSEWLDQKLTKSDR--PELTGAKVVVSGXXXXXXXXXXXXXXXXX
Oryctolagus_cuniculus|7367         GSASSENASSTSPVGISEWLEQKLTKSDR--PELTGAKVVVSGGRGLKSGENFKLLYDLA
Cavia_porcellus|19709              GSASSENAPSSSPVGISQWLDQKLTKSDR--PELTGAKVVVSGGRGLKSGENFKLLYDLA
Mus_musculus|27950                 GSASSEKAPSSSSVGISEWLDQKLTKSDR--PELTGAKVVVSGGRGLKSGENFKLLYDLA
Rattus_norvegicus|21880            GSASSEKAPSSSSAGISEWLDQKLTKSDR--PELTGAKVVVSGGRGLKSGENFKLLYDLA
Microcebus_murinus|869             GSAGSEKASSTSPVGISEWLDQKLTKSDR--PELIGAKVVVSGGRGLKSGENFKLLYDLA
Callithrix_jacchus|38007           GSGSSEKASSTSPVGISEWLDQKLTKSDR--PELTGAKVVVSGGRGLKSGENFKLLYDLA
Gorilla_gorilla|13582              GSASSEKASSTSPVEISEWLDQKLTKSDR--PELTGAKVVVSG-----------------
Homo_sapiens|22700                 GSASSEKASSTSPVEISEWLDQKLTKSDR--PELTGAKVVVSGGRGLKSGENFKLLYDLA
Pan_troglodytes|16968              GSASSEKASSTSPVEISEWLDQKLTKSDR--PELTGAKVVVSGGRGLKSGENFKLLYDLA
Dipodomys_ordii|14914              GSAGSEKXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tarsius_syrichta|2878              GSASSEKXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXRGLKSGENFKLLYDLA
Otolemur_garnettii|8302            GSASSEKXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXRGLKSGENFKLLYDLA
Tupaia_belangeri|10879             GSASSEKXXXXXXXXXXXXXXXXXXKSDR--PEL--GKVVVSGGRGLKSGENFKLLYDLA
                                   **..**:                                                     

Ochotona_princeps|13380            DQLHAAVGASRAAVDAGFVPNDMQVGQTGKIVAPXXXXXXXXXXXXXXXXXXXXXXTIVA
Spermophilus_tridecemlineatus|5329 XXXXXXXGASRAAVDAGFVPNDMQVGQTGKIVAPXXXXXXXXXXXXXXXXXXXXXXXXXX
Oryctolagus_cuniculus|7367         DELHAAVGASRAAVDAGYVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVA
Cavia_porcellus|19709              DQLHAAVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVA
Mus_musculus|27950                 DQLHAAVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVA
Rattus_norvegicus|21880            DQLHAAVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVA
Microcebus_murinus|869             DQLHAAVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVA
Callithrix_jacchus|38007           DQLHAAVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVA
Gorilla_gorilla|13582              ------------------------------------------------------------
Homo_sapiens|22700                 DQLHAAVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVA
Pan_troglodytes|16968              DQLHAAVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVA
Dipodomys_ordii|14914              XXXXXXXGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVA
Tarsius_syrichta|2878              DQLHAAVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVA
Otolemur_garnettii|8302            DQLHAAVGASRAAVDAGFV-NDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKXXXX
Tupaia_belangeri|10879             DQLHAAVGASRAAVDAGFVPNDMQVGQTGKIVAPXXXXXXXXXXXXXXXXXXXXXXXXXX
                                                                                               

Ochotona_princeps|13380            INKDPEAPIFQVADYGIVADLFK------------
Spermophilus_tridecemlineatus|5329 XXXXXXXXXXXXXXXXXXXXXXXVVPEMTELLKKK
Oryctolagus_cuniculus|7367         INKDPEAPIFQVADYGIVADLFKVVPEMTELLKKK
Cavia_porcellus|19709              INKDPEAPIFQVADYGIVADLFKVVPEMTELLKKK
Mus_musculus|27950                 INKDPEAPIFQVADYGIVADLFKVVPEMTEILKKK
Rattus_norvegicus|21880            INKDPEAPIFQVADYGIVADLFKVVPEMTEILKKK
Microcebus_murinus|869             INKDPEAPIFQVADYGIVADLFKVVPEMTEILKKK
Callithrix_jacchus|38007           INKDPEAPIFQVADYGIVADLFKVVPEMTEILKKK
Gorilla_gorilla|13582              -----------------------------------
Homo_sapiens|22700                 INKDPEAPIFQVADYGIVADLFKVVPEMTEILKKK
Pan_troglodytes|16968              INKDPEAPIFQVADYGIVADLFKVVPEMTEILKKK
Dipodomys_ordii|14914              INKDPEAPIFQVADYGIVADLFK------------
Tarsius_syrichta|2878              INKDPEAPIFQVADYGIVADLFKVVPEMTELLKKK
Otolemur_garnettii|8302            XXXXXXXXXXXXXXXXXXXXXXXVVPEMTEILKKK
Tupaia_belangeri|10879             XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKK