Orthologs Set ID: EOG4003HQ


Orthology Database
OrthoDB4
Gene Symbol(s)
OLFR139

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Cavia porcellus 13769
Mus musculus 6470

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Cavia porcellus 13769 ENSCPOT00000020439 100735742 ENSCPOG00000027586 cavPor3
Mus musculus 6470 ENSMUST00000050678, NM_147003 259005 ENSMUSG00000047444 Olfr139 mm9

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Cavia porcellus 10775 ENSCPOP00000018030 100735742 ENSCPOG00000027586 cavPor3
Mus musculus 197 ENSMUSP00000049558 259005 ENSMUSG00000047444 Olfr139 mm9

multiple sequence alignment in CLUSTALW format


Cavia_porcellus|13769 TTGGAAGCAAGCACCAGCAGCAACAGGAGAGCTGTCACCAAGTTCACTCTCCTTGGCCTG
Mus_musculus|6470     ATGGAGCCAGGTGCCTGGGGAAACAGGACAGCTGTCACGGATTTCATCCTTCTTGGCTTA
                      :****. **.* .**:* .*.******* ********* .* ****  ** ****** *.

Cavia_porcellus|13769 ACAGAGAGTGTTGATCTGCAATCTATTGTGTATGTTGTGTTTTTCTGTGCCTATGTAGTC
Mus_musculus|6470     ACAGGAAATGTAAGACTGCAACCTATCCTTTTTGTTGTCTTCTTCTTTGCCTATATTGTC
                      ****..*.***:..:****** ****  * *:****** ** **** *******.*:***

Cavia_porcellus|13769 ACCTTAGGGGGCAACTTGAGCATCATCTCTACCATCTTTGTGGAGCCCAAACTCCACACC
Mus_musculus|6470     ACAGTTGGGGGTAACCTCAGCATCTTGGCCGCCATCTTTGTGGAACCCAAGCTCCACACT
                      **. *:***** *** * ******:*  * .*************.*****.******** 

Cavia_porcellus|13769 CTCATGTACTACTTCCTGGGGATCCTGTCTCTGCTGGACATCGGGTGCATCACGGTCACG
Mus_musculus|6470     CCTATGTACTACTTCTTGGGGAATCTATCTCTGTTGGACATCGGATGCATCAGTGTCACT
                      *  ************ ******: **.****** **********.*******  ***** 

Cavia_porcellus|13769 GTTCCTCCAATGCTGTTGTGTCTCCTGGCCCACCAGTGCAGAGTTCCCTATGGTTCCTGC
Mus_musculus|6470     GTTCCTCCAATGCTTGTGTGTCTCCTGGCTCATGAGTGCAGAGTTCCCTACGCTGCCTGC
                      **************  ************* **  **************** * * *****

Cavia_porcellus|13769 CTTTCAAAGCTCTTCTTTTTCCAACTTTTGGCTGGTGTAGACCGTCACCTCTTGACAGCC
Mus_musculus|6470     ATTTCACAGCTCTTTTTTTTCCACCTCCTGGCAGGTGTGGACTGTCATCTCTTGACAGCC
                      .*****.******* ********.**  ****:*****.*** **** ************

Cavia_porcellus|13769 ATGGCCTATGACCGCTATCTGGCCATCTGCCAGCCCTTCTCCTACAGCACCCACACAAGC
Mus_musculus|6470     ATGGCCTATGACCGCTACCTGGCCATCTGCCAGCCCCTCACCTACAGCACCCGCATGAGC
                      ***************** ****************** **:************.** .***

Cavia_porcellus|13769 CGTGAGGTACAGGGTGCCCTGGTGGGTACCTGCTGCACTGTCTCCTTCTTCAATGCTCTG
Mus_musculus|6470     CGTGAAGTGCAGGGCACACTGGTGGGTATTTGCTGTACTGTCTCCTTCATTAATGCTCTG
                      *****.**.***** .*.**********  ***** ************:* *********

Cavia_porcellus|13769 ACTCACACATTGGCTGTGTCTGTGCTAGACTTCTGCTGCCCAAATGTGATCACCAACTTC
Mus_musculus|6470     ACTCACACAGTGGCAGTGTCTGTGCTGGATTTCTGTGGCCCTAATGTGGTCAACCACTTC
                      ********* ****:***********.** *****  ****:******.***.*.*****

Cavia_porcellus|13769 TACTGCGACCTCCCACCTCTGTGCCAGCTCTCCTTCTCCAGTATCCACCTCAGTGGGCAA
Mus_musculus|6470     TACTGTGACCTTCCACCTCTTTTCCAGCTCTCCTGCTCCAGCATCTACCTCAATGGGCAA
                      ***** ***** ******** * *********** ****** *** ******.*******

Cavia_porcellus|13769 CTGCTGTTTGTGGGGGCCACTTTCATGCGAGTGATCCCCATGATCCTCATCTCAGTGTCC
Mus_musculus|6470     CTGCTTTTTGTGGGAGCCACTTTCATGGGAGTAGTCCCCATGATACTTATCTCAGTGTCC
                      ***** ********.************ ****..**********.** ************

Cavia_porcellus|13769 TATGCCCACATCGCTGCTGTGGTACTGTGGATCTGCTCCGCTGAGGGGAGGAAGAAGGCC
Mus_musculus|6470     TATGCCCACGTTGCAGCTGCAGTACTACGGATCCGCTCCACAGAGGGGAGGAAGAAGGCA
                      *********.* **:**** .*****. ***** *****.*:*****************.

Cavia_porcellus|13769 TTCTCCACGTGTGGCTCCCACCTCACTGTGGTTTGCTTTTTTTATGGAACGGGCTTCTTC
Mus_musculus|6470     TTTTCCACATGCGGCTCCCACCTCACTGTGGTCTGTATCTTTTATGGAACTGGCTTCTTC
                      ** *****.** ******************** ** :* *********** *********

Cavia_porcellus|13769 AGTTACATGCGCCTGGGCTCAATCTCAGCCCTAGATAAGGACAAAGGGATTGCAGTCTTT
Mus_musculus|6470     AGTTACATGCGTCTGGGTTCTGTCTCAGCCTCAGACAAGGACAAGGGCATTGGGATCCTC
                      *********** ***** **:.********  *** ********.** **** ..** * 

Cavia_porcellus|13769 AATGCAGTCTTTGTTCTCAATCCCATGCTGAACCCCATCATCTACAGTCTCTGGAACCCC
Mus_musculus|6470     AATACT------ATCCTCAGCCCTATGTTAAACCCACTCATCTACAGCCTCCGGAACCCA
                      ***.*:      .* ****. ** *** *.*****..********** *** *******.

Cavia_porcellus|13769 GATGTAGAGAGCGCCCTGAAGAGGGTGCTGACAGGGAGGAAG------------
Mus_musculus|6470     GATGTACAGGGTGCCCTGAAGAGGGTGCTGACAGGAAAGAGGTATCCAGTGTGA
                      ****** **.* ***********************.*.**.*            

multiple sequence alignment in CLUSTALW format


Cavia_porcellus|10775 LEASTSSNRRAVTKFTLLGLTESVDLQSIVYVVFFCAYVVTLGGNLSIISTIFVEPKLHT
Mus_musculus|197      MEPGAWGNRTAVTDFILLGLTGNVRLQPILFVVFFFAYIVTVGGNLSILAAIFVEPKLHT
                      :*..: .** ***.* ***** .* **.*::**** **:**:******:::*********

Cavia_porcellus|10775 LMYYFLGILSLLDIGCITVTVPPMLLCLLAHQCRVPYGSCLSKLFFFQLLAGVDRHLLTA
Mus_musculus|197      PMYYFLGNLSLLDIGCISVTVPPMLVCLLAHECRVPYAACISQLFFFHLLAGVDCHLLTA
                       ****** *********:*******:*****:*****.:*:*:****:****** *****

Cavia_porcellus|10775 MAYDRYLAICQPFSYSTHTSREVQGALVGTCCTVSFFNALTHTLAVSVLDFCCPNVITNF
Mus_musculus|197      MAYDRYLAICQPLTYSTRMSREVQGTLVGICCTVSFINALTHTVAVSVLDFCGPNVVNHF
                      ************::***: ******:*** ******:******:******** ***:.:*

Cavia_porcellus|10775 YCDLPPLCQLSFSSIHLSGQLLFVGATFMRVIPMILISVSYAHIAAVVLWICSAEGRKKA
Mus_musculus|197      YCDLPPLFQLSCSSIYLNGQLLFVGATFMGVVPMILISVSYAHVAAAVLRIRSTEGRKKA
                      ******* *** ***:*.*********** *:***********:**.** * *:******

Cavia_porcellus|10775 FSTCGSHLTVVCFFYGTGFFSYMRLGSISALDKDKGIAVFNAVFVLNPMLNPIIYSLWNP
Mus_musculus|197      FSTCGSHLTVVCIFYGTGFFSYMRLGSVSASDKDKGIGILNT--ILSPMLNPLIYSLRNP
                      ************:**************:** ******.::*:  :*.*****:**** **

Cavia_porcellus|10775 DVESALKRVLTGRK---
Mus_musculus|197      DVQGALKRVLTGKRYPV
                      **:.********::