Orthologs Set ID: EOG4003HS


Orthology Database
OrthoDB4
Gene Symbol(s)
ORAI2

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 27455
Cavia porcellus 12952 414
Dipodomys ordii 10617 414
Gorilla gorilla 10769 176, 414
Microcebus murinus 11068 414
Mus musculus 34202 414
Ochotona princeps 5007 266, 402, 414, 816, 837, 849, 885, 898
Oryctolagus cuniculus 25967 414
Pan troglodytes 34355 414
Rattus norvegicus 9254 176, 414
Spermophilus tridecemlineatus 938 222, 288, 305, 414, 788, 825, 907
Tupaia belangeri 10329 414

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 27455 ENSCJAT00000031475 100411479 ENSCJAG00000016180 ORAI2 calJac3
Cavia porcellus 12952 ENSCPOT00000001415 100714300 ENSCPOG00000001396 ORAI2 cavPor3
Dipodomys ordii 10617 ENSDORT00000005930 ENSDORG00000005930 Orai2 dipOrd1
Gorilla gorilla 10769 ENSGGOT00000016097 101126904 ENSGGOG00000016045 ORAI2 gorGor3
Microcebus murinus 11068 ENSMICT00000010306 ENSMICG00000010309 ORAI2 micMur1
Mus musculus 34202 ENSMUST00000041048 269717 ENSMUSG00000039747 Orai2 mm9
Ochotona princeps 5007 ENSOPRT00000011957 ENSOPRG00000011969 ORAI2 OchPri2.0
Oryctolagus cuniculus 25967 ENSOCUT00000028529 100359269 ENSOCUG00000023741 ORAI2 oryCun2.0
Pan troglodytes 34355 ENSPTRT00000046049 ENSPTRG00000019537 ORAI2 panTro2
Rattus norvegicus 9254 ENSRNOT00000001938 304592 ENSRNOG00000001427 Orai2 rn4
Spermophilus tridecemlineatus 938 ENSSTOT00000000938 101962488 ENSSTOG00000000942 Orai2 speTri1
Tupaia belangeri 10329 ENSTBET00000010330 ENSTBEG00000010349 ORAI2 tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 19527 ENSCJAP00000029786 100411479 ENSCJAG00000016180 ORAI2 calJac3
Cavia porcellus 10124 ENSCPOP00000001261 100714300 ENSCPOG00000001396 ORAI2 cavPor3
Dipodomys ordii 9975 ENSDORP00000005554 ENSDORG00000005930 Orai2 dipOrd1
Gorilla gorilla 9029 ENSGGOP00000015648 101126904 ENSGGOG00000016045 ORAI2 gorGor3
Microcebus murinus 9386 ENSMICP00000009385 ENSMICG00000010309 ORAI2 micMur1
Mus musculus 3162 ENSMUSP00000037137 269717 ENSMUSG00000039747 Orai2 mm9
Ochotona princeps 4341 ENSOPRP00000010911 ENSOPRG00000011969 ORAI2 OchPri2.0
Oryctolagus cuniculus 9201 ENSOCUP00000023871 100359269 ENSOCUG00000023741 ORAI2 oryCun2.0
Pan troglodytes 23521 ENSPTRP00000043567 ENSPTRG00000019537 ORAI2 panTro2
Rattus norvegicus 2066 ENSRNOP00000001938 304592 ENSRNOG00000001427 Orai2 rn4
Spermophilus tridecemlineatus 843 ENSSTOP00000000839 101962488 ENSSTOG00000000942 Orai2 speTri1
Tupaia belangeri 8951 ENSTBEP00000008933 ENSTBEG00000010349 ORAI2 tupBel1

multiple sequence alignment in CLUSTALW format


Ochotona_princeps|5007            ------------------------------------------------------------
Spermophilus_tridecemlineatus|938 ------------------------------------------------------------
Cavia_porcellus|12952             ------------------------------------------------------------
Dipodomys_ordii|10617             ------------------------------------------------------------
Mus_musculus|34202                ------------------------------------------------------------
Rattus_norvegicus|9254            ATGGGTCACGTGACGGCGGCGCAGCGTTGCCTAGGCAGCGGCTGCGGGCGGAAAGAGGGA
Gorilla_gorilla|10769             ------------------------------------------------------------
Pan_troglodytes|34355             ------------------------------------------------------------
Tupaia_belangeri|10329            ------------------------------------------------------------
Oryctolagus_cuniculus|25967       ------------------------------------------------------------
Microcebus_murinus|11068          ------------------------------------------------------------
Callithrix_jacchus|27455          ------------------------------------------------------------
                                                                                              

Ochotona_princeps|5007            ------------------------------------------------------------
Spermophilus_tridecemlineatus|938 ------------------------------------------------------------
Cavia_porcellus|12952             ------------------------------------------------------------
Dipodomys_ordii|10617             ------------------------------------------------------------
Mus_musculus|34202                ------------------------------------------------------------
Rattus_norvegicus|9254            GGGGGCCGGTCCTCCGCCCTGGCCCGGCTGCCGGGCCACCCGGCCCCGACACAGACGCTA
Gorilla_gorilla|10769             ------------------------------------------------------------
Pan_troglodytes|34355             ------------------------------------------------------------
Tupaia_belangeri|10329            ------------------------------------------------------------
Oryctolagus_cuniculus|25967       ------------------------------------------------------------
Microcebus_murinus|11068          ------------------------------------------------------------
Callithrix_jacchus|27455          ------------------------------------------------------------
                                                                                              

Ochotona_princeps|5007            ------------------------------------------------------------
Spermophilus_tridecemlineatus|938 ------------------------------------------------------------
Cavia_porcellus|12952             ------------------------------------------------------AGCCCA
Dipodomys_ordii|10617             ------------------------------------------------------------
Mus_musculus|34202                ------------------------------------------------------------
Rattus_norvegicus|9254            GCCACGAGCCGGAGCGGAGAACTGGAGCCAAGCGCGCTGAGGGCTAGCCAGCCAGGCCTG
Gorilla_gorilla|10769             ------------------------------------------------ATGACCTGCCTG
Pan_troglodytes|34355             ------------------------------------------------------------
Tupaia_belangeri|10329            ------------------------------------------------------------
Oryctolagus_cuniculus|25967       ------------------------------------------------------------
Microcebus_murinus|11068          ------------------------------------------------------------
Callithrix_jacchus|27455          ------------------------------------------------------------
                                                                                              

Ochotona_princeps|5007            ---------ATGAGCGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|938 ---------ATGAGTGCCGAGCTCAACGTCCCTGTGGACCCC------CCGGCCTGCCCT
Cavia_porcellus|12952             GCTCCCACCATGAGCGCCGAGCTCAGCGTGCCTGCAGACCCCTCCACT---GCTCGCCCA
Dipodomys_ordii|10617             ---------ATGAGTGCTGAGCTCAATGTGCCGGTGGACCCGTCCACCCCCGCGTGCACG
Mus_musculus|34202                ---------ATGAGTGCAGAGCTCAATGTGCCCATGGACCCCTCTGCCCCTGCCTGCCCT
Rattus_norvegicus|9254            GTCCCCACCATGAGTGCCGAGCTCAATGTGCCCATGGACCCCTCTGCCCCCGCCTGCCCT
Gorilla_gorilla|10769             GCTCCCACCATGAGTGCTGAGCTCAACGTGCCTATCGACCCCTCTGCTCCTGCCTGCCCT
Pan_troglodytes|34355             ---------ATGAGTGCTGAGCTCAACGTGCCTATTGACCCCTCTGCTCCTGCCTGCCCT
Tupaia_belangeri|10329            ---------ATGAGCGCTGAGCTCAGCGTGCCTGTGGACCCCTGCACTCCTGCCTGCCCT
Oryctolagus_cuniculus|25967       ---------ATGAGCGCTGAGCTCAACGTGCCTGTGGACCCGTCCACCCCCGCCTGCTCG
Microcebus_murinus|11068          ---------ATGAACGCTGAGCTCAATGTGCCTGTGGACCCCTCCACTCCCGCCTGCTCT
Callithrix_jacchus|27455          ------------------------------------------------------------
                                                                                              

Ochotona_princeps|5007            NNNNNNNNNNNNNNNNNNNNNNNNNNCCGGGACTGGGTCCGCCGCAGCTACCTTGAACTG
Spermophilus_tridecemlineatus|938 GAGCCCGGGCACAAGGGCATGGATTACCGCGACTGGGTCCGCCGCAGC---CTGGAACTG
Cavia_porcellus|12952             GAGCCTGGCCACAAGGGCATGGATTACCGGGACTGGGTCCGCCGTAGCTACCTGGAGCTG
Dipodomys_ordii|10617             GAGCCAGGCCACAAGGGCATGGACTACCGGGACTGGGTGCGCCGCAGCTACCTGGAGCTG
Mus_musculus|34202                GAACCCGGCCACAAGGGCATGGATTACCGAGACTGGGTCCGGCGCAGCTACCTGGAACTC
Rattus_norvegicus|9254            GAACCCGGCCACAAGGGCATGGATTACCGAGACTGGGTCCGACGCAGCTACCTGGAACTG
Gorilla_gorilla|10769             GAGCCCGGCCACAAGGGCATGGATTACCGGGACTGGGTCCGCCGCAGCTACCTGGAACTG
Pan_troglodytes|34355             GAGCCCGGCCACAAGGGCATGGATTACCGGGACTGGGTCCGCCGCAGCTACCTGGAACTG
Tupaia_belangeri|10329            GAGCCCGGCCACAAGGGTATGGATTACCGGGACTGGGTCCGCCGCAGCTACCTGGAACTG
Oryctolagus_cuniculus|25967       GAGCCCGGCCACAAGGGCATGGATTACCGGGACTGGGTCCGCCGCAGCTACCTGGAACTG
Microcebus_murinus|11068          GAGCCTGGCCACAAGGGCATGGATTACCGCGACTGGGTCCGCCGCAGCTACCTGGAACTG
Callithrix_jacchus|27455          ------------------------------------------------------------
                                                                                              

Ochotona_princeps|5007            GTCACT---CAACAACACTCAGTGCAGGCACTGTCCTGGAGGAAGCTGTACCTGAGCAGG
Spermophilus_tridecemlineatus|938 GTCACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|12952             GTCACCTCCAACCACCACTCAGTGCAGGCCCTGTCCTGGAGGAAGCTGTACCTGAGCAGG
Dipodomys_ordii|10617             GTCACCTCCAACCACCACTCAGTGCAGGCGCTGTCCTGGAGGAAGCTGTACCTGAGCAGG
Mus_musculus|34202                GTCACGTCTAACCACCATTCGGTGCAGGCACTGTCCTGGAGGAAGCTCTACCTGAGCAGG
Rattus_norvegicus|9254            GTCACATCCAACCACCACTCGGTGCAGGCCCTGTCCTGGAGGAAGCTGTACCTGAGCAGG
Gorilla_gorilla|10769             GTCACCTCTAACCACCACTCGGTACAGGCCCTGTCGTGGCGGAAGCTCTACCTGAGCAGG
Pan_troglodytes|34355             GTCACCTCTAACCACCACTCGGTACAGGCCCTGTCGTGGCGGAAGCTCTACCTGAGCAGG
Tupaia_belangeri|10329            GTCACCTCCAACCACCACTCGGTGCAGGCTCTGTCCTGGAGGAAGCTCTACCTGAGCAGG
Oryctolagus_cuniculus|25967       GTCACCTCCAACCACCACTCGGTGCAGGCCCTGTCCTGGAGGAAGCTCTACCTGAGCAGA
Microcebus_murinus|11068          GTCACCTCCAATCACCACTCGGTGCAGGCCCTGTCCTGGAGGAAGCTGTACCTGAGCAGG
Callithrix_jacchus|27455          ------------------------------------------------------------
                                                                                              

Ochotona_princeps|5007            GCCAAGTTGAAGGCCTCTAGCCGAACCTCAGCCCTCCTCTCC---TTTGCCATGGTGGCC
Spermophilus_tridecemlineatus|938 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTGGCC
Cavia_porcellus|12952             GCCAAACTGAAGGCCTCCAGCCGGACGTCGGCCCTCCTTTCCGGTTTCGCCATGGTGGCC
Dipodomys_ordii|10617             GCCAAGCTGAAGGCCTCCAGCCGCACCTCCGCCCTCCTCTCCGGCTTCGCCATGGTTGCC
Mus_musculus|34202                GCCAAGCTGAAAGCCTCCAGCCGGACCTCAGCCCTCCTGTCTGGCTTCGCCATGGTGGCC
Rattus_norvegicus|9254            GCCAAGCTGAAGGCCTCCAGCCGGACCTCTGCCCTCCTGTCCGGCTTCGCCATGGTGGCC
Gorilla_gorilla|10769             GCCAAGCTGAAGGCCTCCAGCAGGACCTCCGCCCTCCTCTCCGGCTTTGCCATGGTGGCC
Pan_troglodytes|34355             GCCAAGCTGAAGGCCTCCAGCAGGACCTCCGCCCTCCTCTCCGGCTTTGCCATGGTGGCC
Tupaia_belangeri|10329            GCCAAGCTGAAGGCCTCCAGCAGGACCTCAGCCCTCCTCTCAGGCTTCGCCATGGTGGCC
Oryctolagus_cuniculus|25967       GCCAAGCTGAAGGCCTCCAGCAGGACCTCGGCCCTGCTCTCCGGCTTCGCCATGGTGGCC
Microcebus_murinus|11068          GCCAAGCTGAAGGCCTCCAGCAGGACCTCAGCCCTCCTTTCCGGCTTTGCCATGGTGGCC
Callithrix_jacchus|27455          ------------------------------------------------------------
                                                                                              

Ochotona_princeps|5007            ATGGTGGAGGTACAGCTGGAGACACAGTACCAGTACCCACGGCCGCTGCTCATCGCCTTC
Spermophilus_tridecemlineatus|938 ATGGTGGAGGTGCAGCTGGAGACGCAGTACCAGTACCCACCGCCGCTGCTCATCGCCTTC
Cavia_porcellus|12952             ATGGTGGAGGTGCAGCTGGAGACGCAGTACCAGTACCCAAGGCCCCTGCTCATCGCCTTT
Dipodomys_ordii|10617             ATGGTGGAGGTGCAGCTGGAGACGCAGTACCAGTACCCACAGCCGCTGCTCGTGGCCTTC
Mus_musculus|34202                ATGGTGGAGGTGCAGCTGGAGACCAAGTACCAGTACCCTCAGCCCCTGCTCATTGCCTTC
Rattus_norvegicus|9254            ATGGTGGAGGTGCAGCTGGAGACCAAGTACCAGTACCCTCAGCCCCTGCTCATCGCCTTC
Gorilla_gorilla|10769             ATGGTGGAGGTGCAGCTGGAGACGCAGTACCAGTACCCGCGGCCGCTGCTGATTGCCTTC
Pan_troglodytes|34355             ATGGTGGAGGTGCAGCTGGAGACGCAGTACCAGTACCCGCGGCCACTGCTGATTGCCTTC
Tupaia_belangeri|10329            ATGGTGGAGGTGCAGCTGGAGACGCAGTACCAGTACCCACGGCCGCTGCTCATCGCCTTC
Oryctolagus_cuniculus|25967       ATGGTGGAGGTGCAGCTGGAGACGCAGTACCAGTACCCGCGGCCGCTGCTCATCGCCTTC
Microcebus_murinus|11068          ATGGTGGAGGTGCAGCTGGAGACGCAGTACCAGTACCCGCGGCCGCTGCTCATCGCCTTC
Callithrix_jacchus|27455          ATGGTGGAGGTGCAGCTGGAGACGCAGTACCAGTACCCGCGGCCACTGCTAATTGCCTTC
                                  ***********.*********** .************* . *** ***** .* ***** 

Ochotona_princeps|5007            AGCGCCTGCACCACAGTGCTGGTGGCTGTGCACCTGTTCGCGCTGCTCATCAGCACCTGC
Spermophilus_tridecemlineatus|938 AGCGCCTGCACCACGGTGCTGGTGGCCGTGCACCTGTTCGCCCTGCTCATCAGCACCTGC
Cavia_porcellus|12952             AGCGCCTGCACCACAGTGCTGGTGGCTGTGCATCTGTTCGCCCTCCTCATCAGCACCTGC
Dipodomys_ordii|10617             AGCGCCTGCACCACGGTGCTGGTAGCCGTGCATCTGTTCGCACTCCTCATCAGCACGTGC
Mus_musculus|34202                AGCGCCTGCACCACGGTGCTGGTAGCCGTGCATCTGTTTGCTCTGCTCATCAGCACTTGC
Rattus_norvegicus|9254            AGCGCCTGCACCACGGTGCTGGTAGCCGTGCACCTATTTGCCCTGCTCATCAGCACATGC
Gorilla_gorilla|10769             AGCGCCTGCACCACGGTGCTGGTGGCCGTGCACCTGTTCGCCCTCCTCATCAGCACCTGC
Pan_troglodytes|34355             AGCGCCTGCACCACGGTGCTGGTGGCCGTGCACCTGTTCGCCCTCCTCATCAGCACCTGC
Tupaia_belangeri|10329            AGCGCCTGCACCACGGTGCTGGTAGCCGTGCACCTGTTTGCTCTGCTCATCAGCACGTGC
Oryctolagus_cuniculus|25967       AGCGCCTGCACCACGGTGCTGGTGGCCGTGCACCTGTTCGCGCTGCTCATCAGCACCTGC
Microcebus_murinus|11068          AGCGCCTGCACCACGGTGCTGGTGGCCGTGCACCTGTTTGCCCTGCTCATCAGCACGTGC
Callithrix_jacchus|27455          AGCGCCTGCACCACTGTGCTGGTGGCCGTGCACCTGTTCGCCCTCCTCATCAGCACCTGC
                                  ************** ********.** ***** **.** ** ** *********** ***

Ochotona_princeps|5007            ATCCTGCCCAACGTGGAGGCCGTTAGCAACATCCACAACCTCAATTCCATCAGCGAGTCC
Spermophilus_tridecemlineatus|938 ATCCTGCCCAACGTGGAGGCCGTGAGCAACATCCACAACCTCAACTCCATCAGCGAATCG
Cavia_porcellus|12952             ATCCTGCCCAATGTGGAGGCCGTGAGCAACATCCACAACCTCAACTCCATCAGCGAGTCT
Dipodomys_ordii|10617             ATCCTGCCCAATGTGGAGGCTGTGAGCAACATCCACAACCTCAACTCCATCAGCGAGTCG
Mus_musculus|34202                ATCCTGCCCAACGTGGAAGCGGTGAGCAACATCCACAACCTCAACTCCATCAGCGAGTCG
Rattus_norvegicus|9254            ATCCTGCCCAACGTGGAAGCCGTGAGCAACATCCACAACCTCAACTCCATCAGCGAGTCG
Gorilla_gorilla|10769             ATCCTGCCCAACGTGGAGGCCGTGAGCAACATCCACAACCTGAACTCCATCAGCGAGTCC
Pan_troglodytes|34355             ATCCTGCCCAACGTGGAGGCCGTGAGCAACATCCACAACCTGAACTCCATCAGCGAGTCC
Tupaia_belangeri|10329            ATCCTGCCCAACGTGGAAGCCGTGAGCAACATCCACAACCTCAACTCCATCAGCGAGTCG
Oryctolagus_cuniculus|25967       ATCCTGCCCAACGTGGAGGCGGTGAGCAACATCCACAACCTCAACTCCATCAGCGAGTCC
Microcebus_murinus|11068          ATCCTGCCCAACGTGGAGGCTGTGAGCAACATCCACAACCTCAACTCCATCAGCGAGTCG
Callithrix_jacchus|27455          ATCCTGCCCAACGTGGAGGCCGTGAGCAACATCCACAACCTGAACTCCATCAGCGAGTCC
                                  *********** *****.** ** ***************** ** ***********.** 

Ochotona_princeps|5007            CCGCACGAACGCATGCACCCCTACATCGAGCTGGCCTGGGGCTTCTCCACCGTGCTCGGC
Spermophilus_tridecemlineatus|938 CCGCACGAGCGCATGCACCCCTACATTGAGCTGGCCTGGGGCTTCTCCACCGTGCTGGGC
Cavia_porcellus|12952             CCGCACGAGCGGATGCATCCCTACATTGAGTTGGCCTGGGGCTTCTCCACCGTGCTCGGC
Dipodomys_ordii|10617             CCACACGAGCGCATGCACCCCTACATTGAGCTGGCCTGGGGCTTCTCCACTGTGCTGGGC
Mus_musculus|34202                CCGCACGAGCGCATGCACCCGTACATCGAGCTGGCCTGGGGCTTCTCCACCGTTCTGGGC
Rattus_norvegicus|9254            CCGCACGAGCGCATGCACCCGTACATCGAGCTTGCCTGGGGCTTCTCTACCGTTCTGGGC
Gorilla_gorilla|10769             CCGCACGAGCGCATGCACCCCTACATCGAGCTGGCCTGGGGCTTCTCCACCGTGCTCGGC
Pan_troglodytes|34355             CCGCACGAGCGCATGCACCCCTACATCGAGCTGGCCTGGGGCTTCTCCACCGTGCTCGGC
Tupaia_belangeri|10329            CCACACGAGCGCATGCACCCCTATATCGAGCTGGCCTGGGGCTTCTCCACCGTGCTAGGC
Oryctolagus_cuniculus|25967       CCGCACGAGCGCATGCACCCCTACATCGAGCTGGCCTGGGGCTTCTCCACCGTGCTGGGC
Microcebus_murinus|11068          CCGCATGAGCGCATGCACCCCTACATCGAGCTGGCCTGGGGCTTCTCCACCGTGCTGGGC
Callithrix_jacchus|27455          CCGCACGAGCGCATGCACCCCTACATCGAGCTGGCCTGGGGCTTCTCCACCGTGCTCGGC
                                  **.** **.** ***** ** ** ** *** * ************** ** ** ** ***

Ochotona_princeps|5007            ATCCTGCTCTTCCTGGCTGAAGTGGTGCTGCTGTGCTGGATCAAGTTCCTGCCCGTGGAC
Spermophilus_tridecemlineatus|938 ATCCTGCTCTTCCTGGCTGAGGTGGTGTTGCTCTGCTGGATCAAGTTCCTTCCCGTGGAT
Cavia_porcellus|12952             ATCCTGCTTTTCCTGGCTGAGGTGGTACTGCTCTGCTGGATCAAGTTCCTCCCTGTAGAT
Dipodomys_ordii|10617             ATCCTGCTCTTCCTGGCTGAAGTTGTGTTGCTCTGCTGGATCAAATTCCTGCCAGTGGAT
Mus_musculus|34202                ATCCTGCTTTTCCTGGCTGAGGTGGTCCTGCTCTGCTGGATCAAGTTCCTCCCAGTGGAT
Rattus_norvegicus|9254            ATCCTGCTTTTCCTGGCTGAGGTGGTCCTGCTCTGCTGGATCAAGTTCCTCCCAGTGGAT
Gorilla_gorilla|10769             ATCCTACTCTTCCTGGCCGAGGTGGTGCTGCTCTGCTGGATCAAGTTCCTCCCCGTGGAT
Pan_troglodytes|34355             ATCCTACTCTTCCTGGCCGAGGTGGTGCTGCTCTGCTGGATCAAGTTCCTCCCCGTGGAT
Tupaia_belangeri|10329            ATCCTGCTCTTCCTGGCCGAGGTGGTGCTGCTCTGCTGGATCAAGTTCCTGCCTGTGGAT
Oryctolagus_cuniculus|25967       ATCCTGCTCTTCCTGGCCGAGGTGGTGCTGCTCTGCTGGATCAAGTTCCTGCCCGTGGAC
Microcebus_murinus|11068          ATCCTGCTCTTCCTGGCTGAGGTGGTGCTGCTCTGCTGGATCAAGTTCCTCCCCGTGGAC
Callithrix_jacchus|27455          ATCCTGCTCTTCCTGGCCGAGGTGGTGCTGCTCTGCTGGATTAAGTTCCTCCCCGTGGAC
                                  *****.** ******** **.** **  **** ******** **.***** ** **.** 

Ochotona_princeps|5007            GCACGGCCCCAGGCCGGCCCCCTGCCGGGC------CCTGGTGGCCACACCGGCTGGCAG
Spermophilus_tridecemlineatus|938 GCCAGGCGCCAGCCTGGCCCCACGCCAGGC------TCCGGGGGCCACACAGGCTGGCAG
Cavia_porcellus|12952             GCCAGGCACCAA------------CCTGGCCATGAGTCCAGCACCCACACGGGGTGGCAG
Dipodomys_ordii|10617             GCACGGCGCTCA------------CCAGGC------TCTGGTAGCCATGCCGGCTGGCAG
Mus_musculus|34202                GCCAAGGATCAG------------CCAGGC------TCCCACAGCCACACGGGCTGGCAG
Rattus_norvegicus|9254            GCCAAGGATCAG------------CCAGGC------TCGCATAGCCACACGGGCTGGCAG
Gorilla_gorilla|10769             GCCCGGCGCCAGCCTGGCCCCCCACCTGGC------CCTGGGAGTCACACGGGCTGGCAG
Pan_troglodytes|34355             GCCCGGCGCCAGCCTGGCCCCCCACCTGGC------CCTGGGAGTCACACGGGCTGGCAG
Tupaia_belangeri|10329            GCCAGGCGCCAGCCCGGGCCCCCACCCGGC------CCCGGTGGACACACGGGCTGGCAG
Oryctolagus_cuniculus|25967       TCGAGGCGCCAgcccggccccctgcccggc------gccggcggccACACGGGCTGGCAG
Microcebus_murinus|11068          GCCAGGAGCCAG------------CCTGGC------CCCGGCAGCCACACAGGCTGGCAG
Callithrix_jacchus|27455          GCCCGGCGCCAGTCTGGTCCCCCGCCCAGC------CCCGGCAGCCACACAGGCTGGCAG
                                   * ..*    ..            ** .**       *  . .  ** .* ** ******

Ochotona_princeps|5007            GCGGCTCTGGTGTCCACCATCATCATGGTG---CTGGACCTCATCTTCGTGATCTTC---
Spermophilus_tridecemlineatus|938 GCTGCGCTGGTGTCCACCATCATCATGGTGCCCGTGGGCCTCATCTTCGTGGTCTTCACC
Cavia_porcellus|12952             GCTGCCCTGGTGTCCACCATCATCATGGTGCCTGTGGGCCTCATCTTCGTGGTCTTCACC
Dipodomys_ordii|10617             GCCGCCCTGGTGTCCACCATCATCATGGTGCCAGTGGGGCTCATCTTCGTGGTCTTCACC
Mus_musculus|34202                GCCGCTCTGGTGTCCACCATCATCATGGTACCTGTGGGTCTCATCTTCGTGGTCTTCACC
Rattus_norvegicus|9254            GCCGCTCTGGTGTCCACCATCATCATGGTACCTGTGGGTCTCATCTTCGTGGTCTTTACT
Gorilla_gorilla|10769             GCCGCCCTGGTGTCCACCATCATCATGGTGCCCGTGGGCCTCATCTTCGTGGTCTTCACC
Pan_troglodytes|34355             GCCGCCCTGGTGTCCACCATCATCATGGTGCCCGTGGGCCTCATCTTCGTGGTCTTCACC
Tupaia_belangeri|10329            GCCGCCCTGGTGTCCACCATCATCATGGTGCCTGTGGGCCTCATCTTCGTGGTCTTCACC
Oryctolagus_cuniculus|25967       GCCGCCCTGGTGTCCACCATCATCATGGTGCCCGTGGGCCTCATCTTCGTGGTCTTCACC
Microcebus_murinus|11068          GCCGCCCTGGTGTCCACCATCATCATGGTGCCCGTGGGCCTCATCTTTGTGGTCTTCACC
Callithrix_jacchus|27455          GCCGCCCTAGTGTCCACCATCATCATGGTGCCCGTGGGCCTCATCTTCGTGGTCTTCACC
                                  ** ** **.********************.    ***. ******** ***.****    

Ochotona_princeps|5007            ATGCACTTC---CGCTCGCTGGTGCGTCACAAGACCGAGCGCCAC---CGCGAGATCGAG
Spermophilus_tridecemlineatus|938 ATCCACTTCTACCGCTCACTGGTGCGCCACAAGACAGAGCGCCACAACCGGGAGATCGAG
Cavia_porcellus|12952             ATCCACTTCTACCGCTCGCTGGTGCGCCACAAGACCGAGCGCCACAACCGCGAGATCGAG
Dipodomys_ordii|10617             ATCCACTTCTACCGCTCGCTGGTGCGCCACAAGACCGAACGCCACAACCGTGAGATCGAG
Mus_musculus|34202                ATCCACTTCTACCGTTCCCTGGTGCGGCACAAGACGGAGCGCCACAACCGTGAGATCGAA
Rattus_norvegicus|9254            ATCCACTTCTACCGCTCCCTGGTGCGACATAAGACAGAGCGCCACAACCGTGAGATCGAG
Gorilla_gorilla|10769             ATCCACTTCTACCGCTCCCTGGTGCGCCACAAAACGGAGCGCCACAACCGCGAGATCGAG
Pan_troglodytes|34355             ATCCACTTCTACCGCTCCCTGGTGCGCCACAAAACGGAGCGCCACAACCGCGAGATCGAG
Tupaia_belangeri|10329            ATCCACTTCTACCGCTCGCTGGTGCGCCACAAAACTGAGCGCCACAACCGTGAGATCGAG
Oryctolagus_cuniculus|25967       ATCCACTTCTACCGCTCGCTGGTGCGCCACAAGACCGAGCGCCACAACCGCGAGATCGAG
Microcebus_murinus|11068          ATCCACTTTTACCGCTCGCTGGTGCGCCACAAGACAGAGCGCCACAACCGTGAGATCGAG
Callithrix_jacchus|27455          ATCCACTTCTACCGCTCCCTGGTGCGCCACAAAACGGAGCGCCACAACCGCGAGATCGAG
                                  ** *****    ** ** ******** ** **.** **.******   ** ********.

Ochotona_princeps|5007            GAACTGCACAAGCTCAAGGTGCAGCTGGACGGGCACGAACGCAGCCTACAGGTGGTGTAA
Spermophilus_tridecemlineatus|938 GAGCTTCACAAGCTCAAGGTGCAACTGGACGGGTACGAGCGCAGCCTGCAGGTGGTGTGA
Cavia_porcellus|12952             GAGCTACACAAGCTCAAGGTGCAGCTGGATGGGCAGGAGCGCAGCCTGCAGGTGGTGTGA
Dipodomys_ordii|10617             GAGCTGCACAAGCTCAAGGTGCAGCTGGACGGGCAGGAGCGCAGCCTGCAGGTGGTGTGA
Mus_musculus|34202                GAGCTGCACAAGCTCAAGGTGCAGCTGGATGGGCACGAGCGGAGCCTGCAGGTGGTGTGA
Rattus_norvegicus|9254            GAACTGCACAAGCTCAAGGTGCAGCTGGATGGGCACGAGAGAAGCCTACAGGTGGTGTGA
Gorilla_gorilla|10769             GAGCTCCACAAGCTCAAGGTCCAGCTGGATGGGCATGAGCGCAGCCTGCAGGTCTTATGA
Pan_troglodytes|34355             GAGCTCCACAAGCTCAAGGTCCAGCTGGACGGGCATGAGCGCAGCCTGCAGGTCTTGTGA
Tupaia_belangeri|10329            GAGCTGCATAAGCTCAAAGTGCAGCTGGATGGGCACGAGCGCAGCCTGCAGGTGGTGTGA
Oryctolagus_cuniculus|25967       GAGCTGCACAAGCTCAAGGTGCAGCTGGACGGACACGAGCGCGGCCTGCAGGTGGTC---
Microcebus_murinus|11068          GAGCTGCACAAGCTCAAGGTGCAGCTGGACGGGCACGAGCGCAGCCTGCAGGTCGTGTGA
Callithrix_jacchus|27455          GAGCTGCACAAGCTCAAGGTGCAGCTGGACGGGCACGAGCGCAGCCTGCAGGTCGTGTGA
                                  **.** ** ********.** **.***** **. * **..* .****.*****  *    

multiple sequence alignment in CLUSTALW format


Ochotona_princeps|4341            ------------------------------------------------------------
Spermophilus_tridecemlineatus|843 ------------------------------------------------------------
Cavia_porcellus|10124             ----------------------------------------------------------SP
Dipodomys_ordii|9975              ------------------------------------------------------------
Mus_musculus|3162                 ------------------------------------------------------------
Rattus_norvegicus|2066            MGHVTAAQRCLGSGCGRKEGGGRSSALARLPGHPAPTQTLATSRSGELEPSALRASQPGL
Gorilla_gorilla|9029              --------------------------------------------------------MTCL
Pan_troglodytes|23521             ------------------------------------------------------------
Tupaia_belangeri|8951             ------------------------------------------------------------
Oryctolagus_cuniculus|9201        ------------------------------------------------------------
Microcebus_murinus|9386           ------------------------------------------------------------
Callithrix_jacchus|19527          ------------------------------------------------------------
                                                                                              

Ochotona_princeps|4341            ---MSAXXXXXXXXXXXXXXXXXXXXXXXRDWVRRSYLELVT-QQHSVQALSWRKLYLSR
Spermophilus_tridecemlineatus|843 ---MSAELNVPVDP--PACPEPGHKGMDYRDWVRRS-LELVTXXXXXXXXXXXXXXXXXX
Cavia_porcellus|10124             APTMSAELSVPADPST-ARPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSR
Dipodomys_ordii|9975              ---MSAELNVPVDPSTPACTEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSR
Mus_musculus|3162                 ---MSAELNVPMDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSR
Rattus_norvegicus|2066            VPTMSAELNVPMDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSR
Gorilla_gorilla|9029              APTMSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSR
Pan_troglodytes|23521             ---MSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSR
Tupaia_belangeri|8951             ---MSAELSVPVDPCTPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSR
Oryctolagus_cuniculus|9201        ---MSAELNVPVDPSTPACSEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSR
Microcebus_murinus|9386           ---MNAELNVPVDPSTPACSEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSR
Callithrix_jacchus|19527          ------------------------------------------------------------
                                                                                              

Ochotona_princeps|4341            AKLKASSRTSALLS-FAMVAMVEVQLETQYQYPRPLLIAFSACTTVLVAVHLFALLISTC
Spermophilus_tridecemlineatus|843 XXXXXXXXXXXXXXXXXXVAMVEVQLETQYQYPPPLLIAFSACTTVLVAVHLFALLISTC
Cavia_porcellus|10124             AKLKASSRTSALLSGFAMVAMVEVQLETQYQYPRPLLIAFSACTTVLVAVHLFALLISTC
Dipodomys_ordii|9975              AKLKASSRTSALLSGFAMVAMVEVQLETQYQYPQPLLVAFSACTTVLVAVHLFALLISTC
Mus_musculus|3162                 AKLKASSRTSALLSGFAMVAMVEVQLETKYQYPQPLLIAFSACTTVLVAVHLFALLISTC
Rattus_norvegicus|2066            AKLKASSRTSALLSGFAMVAMVEVQLETKYQYPQPLLIAFSACTTVLVAVHLFALLISTC
Gorilla_gorilla|9029              AKLKASSRTSALLSGFAMVAMVEVQLETQYQYPRPLLIAFSACTTVLVAVHLFALLISTC
Pan_troglodytes|23521             AKLKASSRTSALLSGFAMVAMVEVQLETQYQYPRPLLIAFSACTTVLVAVHLFALLISTC
Tupaia_belangeri|8951             AKLKASSRTSALLSGFAMVAMVEVQLETQYQYPRPLLIAFSACTTVLVAVHLFALLISTC
Oryctolagus_cuniculus|9201        AKLKASSRTSALLSGFAMVAMVEVQLETQYQYPRPLLIAFSACTTVLVAVHLFALLISTC
Microcebus_murinus|9386           AKLKASSRTSALLSGFAMVAMVEVQLETQYQYPRPLLIAFSACTTVLVAVHLFALLISTC
Callithrix_jacchus|19527          --------------------MVEVQLETQYQYPRPLLIAFSACTTVLVAVHLFALLISTC
                                                      ********:**** ***:**********************

Ochotona_princeps|4341            ILPNVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVD
Spermophilus_tridecemlineatus|843 ILPNVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVD
Cavia_porcellus|10124             ILPNVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVD
Dipodomys_ordii|9975              ILPNVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVD
Mus_musculus|3162                 ILPNVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVD
Rattus_norvegicus|2066            ILPNVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVD
Gorilla_gorilla|9029              ILPNVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVD
Pan_troglodytes|23521             ILPNVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVD
Tupaia_belangeri|8951             ILPNVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVD
Oryctolagus_cuniculus|9201        ILPNVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVD
Microcebus_murinus|9386           ILPNVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVD
Callithrix_jacchus|19527          ILPNVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVD
                                  ************************************************************

Ochotona_princeps|4341            ARPQAGPLPG--PGGHTGWQAALVSTIIMV-LDLIFVIF-MHF-RSLVRHKTERH-REIE
Spermophilus_tridecemlineatus|843 ARRQPGPTPG--SGGHTGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIE
Cavia_porcellus|10124             ARHQ----PGHESSTHTGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIE
Dipodomys_ordii|9975              ARRS----PG--SGSHAGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIE
Mus_musculus|3162                 AKDQ----PG--SHSHTGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIE
Rattus_norvegicus|2066            AKDQ----PG--SHSHTGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIE
Gorilla_gorilla|9029              ARRQPGPPPG--PGSHTGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIE
Pan_troglodytes|23521             ARRQPGPPPG--PGSHTGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIE
Tupaia_belangeri|8951             ARRQPGPPPG--PGGHTGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIE
Oryctolagus_cuniculus|9201        SRRQPGPLPG--AGGHTGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIE
Microcebus_murinus|9386           ARSQ----PG--PGSHTGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIE
Callithrix_jacchus|19527          ARRQSGPPPS--PGSHTGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIE
                                  :: .    *.  .  *:************* :.****:* :** *********** ****

Ochotona_princeps|4341            ELHKLKVQLDGHERSLQVV
Spermophilus_tridecemlineatus|843 ELHKLKVQLDGYERSLQVV
Cavia_porcellus|10124             ELHKLKVQLDGQERSLQVV
Dipodomys_ordii|9975              ELHKLKVQLDGQERSLQVV
Mus_musculus|3162                 ELHKLKVQLDGHERSLQVV
Rattus_norvegicus|2066            ELHKLKVQLDGHERSLQVV
Gorilla_gorilla|9029              ELHKLKVQLDGHERSLQVL
Pan_troglodytes|23521             ELHKLKVQLDGHERSLQVL
Tupaia_belangeri|8951             ELHKLKVQLDGHERSLQVV
Oryctolagus_cuniculus|9201        ELHKLKVQLDGHERGLQVV
Microcebus_murinus|9386           ELHKLKVQLDGHERSLQVV
Callithrix_jacchus|19527          ELHKLKVQLDGHERSLQVV
                                  *********** **.***: