Orthologs Set ID: EOG4003HR


Orthology Database
OrthoDB4
Gene Symbol(s)
IYD

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 40035 187, 379, 548, 705
Cavia porcellus 19609 187, 379, 548, 705
Cavia porcellus 20575 379, 506, 530, 705
Dipodomys ordii 15634 187, 379, 548, 705
Gorilla gorilla 12887 187, 379, 548, 705, 826
Homo sapiens 76454 187, 379, 548, 705
Microcebus murinus 4919 187, 379, 384, 548, 705, 708, 726, 753, 762, 826, 894
Mus musculus 2568 187, 379, 548, 705
Ochotona princeps 13842 60, 63, 187, 199, 379, 548, 705, 717, 753, 828
Otolemur garnettii 7013 187, 379, 548, 705, 711, 733, 741, 766, 768, 826
Pan troglodytes 32951 187, 379, 548, 705, 826
Rattus norvegicus 364 187, 379, 548, 705
Spermophilus tridecemlineatus 2018 187, 213, 234, 379, 548, 705, 759, 777, 793, 798
Tarsius syrichta 13923 187, 379, 548, 705, 711, 732, 747, 765, 768, 826
Tupaia belangeri 1880 187, 379, 548, 705, 723, 729, 757, 765, 828

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 40035 ENSCJAT00000026110 100414973 ENSCJAG00000013438 IYD calJac3
Cavia porcellus 19609 ENSCPOT00000023881 100716898 ENSCPOG00000022358 cavPor3
Cavia porcellus 20575 ENSCPOT00000014372 ENSCPOG00000014230 cavPor3
Dipodomys ordii 15634 ENSDORT00000016200 ENSDORG00000016201 Iyd dipOrd1
Gorilla gorilla 12887 ENSGGOT00000000613 101134826 ENSGGOG00000000608 IYD gorGor3
Homo sapiens 76454 ENST00000425615 389434 ENSG00000009765 IYD hg19,GRCh37
Microcebus murinus 4919 ENSMICT00000004585 ENSMICG00000004582 IYD micMur1
Mus musculus 2568 ENSMUST00000019896 70337 ENSMUSG00000019762 Iyd mm9
Ochotona princeps 13842 ENSOPRT00000010409 ENSOPRG00000010409 IYD OchPri2.0
Otolemur garnettii 7013 ENSOGAT00000006764 100957357 ENSOGAG00000006759 IYD otoGar1
Pan troglodytes 32951 ENSPTRT00000064491 ENSPTRG00000018708 IYD panTro2
Rattus norvegicus 364 ENSRNOT00000021895 308129 ENSRNOG00000016286 Iyd rn4
Spermophilus tridecemlineatus 2018 ENSSTOT00000002018 101974736 ENSSTOG00000002022 Iyd speTri1
Tarsius syrichta 13923 ENSTSYT00000012150 ENSTSYG00000012151 IYD tarSyr1
Tupaia belangeri 1880 ENSTBET00000001881 ENSTBEG00000001886 IYD tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 31563 ENSCJAP00000024689 100414973 ENSCJAG00000013438 IYD calJac3
Cavia porcellus 15421 ENSCPOP00000019011 100716898 ENSCPOG00000022358 cavPor3
Cavia porcellus 16206 ENSCPOP00000012820 ENSCPOG00000014230 cavPor3
Dipodomys ordii 14696 ENSDORP00000015240 ENSDORG00000016201 Iyd dipOrd1
Gorilla gorilla 10596 ENSGGOP00000000599 101134826 ENSGGOG00000000608 IYD gorGor3
Homo sapiens 80153 ENSP00000390081 389434 ENSG00000009765 IYD hg19,GRCh37
Microcebus murinus 4177 ENSMICP00000004181 ENSMICG00000004582 IYD micMur1
Mus musculus 46497 ENSMUSP00000019896 70337 ENSMUSG00000019762 Iyd mm9
Ochotona princeps 12070 ENSOPRP00000009510 ENSOPRG00000010409 IYD OchPri2.0
Otolemur garnettii 6049 ENSOGAP00000006050 100957357 ENSOGAG00000006759 IYD otoGar1
Pan troglodytes 30260 ENSPTRP00000056048 ENSPTRG00000018708 IYD panTro2
Rattus norvegicus 25115 ENSRNOP00000021893 308129 ENSRNOG00000016286 Iyd rn4
Spermophilus tridecemlineatus 1802 ENSSTOP00000001798 101974736 ENSSTOG00000002022 Iyd speTri1
Tarsius syrichta 12764 ENSTSYP00000011149 ENSTSYG00000012151 IYD tarSyr1
Tupaia belangeri 1637 ENSTBEP00000001632 ENSTBEG00000001886 IYD tupBel1

multiple sequence alignment in CLUSTALW format


Tarsius_syrichta|13923             ATGCTTTTCCTGACTCCGGTCTTGGTAGCGGTTCTCTGCGTTGTGATTGTGTGGATCTTT
Otolemur_garnettii|7013            ATGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|13842            ATGCCTTCCCTGGGTGCCCTCCTGTTCGTCCTTGTCTGCATTTTGCTCACATGGATCTTT
Spermophilus_tridecemlineatus|2018 ATGCTTTCTCTGACTGCAGTCTTGGCGACAGTTGTCTGCGTTTTGATTGTGTGGATCTTT
Dipodomys_ordii|15634              ATGTCTTTCCTGACTCCGGTCTTGGTGGCCGTTGTGTGCATTTTGATTGTGTGGATCTAT
Microcebus_murinus|4919            ATGTTTTTCCTGACTCCAGTCTTGGTAGCGGTTCTCTGCATTTTGGTTGTGTGGATCTTT
Tupaia_belangeri|1880              ATGTTTTTTCTGACTCCAGTCTTGGTAGCAATTGTCTGCATTTTGGTTGTGTGGATCTTT
Mus_musculus|2568                  ATGTTTCTCCTCACCCCAGTCTTGGTAGCAGTTGTCTGTATCTTGGTTGTATGGGTCTTT
Rattus_norvegicus|364              ATGTTTCTCCTCACTCCAGTCTTGGTAGCAGTTGTCTGTATCTTGGTCATATGGGTCTTT
Callithrix_jacchus|40035           ATGTTTTTCTTGACTCCCGTCTTGGTAGCCATTCTCTGCATTTTGGTTGTGTGGATCTTT
Gorilla_gorilla|12887              ATGTATTTCCTGACTCCCATCTTGGTAGCCATTCTCTGCATTTTGGTTGTGTGGATCTTT
Pan_troglodytes|32951              ATGTATTTCCTGACTCCCATCTTGGTAGCCATTCTCTGCATTTTGGTTGTGTGGATCTTT
Homo_sapiens|76454                 ATGTATTTCCTGACTCCCATCTTGGTAGCCATTCTCTGCATTTTGGTTGTGTGGATCTTT
Cavia_porcellus|19609              ATGTTTTCCCTGACTCCAGTCCTGGTAGCAATTGTCTGCATTTTGATCGTGTGGCTCTTT
Cavia_porcellus|20575              ------------------------------------------------------------
                                                                                               

Tarsius_syrichta|13923             AAAAATGCTGATAGAAGCACAGAGAGAAAGAAGGAGGAGCCTCGAGTCAGGGCTGAGGTT
Otolemur_garnettii|7013            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|13842            ATA------------------------AAGAGCGAGGCGCCTCAGGTCAGAGCTGAGGCT
Spermophilus_tridecemlineatus|2018 AAACCTGCTGACAGAAGCCTCCAGAAGAAGGAGAGGGAGCCT------------GAAGCC
Dipodomys_ordii|15634              AAAAGTGCTGACAGACGTCTGCAGAGAAAGAAGGAGGGGACC------------CCAACT
Microcebus_murinus|4919            AAAAATGCTGACAGAAACATCCAGAGGAAGACGGGGGAGCCTGGAGCCAGGACCGAGTCT
Tupaia_belangeri|1880              AAAAATGCAGATAGAAGCACTGAGGAAAAAAGGGGGGAGGCTGGAGCCAGGGTTGAGGCT
Mus_musculus|2568                  AAAAATGCCGACAGGAACCTAGAGAAAAAGAAGGAGGAGGCT------------CAAGTT
Rattus_norvegicus|364              AAAAATGCTGACAGGAGTCTGGAGGAAAAGAAGGAGGAGGCT------------CGAGCT
Callithrix_jacchus|40035           AAAAATGCTAATAGAAGCATGGAGAAAAAGAAGGGGGAGGCTACAACCAGGGCCGAGGCT
Gorilla_gorilla|12887              AAAAATGCTGACAGAAGCATGGAGAAAAAGAAGGGGGAGCCTAGAACCAGGGCCGAAGCT
Pan_troglodytes|32951              AAAAATGCCGACAGAAGCATGGAGAAAAAGAAGGGGGAGCCTAGAACCAGGGCCGAAGCT
Homo_sapiens|76454                 AAAAATGCCGACAGAAGCATGGAGAAAAAGAAGGGGGAGCCTAGAACCAGGGCCGAAGCT
Cavia_porcellus|19609              AAAGCTGCTGATAGAAGCCCAGAGAAAAAGAAAGAGGAACCC------------CAAATT
Cavia_porcellus|20575              ------------------------------------------------------------
                                                                                               

Tarsius_syrichta|13923             CACCCCTGGGTGGATGAAGACTTAAAAGACAGCACTGAC---CTTCACCAA------GCA
Otolemur_garnettii|7013            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNN------NNN
Ochotona_princeps|13842            CGTCCCTGGGTGGATGGAGACCTGAAGGACAACACTGAG---CTCCCGCAG------GTG
Spermophilus_tridecemlineatus|2018 CGGCCCTGGGTGGATGAAGACTTAAAAGACAGCACTGATCATCTCCACCAG------GTG
Dipodomys_ordii|15634              CCCCCGTGGGTGGATGAAGACTTGAAAGACACCACTGAC---CCCCAGCAG------GCC
Microcebus_murinus|4919            CGACCCTGGGTGGATGAAGACTTAAGGGACAGCACTGAG---CTCCACCAG------GCA
Tupaia_belangeri|1880              CGCCCTTGGGTGGATGAAGACTTAAAAGACAGTACTGAT---CTCCAGCAAGAAGAAGAA
Mus_musculus|2568                  CAGCCCTGGGTGGATGAAGACTTGAAAGACAGCACAGAA---GACCTTCAA------GTG
Rattus_norvegicus|364              CAGCCCTGGGTGGATGAAGACTTGAAAGACAACACGGAA---CACCTTCAA------GTG
Callithrix_jacchus|40035           CGCCCCTGGGTGGATGAAGACTTAAAAGACAGCACTGAC---CTGCACCAA------GCA
Gorilla_gorilla|12887              CGCCCCTGGGTGGATGAAGACTTAAAAGACAGCAGTGAC---CTGCACCAA------GCA
Pan_troglodytes|32951              CGCCCCTGGGTGGATGAAGACTTAAAAGACAGCAGTGAC---CTGCACCAA------GCA
Homo_sapiens|76454                 CGCCCCTGGGTGGATGAAGACTTAAAAGACAGCAGTGAC---CTGCACCAA------GCA
Cavia_porcellus|19609              CAGCCCTGGATGAACGAAGACTTGAAAGCCAGTCCTGAT---ATCCACCAA------ATG
Cavia_porcellus|20575              ------------------------------------------------------------
                                                                                               

Tarsius_syrichta|13923             GAAGAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|7013            NNNNNNNATGCTGATGAGTGGCAGGAATCAGAGGAAAACGTCGAACACATTCCATTCTCC
Ochotona_princeps|13842            GAAGAAGATGCTGGTGACTGGGCAGGTTCAGAGGGGAATGTGGACCACATCCCATTCTCT
Spermophilus_tridecemlineatus|2018 CAAGAAGATGAAGATGAATGGCCAGAATCAGAGGAT---GTTGAACACATCCCA---TCC
Dipodomys_ordii|15634              GAGGAAGATGCTGATGAGTGGCCAGAGGTGGAGGAAAGTGTTGAGCTCATCCCGTACTAT
Microcebus_murinus|4919            GCGGAAGATGCTGATGAGTGGCAAGAATCAGAGGAGAATGTTGAACACATTCCATTCTCC
Tupaia_belangeri|1880              GAAGAAGATGTAGATGAATGGCAAGAGTCAGAAGAAAGTGTTGAACACATTCCATTTGTC
Mus_musculus|2568                  GAAGAAGATGCTGAGGAGTGGCAAGAGGCAGAGGAGAGTGTGGAGCACATCCCGTTCTCT
Rattus_norvegicus|364              GAAGAAGATACTGAGGAATGGCAAGAGTCGGAGGAGAGTGTGGAACACATCCTATTCTCC
Callithrix_jacchus|40035           GAAGAAGATGTTGATGAATGGCAAGAATCAGAAGAAAATGTTGAACACATCCTGTTCTCT
Gorilla_gorilla|12887              GAAGAAGATGCTGATGAATGGCAAGAATCAGAAGAAAATGTTGAACACATCCCCTTCTCT
Pan_troglodytes|32951              GAAGAAGATGCTGATGAATGGCAAGAATCAGAAGAAAAAGTTGAACACATCCCCTTCTCT
Homo_sapiens|76454                 GAAGAAGAA------------------------------------CACATCCCCTTCTCT
Cavia_porcellus|19609              GAAGAAGATGCTGATGAGTGGCAGGAGTCAGAGGAACACATTGAACACATCCCATTCTCC
Cavia_porcellus|20575              ------GATGCTGATGAGTGGCAGGAGTCAGAGGAACACGTTGAACACATCCCATTCTCC
                                         .                                          .          

Tarsius_syrichta|13923             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|7013            CATAGCCGCTATCCCGAGAAGGAAATGGTTAAGAGATCCCAGGAATTTTATGAACTTCTC
Ochotona_princeps|13842            CACACCCGGTATTCCGAGAAGGAAATGATTAAGAGGTCCCAGGAATTTTATGAACTTCTG
Spermophilus_tridecemlineatus|2018 CATACCCGGTATCCTGAGAAAGAAATGGCTAAGAGGTCACAGGAATTTTATGAGCTTCTC
Dipodomys_ordii|15634              CACACTCGCTATCCAGAGGAGGAAATGGCCACGAGGTCCCGGGAGTTTTATGAACTCCTC
Microcebus_murinus|4919            CACGCCCGCTATCCTGAGAAAGAAATGACTAAGAGATCCCAGGAATTTTATGAACTTCTC
Tupaia_belangeri|1880              CACATCCGGTATCCTGAAAAGGAAATGGTTAAGAGATCTCAGGAATTTTTTGAACTCCTC
Mus_musculus|2568                  CACACCCGATACCCAGAACAGGAAATGAGGATGAGGTCCCAGGAATTCTATGAGCTCCTC
Rattus_norvegicus|364              CACACCCGATACCCAGAGCAGGAAATGAGGATGAGATCCCAGGAATTCTATGAGCTCCTC
Callithrix_jacchus|40035           CACACCCGCTATTCTGAGAAGGAAATGGCTAAGAGATCTCAGGAATTTTATGAACTTCTC
Gorilla_gorilla|12887              CATACCCACTATCCTGAGAAGGAAATGGTTAAGAGGTCTCAGGAATTTTATGAACTTCTC
Pan_troglodytes|32951              CATACCCACTATCCCGAGAAGGAAATGGTTAAGAGGTCTCAGGAATTTTATGAACTTCTC
Homo_sapiens|76454                 CATAACCACTATCCTGAGAAGGAAATGGTTAAGAGGTCTCAGGAATTTTATGAACTTCTC
Cavia_porcellus|19609              CACACCCGGTACCCTGAGGAGGAAATGGTTAAGAGAGCTCAGGAATTTTATGAACTTCTC
Cavia_porcellus|20575              CACACCCGGTACCCTGAGGAGGAAATGGTTAAGAGAGCTCAGGAATTTTATGAACTTCTC
                                            .     .     .   ..     . .      ..  .. . ..   .  . 

Tarsius_syrichta|13923             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|7013            AATAAGAGACGGTCAGTCCGGTTCATAAGTAATGAGCAAATCCCGACGGAGGTCATTGAC
Ochotona_princeps|13842            AATAAGAGACGTTCGATCAGGTTCATAAGTAATGAACAGGTCCCCCAGGAAGTAATTGAC
Spermophilus_tridecemlineatus|2018 AATAAGAGACGGTCGGTCAGGTTCATAAGTAATGAGCAAGTCCCAATGGAAGTCATTAAT
Dipodomys_ordii|15634              CGCCAGCGACGGTCCGTGCGGTCCATCAGCGAGGAGCAAGTGCCCATGGAAGTCATTGAA
Microcebus_murinus|4919            AGTAAGAGACGGTCAGTCCGGTTCATCAGTAACGAGCAGATCCCAATGGAAGTCATTGAT
Tupaia_belangeri|1880              AATAAGAGACGGTCAGTAAGGTTTATAAGTAATGAGCAAGTCCCAATGGAAGTCATCGAC
Mus_musculus|2568                  AATAAGAGACGCTCCGTCAGGTTTATCAGCAGCGAGCACGTCCCAATGGAAGTCATTGAA
Rattus_norvegicus|364              AGTAAGAGACGCTCCATCAGATTTATCAGCAGCGAGCCAGTCCCGATGGAAGTGATTGAC
Callithrix_jacchus|40035           AATAACAGACGGTCAGTCAGGTTCATAAGTAATGAGCAAGTCCCAATGGAAGTCATTGAT
Gorilla_gorilla|12887              AATAAGAGACGGTCAGTCAGGTTCATAAGTAATGAGCAAGTCCCAATGGAAGTCATTGAT
Pan_troglodytes|32951              AATAAGAGACGGTCAGTCAGGTTCATAAGAAATGAGCAAGTCCCAATGGAAGTCATTGAT
Homo_sapiens|76454                 AATAAGAGACGGTCAGTCAGGTTCATAAGTAATGAGCAAGTCCCAATGGAAGTCATTGAT
Cavia_porcellus|19609              AATAAGAGACGCTCAGTCCGGTTCATAAGCAATGAGCAAGTTCCAATGGAGGTCATTGAC
Cavia_porcellus|20575              AATAAGAGACGCTCAGTCCGGTTCATAAGCAATGAGCAAGTTCCAATGGAGGTCATTGAC
                                          .  . .   .  . .   .  .    .      .      ..  ..  .    

Tarsius_syrichta|13923             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|7013            AACGTCATCAGAGCCGCAGGGACAGCCCCCAGTGGGGCACACACAGAGCCCTGGACCTTC
Ochotona_princeps|13842            AATGTCATCAAAGCCGCAGGAACTGCCCCAAGTGGGGCCCATACGGAGCCCTGGACCTTC
Spermophilus_tridecemlineatus|2018 AATGTCATCAAAGCAGCAGGAACAGCCCCAAGCGGGGCCCACACAGAACCCTGGACCTTT
Dipodomys_ordii|15634              AACGTCATCAAAGCGGCAGGAACAGCACCGAGCGGGGCCCACACGGAGCCCTGGACCTTT
Microcebus_murinus|4919            AATGTCATCAAGGCAGCAGGAACAGCCCCAAGAGGGGCCCACACAGAGCCTTGGACCTTC
Tupaia_belangeri|1880              AATGTCATCAAGACAGCAGGAACAGCCCCAAGTGGGGCCCACACAGAGCCCTGGACCTTT
Mus_musculus|2568                  AATGTCATCAAAGCAGCAGGAACAGCTCCAAGTGGGGCCCATACAGAGCCCTGGACCTTT
Rattus_norvegicus|364              AATGTCATCAAAGCAGCAGGAACAGCTCCAAGTGGAGCCCATACAGAGCCCTGGACGTTT
Callithrix_jacchus|40035           AATGTCATCAGAACGGCAGGAACAGCCCCGAGTGGGGCCCACACAGAGCCCTGGACCTTT
Gorilla_gorilla|12887              AATGTCATCAGAACGGCAGGAACAGCCCCGAGTGGGGCTCACACAGAGCCCTGGACCTTC
Pan_troglodytes|32951              AATGTCATCAGAACGGCAGGAACAGCCCCGAGTGGGGCTCACACAGAGCCCTGGACCTTC
Homo_sapiens|76454                 AATGTCATCAGAACGGCAGGAACAGCCCCGAGTGGGGCTCACACAGAGCCCTGGACCTTC
Cavia_porcellus|19609              AGTGTCATCAAAACAGCAGGAACAGCCCCAAGTGGGGCCCACACAGAGCCCTGGACCTTT
Cavia_porcellus|20575              AGTGTCATCAAAACAGCAGGAACAGCCCCAAGTGGGGCCCACACAGAGCCCTGGACCTTT
                                      ..  .       .  ..    .      . .. .        .     ...   .. 

Tarsius_syrichta|13923             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|7013            GTGGTTGTGAAGGACCCAGACATGAAACACGAGATTCGCCAGATCATCGAGGAGGAAGAG
Ochotona_princeps|13842            GTGGTTGTGAAGGACCCAGACGTGAAGCACAAGATCCGGGAGATCATAGAAGAGGAGGAG
Spermophilus_tridecemlineatus|2018 GTGGTGGTGAAGGACCCAGACACGAAGCATAAGATCCGGGAGATCATCGAAAAGGAAGAG
Dipodomys_ordii|15634              GTGGTTGTGAAGGACCCGGTTGTGAAGCATAAAATCCGGGAGATTATTGAGGAGGAAGAG
Microcebus_murinus|4919            GTGGTTGTGAAGGACCCAGACATGAAACATGAGATTCGCAAGATCATAGAGGAGGAAGAA
Tupaia_belangeri|1880              GTAGTTGTGAAGGACCCAGATATGAAACACAAGATTCGGGAAATCATTGAGGAGGAAGAG
Mus_musculus|2568                  GTGGTGGTGAAGGACCCAGACATGAAGCATAAGATCAGAGAGATTATCGAAGAGGAGGAA
Rattus_norvegicus|364              GTGGTGGTAAAGGACCCAGACATGAAGCATAAGATCCGAGAGATTATCGAGGAGGAGGAA
Callithrix_jacchus|40035           GTGGTTGTGAAGGACCCGGACATGAAGCACAAGATTCGAAAGATCATCGAGGAGGAAGAG
Gorilla_gorilla|12887              GTGGTTGTGAAGGACCCAGACGTGAAGCACAAGATTCGAAAGATCATTGAGGAGGAAGAG
Pan_troglodytes|32951              GTGGTTGTGAAGGACCCAGACGTGAAGCACAAGATTCGAAAGATCATTGAGGAGGAAGAG
Homo_sapiens|76454                 GTGGTTGTGAAGGACCCAGACGTGAAGCACAAGATTCGAAAGATCATTGAGGAGGAAGAG
Cavia_porcellus|19609              GTGGTGGTGAAGGACCCAGCTGTGAAGCACCAAATCCGACAGATCGTGGAAGAGGAAGAG
Cavia_porcellus|20575              GTGGTGGTGAAGGACCCAGCTGTGAAGCACCAAATCCGGCAGATCGTGGAAGAGGAAGAG
                                   .. .. ..   ..     .    .          .  .     .  . .    ..  .  

Tarsius_syrichta|13923             NNNNNNNNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|7013            GAGATAAACTACATGAAAAGAATG------GGGCACCGATGGGTTTCGGACCTGAAGAAA
Ochotona_princeps|13842            GAGATCAACTACAGGAAAAGGATG------GGGGCCCGGTGGGTGGCAGACCTGAGGAAG
Spermophilus_tridecemlineatus|2018 GAAATAAACTACATGAAGAGGATG------GGACAACGATGGGTCACGGACTTGAAGAAA
Dipodomys_ordii|15634              GAAATTAACTACATGAAAAGAATG------GGACGCCGATGGGTCACAGACTTGAAGAAA
Microcebus_murinus|4919            GAAATAAACTATATGAAGAGAATG------GGGCACCGATGGGTTACAGACCTGAAGAAA
Tupaia_belangeri|1880              GAAATAAACTACCTGAAAAGAATG------GGACACAGATGGGTTGCCGACCTGAAGAAA
Mus_musculus|2568                  GAAATAAATTACATGAAAAGGATG------GGAAAGCGATGGGTCACAGACCTGAAGAAA
Rattus_norvegicus|364              GAAATCAATTACATGAAAAGGATG------GGAAAGCGATGGGTCACAGATCTGAAGAAA
Callithrix_jacchus|40035           GAGATCAACTACATGAAAAGAATG------GGGCATCGCTGGGTCTCAGACCTCAAGAAA
Gorilla_gorilla|12887              GAGATCAACTACATGAAAAGGATG------GGACATCGCTGGGTCACAGACCTCAAGAAA
Pan_troglodytes|32951              GAGATCAACTACATGAAAAGGATG------GGACATCGCTGGGTCACAGACCTCAAGAAA
Homo_sapiens|76454                 GAGATCAACTACATGAAAAGGATG------GGACATCGCTGGGTCACAGACCTCAAGAAA
Cavia_porcellus|19609              GAAATAAACTACATGAAAAGAATG------GGACCCCGCTGGGTTACAGATCTGAAGAAA
Cavia_porcellus|20575              GAAATAAACTACATGAAAAGAATGGGAACTGGGAGGAGGTGGGTGATACCAATCTCCCCC
                                   .   .    .    .    .  ..      ..     . .....        .       

Tarsius_syrichta|13923             NNN---NNAACCAACTGGATTAAAGAGTACTTGGACACTGCCCCTGTCTTGATTCTCATT
Otolemur_garnettii|7013            CTG---AGAACCAACTGGATTAAAGAGTACTTGGACACCGCCCCTGTTTTGATTCTCATT
Ochotona_princeps|13842            ATG---AGAACCAACTGGGTCAAAGACTACCTGGACACTGCTCCCATTTTGATCCTCATT
Spermophilus_tridecemlineatus|2018 CTG---AGAACCAACTGGGTGAAAGAATACCTGGACACCGCCCCTGTTTTGATTCTCATT
Dipodomys_ordii|15634              CTG---AGAACGAATTGGATTAAAGAATATTTGGACACTGCCCCTGTTTTGATTCTCATT
Microcebus_murinus|4919            CTG---AGAACCAACTGGATTAAAGAATACTTGGACACCGCCCCTGTTTTGATTCTCATT
Tupaia_belangeri|1880              CTA---AGAACCAATTGGATTAAGGAGTACTTGGACACTGCCCCTGTTCTGATTCTCATT
Mus_musculus|2568                  CTG---AGAACCAACTGGATTAAGGAGTACTTGGACACCGCCCCAGTTCTGATCCTCATT
Rattus_norvegicus|364              CTG---AGAACCAACTGGATTAAGGAGTACTTGGACACTGCCCCTGTTCTGATCCTCATT
Callithrix_jacchus|40035           CTT---AGAACCAATTGGATTAAAGACTACTTGGATACTGCCCCTGTTTTGATTCTCATT
Gorilla_gorilla|12887              CTG---AGAACCAATTGGATTAAAGAGTACTTGGATACTGCCCCTATTTTGATTCTCATT
Pan_troglodytes|32951              CTG---AGAACCAACTGGATTAAAGAGTACTTGGATACTGCCCCTATTTTGATTCTCATT
Homo_sapiens|76454                 CTG---AGAACCAACTGGATTAAAGAGTACTTGGATACTGCCCCTATTTTGATTCTCATT
Cavia_porcellus|19609              CTG---AGAACCAATTGGATTAAAGAGTACTTGGACACTGCCCCCATTTTGATTCTCATT
Cavia_porcellus|20575              CTGCCCAGAACCAATTGGATTAAAGAGTACTCGGACACTGCCCCCATTTTGATTCTCATT
                                    .     .*** ** ***.* **.** **   *** ** ** ** .*  **** ******

Tarsius_syrichta|13923             TTCAAACAAGTACATGGCTTTTCTGCAACTGGCAAGAAAAAGGTCCACTACTACAATGAG
Otolemur_garnettii|7013            TTCAAACAAATACATGGTATCGCTGCGAACGGCAAGAAGCGGGTCCATTACTACAATGAG
Ochotona_princeps|13842            TTCAAGCAGGTGCATGGCTTTACTGCAAGTGGCAAGAAAAAGGTCCACTACTACAATGAG
Spermophilus_tridecemlineatus|2018 TTCAAACAAGTACATGGGTTTACTGCAAGTGGCAAGAAAAAGGTCCACTACTACAATGAG
Dipodomys_ordii|15634              TTTAAACAAGTGCATGGTTTTGCTGAGAATGGCAGGAGAAAGGTGCACTACTACAATGAG
Microcebus_murinus|4919            TTCAAACAAGTACATGGTTTTGCTGCAAATGGCAAGAAAAAGGTCCATTACTACAATGAG
Tupaia_belangeri|1880              TTTAAACAAGTACATGGTTTTGCTGCAAATGGCAAGAAAAAGGTGCATTACTACAACGAG
Mus_musculus|2568                  TTCAAACAAGTCCATGGTTTTGCTGCGAATGGAAAGAAGAAGGTCCACTACTACAACGAG
Rattus_norvegicus|364              TTCAAACAAGTCCATGGTTTTGCGGTAAATGGGAAGAAAAAGGTCCACTACTACAACGAG
Callithrix_jacchus|40035           TTCAAACAAGTACATGGTTTTGCTGCAAATGGCAAGAAAAAAGTCCACTACTACAATGAG
Gorilla_gorilla|12887              TTCAAACAAGTACATGGTTTTGCCGCAAATGGCAAGAAAAAAGTCCACTACTACAATGAG
Pan_troglodytes|32951              TTCAAACAAGTACATGGTTTTGCCACAAATGGCAAGAAAAAAGTCCACTACTACAATGAG
Homo_sapiens|76454                 TTCAAACAAGTACATGGTTTCGCCGCAAATGGCAAGAAAAAAGTCCACTACTACAATGAG
Cavia_porcellus|19609              TTCAAGCAAGTGCATGGCTTTGCTGCGAATGGCAAGAAAAAGATCCACTACTACAATGAG
Cavia_porcellus|20575              TTCAAGCAAGTGCATGGCTTTGCTGCGAATGGCAAGAAAAAGATCCACTACTACAATGAG
                                   ** **.**..* ***** :*  * . .*  ** *.**......* ** ******** ***

Tarsius_syrichta|13923             ATCAGTGTTTCCATCGCTTGTGGCATTCTGCTGGCTGCCTTGCAGGTAAACGGAATTGCT
Otolemur_garnettii|7013            ATCAGCGTCTCCATCGCCTGTGGCATCCTCCTAGCTGCCCTGCAG---ACAGGAATCACT
Ochotona_princeps|13842            ATCAGCGTGTCCATCGCCTGTGGCATCCTGCTGGCAGCCCTGCAGGATGAGTGGGTCAGG
Spermophilus_tridecemlineatus|2018 ATCAGTGTCTCCATCGCATGCGGCATCCTGCTGGCTGCGCTGCAGATTAATAAGAGAGTC
Dipodomys_ordii|15634              ATCAGCGTTTCCATCGCCTGCGGCATCCTGCTGTCCGCACTGCAG---------------
Microcebus_murinus|4919            ATCAGTGTTTCCATCGCTTGTGGCATCCTGTTGGCCGCCCTGCAGATA------GGAATC
Tupaia_belangeri|1880              ATCAGCGTCTCCATCGCTTGCGGCATCCTACTGGCTGCCCTGCAGATAAATACAGAAATT
Mus_musculus|2568                  ATCAGTGTGTCCATCGCCTGTGGCCTCCTGCTGGCTGCACTGCAGAATGCAGGGCTAGTG
Rattus_norvegicus|364              ATCAGTGTGTCCATTGCCTGTGGCATTCTGCTGGCTGCACTGCAGAATGCAGGGCTGGTG
Callithrix_jacchus|40035           ATCAGTGTTTCCATCGCTTGTGGCATCCTGCTAGCTGCCCTACAGGTTATTGGAAAAATT
Gorilla_gorilla|12887              ATCAGTGTTTCCATCGCTTGTGGCATCCTGCTAGCTGCCCTACAGGTAAATAATGGAATC
Pan_troglodytes|32951              ATCAGTGTTTCCATCGCTTGTGGCATCCTGCTAGCTGCCCTGCAGGTAAATAATGGAATC
Homo_sapiens|76454                 ATCAGTGTTTCCATCGCTTGTGGCATCCTGCTAGCTGCCCTGCAGAATGCAGGTCTGGTG
Cavia_porcellus|19609              ATCAGCGTCTCCATCGCTTGTGGCATCCTGCTCGCCGCGCTGCAGAATGCAGGGCTAGTG
Cavia_porcellus|20575              ATCAGCGTCTCCATCGCTTGTGGCATCCTGCTCACCACGCTGCAGAATGCAGGGCTAGTG
                                   ***** ** ***** ** ** ***.* **  *  * .*  *.***               

Tarsius_syrichta|13923             GTGCAGCGTCAGCATCCCCACACATTTGATGCTGGAAGAAGAAGCACC------------
Otolemur_garnettii|7013            GAGCAGCGTCAGACTTCCAGACGGTGTTGGGGTCCTGGAAGAAGCATT------------
Ochotona_princeps|13842            GACCTGTGTCAGGCAAGGAGCACTGAGGACTTCCAGCACTTCACTCAG------------
Spermophilus_tridecemlineatus|2018 TCTGTGCAGCATCAGACCACAGGGCACCACCCACTGCTTGGTGTTGGA------GGAGAG
Dipodomys_ordii|15634              ------------------------------------------------------------
Microcebus_murinus|4919            ACTGTGCATGAGACCTCA---------GGACACCGTCTATTCGGTCNN---------NNN
Tupaia_belangeri|1880              GCCTGGAGCCATCCATTTTACGGTCCTGGAGGAAGCCTTTCGGCCAGCAAGCTTGGTTCA
Mus_musculus|2568                  ACGGTCACTACCACTCCCCTCAACTGTGGTCCTCGTCTGAGGGTGCTC---CTGGGCCGC
Rattus_norvegicus|364              ACGGTCACTACCACTCCCCTCAACTGTGGTCCTCGTCTGAGGGTGCTC---CTGGGCCGC
Callithrix_jacchus|40035           ATCCTGAAGGAGCTGGCATTGATGTCCTTCCTGAATCTG---------------------
Gorilla_gorilla|12887              ACCATGCGGCATCAGACT---GCGGGGCACTGCCACCTGATTGAGGGT---CCTGGAAGA
Pan_troglodytes|32951              ACCATGCGGCATCAGACT---GCGGGGCACCGCCACCTGATTGAGGGT---CCTGGAAGA
Homo_sapiens|76454                 ACTGTCACTACCACTCCTCTCAACTGTGGCCCTCGACTGAGGGTGCTC---CTGGGCCGC
Cavia_porcellus|19609              ACCGTCACTACTACTCCCCTCAACTGTGGCCCTCGTCTGCGGGTGCTT---CTGGACCGT
Cavia_porcellus|20575              ACCGTCACTACTACTCCCCTCAACTGTGGCCCTCGTCTGTGGGTGCTT---CTGGACCGT
                                                                                               

Tarsius_syrichta|13923             ---------------------GAGCTCAGCTCACAAGGTGGCATCCAACGTGGGACTGGT
Otolemur_garnettii|7013            ------------GCCCGGAGAGAGCTCAGTCCNNNNNNNNNNNNNNAATGCAGGACTGGT
Ochotona_princeps|13842            ---------------------------------------------GATTGCAGGGCTAGT
Spermophilus_tridecemlineatus|2018 CTCAGTTCACCAAGTTGT------------------------------TGCAGGGCTGGT
Dipodomys_ordii|15634              ------------------------------------------------TGCAGGGCTGGT
Microcebus_murinus|4919            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATGCGGGACTGGT
Tupaia_belangeri|1880              CCA------------------------------------AGAGGCTCTTGCAGGCCTGGT
Mus_musculus|2568                  CCCTCACATGAGAAGCTGTTGGTGCTACTTCCTGTGGGGTACCCCAGCAGAGATGCCACA
Rattus_norvegicus|364              CCCTCACATGAGAAGCTGCTAGTGCTCCTTCCTGTGGGGTACCCTAGCAGAGGTGCCACA
Callithrix_jacchus|40035           ------------------------------------------------------------
Gorilla_gorilla|12887              AGCAGC---GAAGCCTGCAGCAAGCTCAGCTCACAAGGCCGCCCAGAATGCAGGTCTGGT
Pan_troglodytes|32951              AGCAGC---GAAGCCTGCAGCAAGCTCAGCTCACAAGGCCGCCCAGAATGCAGGTCTGGT
Homo_sapiens|76454                 CCCGCACATGAAAAGCTGCTGATGCTGCTCCCCGTGGGGTACCCCAGCAAGGAGGCCACG
Cavia_porcellus|19609              CCCCCACATGAAAAGCTGCTGGTGCTGCTCCCCGTGGGGTACCCCAGCAAAGGGGCCACA
Cavia_porcellus|20575              CCCCCACATGAAAAGCTGCTGGTGCTGCTCCCCATGGGGTACCCCAGCAAAGAGACCACA
                                                                                               

Tarsius_syrichta|13923             GACTGTCACTACCACTCCTCTCAACTGTGGCCCACGTCTGAGGGTGTTCCTGGACCGGCC
Otolemur_garnettii|7013            GACTGTCACTACCACTCCTCTCAACTGTGGTCCTCGTCTGAGGTTACTCTTGGGCCGCCC
Ochotona_princeps|13842            GACAGTCACCACCACTCCACTCAACTGTGGCCCTCGGCTGAGAGTGCTCCTGAACCGGCC
Spermophilus_tridecemlineatus|2018 GACAGTCACTACTACTCCCCTCAACTGTGGCCCTCCTCTGAGGATGCTCCTGGGCCGCCC
Dipodomys_ordii|15634              GACGGTCACCACCACGCCCCTCAACTGCGGTCCTCGTCTCAGGGTGCTCCTGGACCGCCC
Microcebus_murinus|4919            GACTGTCACTACCACGCCTCTCAACTGTGGCCCTCGTCTGAGAGTGCTCCTGGGCCCTGC
Tupaia_belangeri|1880              GACTGTCACCACCACTCCTCTCAACTGTGGACCGCGTCTGAGGTTGCTCTTGGGTCGTCC
Mus_musculus|2568                  GTGCCTGACCTCAAGCGGAAAGCTCTGGACCAGATCATGGTGACAGTA------------
Rattus_norvegicus|364              GTGCCTGACCTCAAGCGGAAAACTCTGGACCAGATCATGGTGACAGTA------------
Callithrix_jacchus|40035           ------------------------------------------------------------
Gorilla_gorilla|12887              GACTGTCACTACCACTCCTCTCAACTGTGGCCCTCGACTGAGGGTGCTTCTGGGCCGCCC
Pan_troglodytes|32951              GACTGTCACTACCACTCCTCTCAACTGTGGCCCTCGACTGAGGGTGCTCCTGGGCCGCCC
Homo_sapiens|76454                 GTGCCTGACCTCAAGCGCAAACCTCTGGACCAGATCATGGTGACAGTG------------
Cavia_porcellus|19609              GTGCCTGACCTCAGACGGAAGACTCTGGATCAGATCATGGTGACGGTG------------
Cavia_porcellus|20575              GTGCCTGACCTCAGACGGAAGACTCTGGATCAGATCATGGTGACGGTG------------
                                                                                               

Tarsius_syrichta|13923             CTCACATGA
Otolemur_garnettii|7013            TGCACATGA
Ochotona_princeps|13842            CACCCATGA
Spermophilus_tridecemlineatus|2018 CCCACATGA
Dipodomys_ordii|15634              CACAAATGA
Microcebus_murinus|4919            ACA---TGA
Tupaia_belangeri|1880              TCCACATGA
Mus_musculus|2568                  ------TAG
Rattus_norvegicus|364              ------TAG
Callithrix_jacchus|40035           ------TAA
Gorilla_gorilla|12887              CGCACATGA
Pan_troglodytes|32951              CGCACATGA
Homo_sapiens|76454                 ------TAG
Cavia_porcellus|19609              ------TAG
Cavia_porcellus|20575              ------TAG
                                         *..

multiple sequence alignment in CLUSTALW format


Tarsius_syrichta|12764             MLFLTPVLVAVLCVVIVWIFKNADRSTERKKEEPRVRAEVHPWVDEDLKDSTD-LHQ--A
Otolemur_garnettii|6049            MXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXX--X
Ochotona_princeps|12070            MPSLGALLFVLVCILLTWIFI--------KSEAPQVRAEARPWVDGDLKDNTE-LPQ--V
Spermophilus_tridecemlineatus|1802 MLSLTAVLATVVCVLIVWIFKPADRSLQKKEREP----EARPWVDEDLKDSTDHLHQ--V
Dipodomys_ordii|14696              MSFLTPVLVAVVCILIVWIYKSADRRLQRKKEGT----PTPPWVDEDLKDTTD-PQQ--A
Microcebus_murinus|4177            MFFLTPVLVAVLCILVVWIFKNADRNIQRKTGEPGARTESRPWVDEDLRDSTE-LHQ--A
Tupaia_belangeri|1637              MFFLTPVLVAIVCILVVWIFKNADRSTEEKRGEAGARVEARPWVDEDLKDSTD-LQQEEE
Mus_musculus|46497                 MFLLTPVLVAVVCILVVWVFKNADRNLEKKKEEA----QVQPWVDEDLKDSTE-DLQ--V
Rattus_norvegicus|25115            MFLLTPVLVAVVCILVIWVFKNADRSLEEKKEEA----RAQPWVDEDLKDNTE-HLQ--V
Callithrix_jacchus|31563           MFFLTPVLVAILCILVVWIFKNANRSMEKKKGEATTRAEARPWVDEDLKDSTD-LHQ--A
Gorilla_gorilla|10596              MYFLTPILVAILCILVVWIFKNADRSMEKKKGEPRTRAEARPWVDEDLKDSSD-LHQ--A
Pan_troglodytes|30260              MYFLTPILVAILCILVVWIFKNADRSMEKKKGEPRTRAEARPWVDEDLKDSSD-LHQ--A
Homo_sapiens|80153                 MYFLTPILVAILCILVVWIFKNADRSMEKKKGEPRTRAEARPWVDEDLKDSSD-LHQ--A
Cavia_porcellus|15421              MFSLTPVLVAIVCILIVWLFKAADRSPEKKKEEP----QIQPWMNEDLKASPD-IHQ--M
Cavia_porcellus|16206              ------------------------------------------------------------
                                                                                               

Tarsius_syrichta|12764             EEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Otolemur_garnettii|6049            XXXADEWQESEENVEHIPFSHSRYPEKEMVKRSQEFYELLNKRRSVRFISNEQIPTEVID
Ochotona_princeps|12070            EEDAGDWAGSEGNVDHIPFSHTRYSEKEMIKRSQEFYELLNKRRSIRFISNEQVPQEVID
Spermophilus_tridecemlineatus|1802 QEDEDEWPESED-VEHIP-SHTRYPEKEMAKRSQEFYELLNKRRSVRFISNEQVPMEVIN
Dipodomys_ordii|14696              EEDADEWPEVEESVELIPYYHTRYPEEEMATRSREFYELLRQRRSVRSISEEQVPMEVIE
Microcebus_murinus|4177            AEDADEWQESEENVEHIPFSHARYPEKEMTKRSQEFYELLSKRRSVRFISNEQIPMEVID
Tupaia_belangeri|1637              EEDVDEWQESEESVEHIPFVHIRYPEKEMVKRSQEFFELLNKRRSVRFISNEQVPMEVID
Mus_musculus|46497                 EEDAEEWQEAEESVEHIPFSHTRYPEQEMRMRSQEFYELLNKRRSVRFISSEHVPMEVIE
Rattus_norvegicus|25115            EEDTEEWQESEESVEHILFSHTRYPEQEMRMRSQEFYELLSKRRSIRFISSEPVPMEVID
Callithrix_jacchus|31563           EEDVDEWQESEENVEHILFSHTRYSEKEMAKRSQEFYELLNNRRSVRFISNEQVPMEVID
Gorilla_gorilla|10596              EEDADEWQESEENVEHIPFSHTHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVID
Pan_troglodytes|30260              EEDADEWQESEEKVEHIPFSHTHYPEKEMVKRSQEFYELLNKRRSVRFIRNEQVPMEVID
Homo_sapiens|80153                 EEE------------HIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVID
Cavia_porcellus|15421              EEDADEWQESEEHIEHIPFSHTRYPEEEMVKRAQEFYELLNKRRSVRFISNEQVPMEVID
Cavia_porcellus|16206              --DADEWQESEEHVEHIPFSHTRYPEEEMVKRAQEFYELLNKRRSVRFISNEQVPMEVID
                                                                                               

Tarsius_syrichta|12764             XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXX
Otolemur_garnettii|6049            NVIRAAGTAPSGAHTEPWTFVVVKDPDMKHEIRQIIEEEEEINYMKRM--GHRWVSDLKK
Ochotona_princeps|12070            NVIKAAGTAPSGAHTEPWTFVVVKDPDVKHKIREIIEEEEEINYRKRM--GARWVADLRK
Spermophilus_tridecemlineatus|1802 NVIKAAGTAPSGAHTEPWTFVVVKDPDTKHKIREIIEKEEEINYMKRM--GQRWVTDLKK
Dipodomys_ordii|14696              NVIKAAGTAPSGAHTEPWTFVVVKDPVVKHKIREIIEEEEEINYMKRM--GRRWVTDLKK
Microcebus_murinus|4177            NVIKAAGTAPRGAHTEPWTFVVVKDPDMKHEIRKIIEEEEEINYMKRM--GHRWVTDLKK
Tupaia_belangeri|1637              NVIKTAGTAPSGAHTEPWTFVVVKDPDMKHKIREIIEEEEEINYLKRM--GHRWVADLKK
Mus_musculus|46497                 NVIKAAGTAPSGAHTEPWTFVVVKDPDMKHKIREIIEEEEEINYMKRM--GKRWVTDLKK
Rattus_norvegicus|25115            NVIKAAGTAPSGAHTEPWTFVVVKDPDMKHKIREIIEEEEEINYMKRM--GKRWVTDLKK
Callithrix_jacchus|31563           NVIRTAGTAPSGAHTEPWTFVVVKDPDMKHKIRKIIEEEEEINYMKRM--GHRWVSDLKK
Gorilla_gorilla|10596              NVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRM--GHRWVTDLKK
Pan_troglodytes|30260              NVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRM--GHRWVTDLKK
Homo_sapiens|80153                 NVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRM--GHRWVTDLKK
Cavia_porcellus|15421              SVIKTAGTAPSGAHTEPWTFVVVKDPAVKHQIRQIVEEEEEINYMKRM--GPRWVTDLKK
Cavia_porcellus|16206              SVIKTAGTAPSGAHTEPWTFVVVKDPAVKHQIRQIVEEEEEINYMKRMGTGRRWVIPISP
                                                                                               

Tarsius_syrichta|12764             X-XTNWIKEYLDTAPVLILIFKQVHGFSATGKKKVHYYNEISVSIACGILLAALQVNGIA
Otolemur_garnettii|6049            L-RTNWIKEYLDTAPVLILIFKQIHGIAANGKKRVHYYNEISVSIACGILLAALQ-TGIT
Ochotona_princeps|12070            M-RTNWVKDYLDTAPILILIFKQVHGFTASGKKKVHYYNEISVSIACGILLAALQDEWVR
Spermophilus_tridecemlineatus|1802 L-RTNWVKEYLDTAPVLILIFKQVHGFTASGKKKVHYYNEISVSIACGILLAALQINKRV
Dipodomys_ordii|14696              L-RTNWIKEYLDTAPVLILIFKQVHGFAENGRRKVHYYNEISVSIACGILLSALQ-----
Microcebus_murinus|4177            L-RTNWIKEYLDTAPVLILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQI--GI
Tupaia_belangeri|1637              L-RTNWIKEYLDTAPVLILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQINTEI
Mus_musculus|46497                 L-RTNWIKEYLDTAPVLILIFKQVHGFAANGKKKVHYYNEISVSIACGLLLAALQNAGLV
Rattus_norvegicus|25115            L-RTNWIKEYLDTAPVLILIFKQVHGFAVNGKKKVHYYNEISVSIACGILLAALQNAGLV
Callithrix_jacchus|31563           L-RTNWIKDYLDTAPVLILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQVIGKI
Gorilla_gorilla|10596              L-RTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQVNNGI
Pan_troglodytes|30260              L-RTNWIKEYLDTAPILILIFKQVHGFATNGKKKVHYYNEISVSIACGILLAALQVNNGI
Homo_sapiens|80153                 L-RTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLV
Cavia_porcellus|15421              L-RTNWIKEYLDTAPILILIFKQVHGFAANGKKKIHYYNEISVSIACGILLAALQNAGLV
Cavia_porcellus|16206              LPRTNWIKEYSDTAPILILIFKQVHGFAANGKKKIHYYNEISVSIACGILLTTLQNAGLV
                                      ***:*:* ****:*******:**:: .*::::*************:**::**     

Tarsius_syrichta|12764             VQRQHPHTFDAGRRST-----------ELSSQGGIQRGTGDCHYHSSQLWPTSEGVPGPA
Otolemur_garnettii|6049            EQRQTSRRCWGPGRSI--------ARRELSPXXXXXCRTGDCHYHSSQLWSSSEVTLGPP
Ochotona_princeps|12070            DLCQARSTEDFQHFTQ-------------------DCRASDSHHHSTQLWPSAESAPEPA
Spermophilus_tridecemlineatus|1802 SVQHQTTGHHPLLGVG--GELSSPSC----------CRAGDSHYYSPQLWPSSEDAPGPP
Dipodomys_ordii|14696              ------------------------------------CRAGDGHHHAPQLRSSSQGAPGPP
Microcebus_murinus|4177            TVHETS---GHRLFGX---XXXXXXXXXXXXXXXXXCGTGDCHYHASQLWPSSESAPGPC
Tupaia_belangeri|1637              AWSHPFYGPGGSLSASKLGSP------------RGSCRPGDCHHHSSQLWTASEVALGSS
Mus_musculus|46497                 TVTTTPLNCGPRLRVL-LGRPSHEKLLVLLPVGYPSRDATVPDLKRKALDQIMVTV----
Rattus_norvegicus|25115            TVTTTPLNCGPRLRVL-LGRPSHEKLLVLLPVGYPSRGATVPDLKRKTLDQIMVTV----
Callithrix_jacchus|31563           ILKELALMSFLNL-----------------------------------------------
Gorilla_gorilla|10596              TMRHQT-AGHCHLIEG-PGRSS-EACSKLSSQGRPECRSGDCHYHSSQLWPSTEGASGPP
Pan_troglodytes|30260              TMRHQT-AGHRHLIEG-PGRSS-EACSKLSSQGRPECRSGDCHYHSSQLWPSTEGAPGPP
Homo_sapiens|80153                 TVTTTPLNCGPRLRVL-LGRPAHEKLLMLLPVGYPSKEATVPDLKRKPLDQIMVTV----
Cavia_porcellus|15421              TVTTTPLNCGPRLRVL-LDRPPHEKLLVLLPVGYPSKGATVPDLRRKTLDQIMVTV----
Cavia_porcellus|16206              TVTTTPLNCGPRLWVL-LDRPPHEKLLVLLPMGYPSKETTVPDLRRKTLDQIMVTV----
                                                                                               

Tarsius_syrichta|12764             LT
Otolemur_garnettii|6049            CT
Ochotona_princeps|12070            HP
Spermophilus_tridecemlineatus|1802 PT
Dipodomys_ordii|14696              HK
Microcebus_murinus|4177            T-
Tupaia_belangeri|1637              ST
Mus_musculus|46497                 --
Rattus_norvegicus|25115            --
Callithrix_jacchus|31563           --
Gorilla_gorilla|10596              RT
Pan_troglodytes|30260              RT
Homo_sapiens|80153                 --
Cavia_porcellus|15421              --
Cavia_porcellus|16206              --