Orthologs Set ID: EOG4003HT


Orthology Database
OrthoDB4
Gene Symbol(s)
PPCS

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 42436 538, 642
Cavia porcellus 4816 538, 642
Dipodomys ordii 7941 31, 538, 558, 642
Gorilla gorilla 14601 538, 642
Homo sapiens 2958 642
Microcebus murinus 16043 538, 642
Mus musculus 30335 538, 642
Ochotona princeps 15985 459, 530, 538, 642
Oryctolagus cuniculus 5978 249, 297, 538, 642
Pan troglodytes 1129 389, 642
Rattus norvegicus 28009 538, 642
Spermophilus tridecemlineatus 111 187, 538, 642
Tarsius syrichta 4114 538, 642
Tupaia belangeri 15053 84, 538, 642

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 42436 ENSCJAT00000005993 100414413 ENSCJAG00000003121 PPCS calJac3
Cavia porcellus 4816 ENSCPOT00000003283 100713605 ENSCPOG00000003240 PPCS cavPor3
Dipodomys ordii 7941 ENSDORT00000015842 ENSDORG00000015843 Ppcs dipOrd1
Gorilla gorilla 14601 ENSGGOT00000023058 101138135 ENSGGOG00000026253 PPCS gorGor3
Homo sapiens 2958 ENST00000372562 79717 ENSG00000127125 PPCS hg19,GRCh37
Microcebus murinus 16043 ENSMICT00000014926 ENSMICG00000014936 PPCS micMur1
Mus musculus 30335 ENSMUST00000030385 106564 ENSMUSG00000028636 Ppcs mm9
Ochotona princeps 15985 ENSOPRT00000008754 ENSOPRG00000008764 PPCS OchPri2.0
Oryctolagus cuniculus 5978 ENSOCUT00000022670 100357911 ENSOCUG00000027000 PPCS oryCun2.0
Pan troglodytes 1129 ENSPTRT00000059324 ENSPTRG00000030660 PPCS panTro2
Rattus norvegicus 28009 ENSRNOT00000011392 298490 ENSRNOG00000008572 Ppcs rn4
Spermophilus tridecemlineatus 111 ENSSTOT00000000111 101973297 ENSSTOG00000000111 Ppcs speTri1
Tarsius syrichta 4114 ENSTSYT00000005454 103269616 ENSTSYG00000005466 PPCS tarSyr1
Tupaia belangeri 15053 ENSTBET00000015054 ENSTBEG00000015068 PPCS tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 33817 ENSCJAP00000005686 100414413 ENSCJAG00000003121 PPCS calJac3
Cavia porcellus 3750 ENSCPOP00000002934 100713605 ENSCPOG00000003240 PPCS cavPor3
Dipodomys ordii 7460 ENSDORP00000014902 ENSDORG00000015843 Ppcs dipOrd1
Gorilla gorilla 11855 ENSGGOP00000024764 101138135 ENSGGOG00000026253 PPCS gorGor3
Homo sapiens 34339 ENSP00000361643 79717 ENSG00000127125 PPCS hg19,GRCh37
Microcebus murinus 13616 ENSMICP00000013609 ENSMICG00000014936 PPCS micMur1
Mus musculus 2568 ENSMUSP00000030385 106564 ENSMUSG00000028636 Ppcs mm9
Ochotona princeps 13932 ENSOPRP00000008014 ENSOPRG00000008764 PPCS OchPri2.0
Oryctolagus cuniculus 13578 ENSOCUP00000017583 100357911 ENSOCUG00000027000 PPCS oryCun2.0
Pan troglodytes 28457 ENSPTRP00000052446 ENSPTRG00000030660 PPCS panTro2
Rattus norvegicus 13110 ENSRNOP00000011392 298490 ENSRNOG00000008572 Ppcs rn4
Spermophilus tridecemlineatus 97 ENSSTOP00000000097 101973297 ENSSTOG00000000111 Ppcs speTri1
Tarsius syrichta 3770 ENSTSYP00000004993 103269616 ENSTSYG00000005466 PPCS tarSyr1
Tupaia belangeri 13085 ENSTBEP00000013069 ENSTBEG00000015068 PPCS tupBel1

multiple sequence alignment in CLUSTALW format


Ochotona_princeps|15985           ------------------------------ATGGCGGAAAGGGACTTGGCCGCCGAGTTC
Dipodomys_ordii|7941              ------------------------------ATGGCGGAAGTGGACCTAGTGGCTGAGTTC
Spermophilus_tridecemlineatus|111 ------------------------------AGGGAGGAAATGGACATCGTCTCCGAGTTC
Oryctolagus_cuniculus|5978        ------------------------------ATGGCGGAAAGGGACTTGGTTGCTGAGTTT
Mus_musculus|30335                ------------------------------ATGGCGGAAATGGACCTGGTGGCTGAGTTG
Rattus_norvegicus|28009           ------------------------------ATGGCGGAAATGGACCTGGTGGCTGAGTTG
Cavia_porcellus|4816              ------------------------------ATGGCGGAAATGGACCTGGGCGCCGAGTTC
Microcebus_murinus|16043          ------------------------------ATGGCGGAAATGGATCTGGTTGCCGAGTTT
Tupaia_belangeri|15053            ------------------------------ATGGCGGAGAAGGACCTGGTCGCCGAGTTC
Tarsius_syrichta|4114             ------------------------------ATGGCGGAAATGGACCTGGTCGCCGAGTTC
Callithrix_jacchus|42436          ------------------------------ATAGCGGAAATGGACCTGGTAGCCGAGTTC
Homo_sapiens|2958                 ------------------------------------------------------------
Pan_troglodytes|1129              ------------------------------ATGGCGGAAATGGATCCGGTAGCCGAGTTC
Gorilla_gorilla|14601             CGTGCGCAGGCGCCGGCCGCTGCGGTGCAGATGGCGGAAATGGATCCGGTAGCCGAGTTC
                                                                                              

Ochotona_princeps|15985           CCCCGGCCTGCCGGTGCTGCGCGCTGGGCCGAGGTTATGGCCCGCTTCGCGGCCAGGCTG
Dipodomys_ordii|7941              CCCCGACCCGCGGGTGCTGCGCGCTGGGCCGAAGTTATGGCTGGCTTCGCGGCCAGGCTG
Spermophilus_tridecemlineatus|111 CCCCAGCCTTCGGGTGCTGCTCGCTCGGCCGAGGTTATCGCTCGCTTCGCGGCCCGGCTA
Oryctolagus_cuniculus|5978        CCTCGGCCCGCCGGTGCTGCGCGCTGGGCCGAGGTTATGGCCCGCTTTGCGGCCAGACTG
Mus_musculus|30335                CCGCGTCCTGCGGGTGCTGCGCGCTGGGCCGAGGTTATGGCTCGCTTTGCGGCCAGGCTG
Rattus_norvegicus|28009           CCGCGTCCCGAGGGTGCTGCGCGCTGGGCCGAGGTTATGGCTCGCTTTGCGGCCAGGCTG
Cavia_porcellus|4816              CCCCGGCCTGCGGGTGCTGCGCGCTGGGCCGAGGTTATGGCTCGCTTTGCCGCCCGTCTG
Microcebus_murinus|16043          CCCCGGCCGGCCGGTGCCGCGCGCTGGGCTGAGGTTATGGCTCGCTTTGCCGCCAGGCTG
Tupaia_belangeri|15053            CCCCAGCCTGCCGGCGCTGCGCGC---GCCGAGGTTATGGCTCGCTTCGCGGCAGGGCTG
Tarsius_syrichta|4114             CCGCAGCCTCCCGGTGTTGCGCGCTGGGCGGAGGTTATGGCTCGCTTCGCGGCCGGGCTG
Callithrix_jacchus|42436          CCCCAGCCTCCCGGTGCCGCGCGCTGGGCTGAGGTTATGGCTCGCTTCGCTGCCAGGCTG
Homo_sapiens|2958                 ------------------------------------------------------------
Pan_troglodytes|1129              CCCCAGCCTCCCGGTGCTGCGCGCTGGGCTGAGGTTATGGCTCGCTTCGCGGCCAGGCTG
Gorilla_gorilla|14601             CCCCAGCCTCCCGGTGCTGCGCGCTGGGCTGAGGTTATGGCTCGCTTCGCGGCCAGGCTG
                                                                                              

Ochotona_princeps|15985           GGCGCTCAGGGCCGGCGGGTGGTGTTGGTCACGTCAGGCGGCACCAAGGTCCCGTTGGAA
Dipodomys_ordii|7941              GGCGCACAGGGCCGGCGGGTGGTGCTGGTCACGTCAGGTGGCACCAAGGTCCCTCTGGAA
Spermophilus_tridecemlineatus|111 GGCGCACAGGGCCGGCGGTGGTCGTTTGTCACTTCAGGCGGCACCAAGGTCCCTCTGGAA
Oryctolagus_cuniculus|5978        GGCGCGCAGGGCCGCCGGGTGGTGTTGGTCACGTCAGGCGGCACCAAGGTCCCGTTGGAA
Mus_musculus|30335                GGCGAGCAGGGCCGGCGGGTGGTGCTGATCACATCTGGAGGCACCAAGGTCCCCCTGGAA
Rattus_norvegicus|28009           GGCGAGCAGGGCCGGCGGGTGGTGCTGGTCACGTCTGGAGGCACTAAGGTTCCTCTGGAA
Cavia_porcellus|4816              GGCGAGCAGGGACGGAGGGTGGTGTTGGTTACGTCAGGTGGCACCAAGGTTCCTCTGGAA
Microcebus_murinus|16043          GGCGCGCAGGGCCGGCGGGTGGTGTTGGTCACGTCAGGCGGCACCAAGGTCCCACTGGAA
Tupaia_belangeri|15053            GGCGCGCAGGGCCGGCGGGTCGTGTTGGTCACGTCCGGCGGCACCAAGGTCCCACTGGAA
Tarsius_syrichta|4114             GGCGCACAGGGCCGGCGGGTGGTGTTGGTCACGTCAGGCGGCACGAAGGTCCCACTGGAA
Callithrix_jacchus|42436          GGCGCGCAGGGCCGGCGGGTGGTGTTGGTCACGTCCGGCGGCACCAAGGTCCCACTGGAG
Homo_sapiens|2958                 ------------------------------------------------------------
Pan_troglodytes|1129              GGCGCGCAGGGCCGGCGGGTGGTGTTGGTTACGTCAGGCGGCACCAAGGTCCCACTGGAA
Gorilla_gorilla|14601             GGCGCGCAGGGCCGGCGGGTGGTGTTGGTTACGTCAGGCGGCACCAAGGTCCCACTGGAA
                                                                                              

Ochotona_princeps|15985           GCACGACCAGTACGCTTTTTGGACAACTTCAGCAGCGGGCGGCGCGGTGCCACCTCGGCC
Dipodomys_ordii|7941              GCGCGGCCGGTGCGCTTTCTGGACAACTTCAGCAGCGGGCGGCGCGGGGCCATGTCGGTC
Spermophilus_tridecemlineatus|111 GCGCGGCCAGTGCGCTTTCTGGACAACTTCAGCAGCGGACGGCGCGGTGCAATTTCAGCC
Oryctolagus_cuniculus|5978        GCGCGGCCAGTCCGCTTTTTGGACAACTTCAGCAGCGGC------GGCGCGGTGCACTCG
Mus_musculus|30335                GCGCGAGCCGTGCGCTTTCTGGACAACTTCAGTAGCGGGCGACGCGGAGCCGCGTCGGCG
Rattus_norvegicus|28009           GCGCGAGCCGTGCGCTTTCTGGACAACTTCAGCAGCGGGCGACGCGGGGCAGCGTCGGCG
Cavia_porcellus|4816              GCGAGGCCCGTGCGCTTTCTGGACAACTTCAGCAGTGGACGGCGTGGTGCAGCCTCGGCG
Microcebus_murinus|16043          GCGCGGCCGGTGCGCTTTCTGGACAACTTCAGCAGCGGGCGGCGAGGTGCAACCTCGGCC
Tupaia_belangeri|15053            GCGCGACCGGTGCGCTTCCTGGACAACTTCAGCAGCGGGCGGCGCGGGGCCACCTCGGCC
Tarsius_syrichta|4114             GCGCGGCCGGTGCGCTTCCTGGACAACTTCAGCAGCGGGCGGCGCGGCGCAACCTCGGCC
Callithrix_jacchus|42436          GCGCGGCCCGTGCGATTCTTGGACAACTTTAGCAGCGGGCGCCGCGGTGCAGCCTCGGCT
Homo_sapiens|2958                 ------------------------------------------------------------
Pan_troglodytes|1129              GCGCGGCCGGTGCGCTTCCTGGACAACTTCAGCAGCGGGCGGCGCGGTGCAACCTCGGCC
Gorilla_gorilla|14601             GCGCGGCCGGTGCGCTTCCTGGACAACTTCAGCAGCGGGCGGCGCGGTGCAACCTCGGCC
                                                                                              

Ochotona_princeps|15985           GAGGCCTTCCTAGCTGCGGGCTATGGGGTGCTGTTCCTGTACCGCGCTCGCTCCGCCTTC
Dipodomys_ordii|7941              GAGGCCTTCCTGGCGGCGGGCTATGGGGTCCTGTTCTTGTATCGCGCTCGCTCAGCCTTT
Spermophilus_tridecemlineatus|111 GAGGCCTTCCTGGCTGCAGGCTACGGGGTCCTGTTCTTGTACCGCGCTCGTTCCTGTTTC
Oryctolagus_cuniculus|5978        CGAGGCTTC---GCTGCGGGCTACGGGGTCCTGTTCCTGTACCCCGCT---CCCGCCCTC
Mus_musculus|30335                GAGGTCTTCCTGGCTGCCGGCTATGGAGTCCTGTTCTTGTACCGAGCGCGCTCGGCCTTC
Rattus_norvegicus|28009           GAGGTCTTCCTGGCTGCCGGCTATGGGGTCTTGTTCTTGTACCGAGCACGCTCGGCCTTC
Cavia_porcellus|4816              GAGGCCTTTCTGGCTGCAGGTTATGGGGTCCTGTTCTTGTACCGTGCCCGCTCCGCCTTC
Microcebus_murinus|16043          GAGGCCTTCCTGGCCGCCGGCTATGGGGTCCTGTTCTTGTACCGTGCTCGCTCTGCTTTC
Tupaia_belangeri|15053            GAGGCCTTCCTGGCCGCGGGCTACGGGGTCTTGTTCCTGTACCGCGCTCGCTCCGCCTTC
Tarsius_syrichta|4114             GAGGCCTTCCTGGCGGCCGGCTACGGGGTCCTGTTTTTGTACCGCGCTCGCTCCGCCTTC
Callithrix_jacchus|42436          GAGGCCTTTCTAGCCACCGGCTACGGGGTTCTGTTCTTGTATCGCGCTCGCTCCGCCTTC
Homo_sapiens|2958                 ------------------------------------------------------------
Pan_troglodytes|1129              GAGGCCTTCCTAGCCGCCGGCTACGGGGTCCTGTTCTTGTATCGCGCTCGCTCTGCCTTC
Gorilla_gorilla|14601             GAGGCCTTCCTAGCCGCCGGCTACGGGGTCCTGTTCTTGTATCGCGCTCGCTCTGCCTTC
                                                                                              

Ochotona_princeps|15985           CCCTTTGCCCACCGCTTCCCGCCCCAGACCTGGCTGTCGGCCCTGCGGCCCTCGGGCCCG
Dipodomys_ordii|7941              CCCTATGCCCATCGCTTCCCGCCTCAGACCTGGCTGGCCGCCTTGCGGCCCGCTGGCCCA
Spermophilus_tridecemlineatus|111 CCCTTTGCCCACCGCTTCCCGCCTCAGACCTGGCTGTCGGCCCTGCGGCCTTCTGGCCCA
Oryctolagus_cuniculus|5978        CCCTTTGCCCACCGCTTCCCGCCCCAGACCTGGCTGGCGGCCCTGAGGCCCTCCGGCCCG
Mus_musculus|30335                CCCTATGCCCACCGCTTCCCGCCCCAGGCCTGGCTGTCAGCCCTTCGGCCTTCTGGCCCA
Rattus_norvegicus|28009           CCCTACGCCCACCGCTTCCCGCCCCAGGCCTGGCTGTCAGCCCTTCGGCCTTCTGGCCCA
Cavia_porcellus|4816              CCCTATGCCCATCGCTTCCCGCCTCAGTCCTGGCTGTCAGCTCTGCGACCTTCTGGGCCA
Microcebus_murinus|16043          CCCTTTGCCCACCGCTTCCCACCCCAGACCTGGCTGTCAGCTCTGCGGCCTTCCGGCCCA
Tupaia_belangeri|15053            CCCTTTGCCCACCGTTTCCCACCCCAGACCTGGCTGTCCGCCCTGCGGCCTTCCGGCCCT
Tarsius_syrichta|4114             CCTTATGCCCACCGCTTCCCACCCCAGACCTGGCTGTCGGCTCTGCGGCCTTCTGGCCCA
Callithrix_jacchus|42436          CCCTATGCCCACCGCTTCCCACCCCAGACTTGGCTGTCGGCTCTGCGCCCTTCGGGCCCA
Homo_sapiens|2958                 ------------------------------------------------------------
Pan_troglodytes|1129              CCCTATGCCCACCGCTTCCCACCCCAGACTTGGCTGTCCGCTCTGCGGCCTTCGGGCCCA
Gorilla_gorilla|14601             CCCTATGCCCACCGCTTCCCACCCCAGACTTGGCTGTCCGCTCTGCGGCCTTCGGGCCCA
                                                                                              

Ochotona_princeps|15985           GCGCACTCGGGCTTGCTGAGTCTGGAAGCCGAGGAGAAGGCGCTGCCGGGCTTCGCCGCG
Dipodomys_ordii|7941              CCTCAGGCGGGCCTCCTGAGCCTAGAAGCCGAGGAGAAGGCGCTCCCGGGCTTCGCTGCG
Spermophilus_tridecemlineatus|111 GCTAAGTCGGGCGTGCTGAGCCTGGAGGCCGAGGAGAATGCACTCCCGGGCTTCGCTGCG
Oryctolagus_cuniculus|5978        GCGCATTCGGGCTTGCTGAGCCTGGAAGCCGAGGAGAACGCGCTGCCCGGCTTCGCCGCG
Mus_musculus|30335                GCCCAGTCGGGCAAGCTGAGTCTGGAGGCCGAAGAGAATGCGCTCCCGGGCTTTGCTGCA
Rattus_norvegicus|28009           GCTCAATCGGGCAAGCTGAGTCTGGAGGCCGAAGAGAATGCACTCCCAGGCTTTGCTGCA
Cavia_porcellus|4816              GCACAGTCAGGCATGCTGAGCCTGGAAGCCGAGGAGAATGCACTACCAGGCTTTGCTGAG
Microcebus_murinus|16043          GCTCATTCGGGCTTGCTGAGCCTTGAGGCCGAGGAGAATGCACTCCCGGGCTTCGCTGCG
Tupaia_belangeri|15053            GCCAGTTCGGGCGTGCTGAGCCTGGAGGCCGAGGAGAATGCACTCCCGGGCTTCGCAGCG
Tarsius_syrichta|4114             GCCCATAAGGGTTTGCTGAGCCTGGAAGCCGAGGAGAATGCACTCCCGGGGTTCGCAACG
Callithrix_jacchus|42436          GCCCATTCAGGCTTGCTGAGCCTGGAGGCGGAGGAGAACGCACTCCCGGGTTTTGCTGAG
Homo_sapiens|2958                 ------------------------------------------------------------
Pan_troglodytes|1129              GCTCTTTCGGGCTTGCTGAGCCTGGAGGCG------------------------------
Gorilla_gorilla|14601             GCCCTTTCGGGCTTGCTGAGCCTGGAGGCGGAGGAGAATGCACTTCCGGGTTTTGCTGAG
                                                                                              

Ochotona_princeps|15985           GCTCTGCAGAGCTACCAGGAGGCAGAGGCTGCCGGCACCTTCCTGGCGGTGGAGTTCACC
Dipodomys_ordii|7941              GCTCTGCGGAGCTACCAGGAGGCAGCGACTGCCGGCACCTTCCTGGCGGTAGAGTTCACC
Spermophilus_tridecemlineatus|111 GCTTTGCGGAGCTACCAAGAAGCAGCGGCTGCCGGCACCTTCCTGGCTGTAGAGTTCTCC
Oryctolagus_cuniculus|5978        GCTCTGCAGAGCTACCAGGAGGCAGCGGCTGCCGGCACCTTTCTGGCGGTGGAGTTCACC
Mus_musculus|30335                GCATTGCAGAGCTACCAAGAGGCAGCCGCTGCCGGCACCTTTCTGGCTGTAGAGTTTACC
Rattus_norvegicus|28009           GCGTTGCAGGGCTACCAAGAGGCAGCTGCTGCCGGCACCTTCCTGGCTGTAGAGTTTACC
Cavia_porcellus|4816              GCTTTGCGGAGCTATCAGGAAGCAGCGGCTGCCGGCACCTTCTTGGCCGTAGAGTTCACC
Microcebus_murinus|16043          GCTCTGCGGAGCTACCAAGAGGCTGTGGCTGCCGGCACCTTCATGGCGGTAGAGTTCACC
Tupaia_belangeri|15053            GCTCTGCGGAGCTACCAGGAGGCAGCGGCCGCTGGCACCTTCCTGGCTGTAGAGTTCACC
Tarsius_syrichta|4114             GCTCTGCGGAGCTACCAGGAGGCTGCGGCTGCCGGCACCTTCCTGGCGGTAGAGTTCACC
Callithrix_jacchus|42436          GGTCTGCGGAGCTACCAGGAGGCTGCAGCTGCAGGCACCTTCCTGGCGGTAGAGTTCACC
Homo_sapiens|2958                 ------------------------------------------------------------
Pan_troglodytes|1129              ------------------------------------------------------------
Gorilla_gorilla|14601             GCTCTGAGGAGCTACCAGGAGGCTGCGGCTGCAGGCACCTTCCTGGTGGTAGAGTTCACC
                                                                                              

Ochotona_princeps|15985           ACTTTGGCGGACTATCTGCATCTGCTGCAGGCGGCAGCCCAGGGGCTCAACCCGCTAGNN
Dipodomys_ordii|7941              ACTTTGGCGGACTATCTGCATCTGCTGCAAGCTGCGGCCCAGGCGCTCAACCCACTAGGC
Spermophilus_tridecemlineatus|111 ACTTTGGCAGACTATTTGCATCTGCTGAAGGCTGCTGCCCAAGCGCTCAGTCCACTAGGG
Oryctolagus_cuniculus|5978        ACCTTGGCAGACTACCTGCACCTGCTTCAGGCGGCAGCGCAGGCGCTCAACCCGCTCGGC
Mus_musculus|30335                ACTTTGGCGGATTATCTGCATCTGCTGCAGGCTGCTGCCCTGGCTCTCAGTCCATTAGGC
Rattus_norvegicus|28009           ACTTTGGCGGATTACCTGCATCTGCTGCAGGCTGCGGCCCTGGCTCTCAATCCATTAGGC
Cavia_porcellus|4816              ACTTTGGCGGACTATTTGCATCTGCTTCAGGCTGCGGCTCAAGCACTCAACCCTCTAGGC
Microcebus_murinus|16043          ACTTTGGCAGACTATTTGCATTTGTTGCAGGCTGCGGCCCAGGCGCTCAATCCGCTAGGC
Tupaia_belangeri|15053            ACTTTGGCAGACTATTTGCATCTGCTACAGGCTGCGGCCCAGGCGCTCAATCCACTAGGC
Tarsius_syrichta|4114             ACTTTGGCGGACTATTTGCATCTCTTGCAGGCTGCAGCCCAGGCGCTCAACCCGCTAGGC
Callithrix_jacchus|42436          ACTTTGGCGGACTATTTGCATCTGTTGCAGGCTGCGGCCCAGGCACTCAATCCGCTAGGC
Homo_sapiens|2958                 ------------------------------------------------------------
Pan_troglodytes|1129              ------------------------------------------------------------
Gorilla_gorilla|14601             ACTTTGGCGGACTATTTGCATCTGTTGCAGGCTGCGGCCCAGGCACTCAATCCGCTAGGC
                                                                                              

Ochotona_princeps|15985           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|7941              CCTTCTGCGATGTTTTAC---GCTGCGGCCGTGTCAGATTTCTATGTTCCTGTCTCTGAA
Spermophilus_tridecemlineatus|111 CCTTCTGCGATGTTTTACCTGGCTGCGGCCGTGTCAGATTTCTATGTTCCTGTCTCTGAA
Oryctolagus_cuniculus|5978        TCGTCCGCGATGTTTTACCTGGCTGCGGCCGTGTCCGATTTCTATGTTCCTGTCTCTGAA
Mus_musculus|30335                TCTTCTGCGATGTTTTACCTGGCCGCGGCAGTGTCAGATTTCTATATTCCTGTCTCCGAA
Rattus_norvegicus|28009           TCTTCTGCGATGTTTTACCTGGCCGCGGCAGTGTCAGATTTCTATATTCCTGTCTCTGAA
Cavia_porcellus|4816              CCTTCTGCGATGTTTTACCTCGCTGCAGCCGTGTCAGATTTCTATGTTCCTGTCTCTGAA
Microcebus_murinus|16043          TCTACTGCGATGTTTTACCTGGCTGCGGCCGTGTCAGATTTCTATGTTCCTGTTTCTGAA
Tupaia_belangeri|15053            CCTTCTGCGATGTTTTACCTAGCTGCGGCCGTGTCAGATTTCTATGTTCCTGTGTCTGAA
Tarsius_syrichta|4114             CCTTCTGCGATGTTTTACCTGGCTGCGGCCGTGTCAGATTTCTATGTTCCTGTCTCTGAA
Callithrix_jacchus|42436          CCTTCTGCGATGTTTTACCTGGCTGCGGCCGTGTCAGATTTCTATGTTCCTGTCTCTGAA
Homo_sapiens|2958                 ---------ATGTTTTACCTGGCTGCGGCTGTGTCAGATTTCTATGTTCCTGTCTCTGAA
Pan_troglodytes|1129              ---------------------------------TCAGATTTCTATGTTCCTGTCTCTGAA
Gorilla_gorilla|14601             CCTTCTGCGATGTTTTACCTGGCTGCGGCTGTGTCAGATTTCTATGTTCCTGTCTCTGAA
                                                                   .  . ... . . ..  ... .  .  

Ochotona_princeps|15985           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATAACAATGAAGATGGTG
Dipodomys_ordii|7941              ATGCCTGAACACAAGATCCAGTCATCTGGGNNNNNNNNNNNNATAACAATGAAGATGGTG
Spermophilus_tridecemlineatus|111 ATGCCTGAACACAAGATCCAGTCATCTGGGGGCCCACTGCAGATAACAATGAAGATGGTG
Oryctolagus_cuniculus|5978        ATGCCTGAACACAAGATCCAGTCATCTGCGGGCGCACTGCAGATAACAATGAAGATGGTG
Mus_musculus|30335                ATGCCTGAACACAAGATCCACTCATCTGGTGGCCCACTGCAGATAACAATGAAGATGGTG
Rattus_norvegicus|28009           ATGCCTGAACACAAGATCCACTCATCTGGTGGCCCACTGCAGATAACAATGAAGATGGTG
Cavia_porcellus|4816              ATGCCTGAACACAAGATCCAGTCATCTGGGGGCCCACTGCAGATAACCATGAAGATGGTG
Microcebus_murinus|16043          ATGCCTGAACACAAGATCCAGTCATCTGGGGGCCTACTGCAGATAACAATGAAGATGGTG
Tupaia_belangeri|15053            ATGCCTGAACACAAGATCCAGTCATCTGGGGGCCCACTGCAGATAACAATGAAGATGGTG
Tarsius_syrichta|4114             ATGCCTGAACACAAGATCCAGTCATCTGGGGGTCCACTGCAGATAACAATGAAGATGGTG
Callithrix_jacchus|42436          ATGCCTGAACACAAGATCCAGTCATCTGGGGGCCCACTGCAGATAACAATGAAGATGGTG
Homo_sapiens|2958                 ATGCCTGAACACAAGATCCAGTCATCTGGGGGCCCACTGCAGATAACAATGAAGATGGTG
Pan_troglodytes|1129              ATGCCTGAACACAAGATCCAGTCATCTGGGGCCCCACTGCAGATAACAATGAAGATGGTG
Gorilla_gorilla|14601             ATGCCTGAACACAAGATCCAGTCATCTGGGGGCCCACTGCAGATAACAATGAAGATGGTG
                                   ..  ..       . .    .  . ..  .      ..  .*****.************

Ochotona_princeps|15985           CCAAAAATGCTTTCTCCTTTGGTTAAAGATTGGGCTCCCAAAGCATTTATTATTTCCTTT
Dipodomys_ordii|7941              CCAAAAATGCTCTCTCCTTTGGTTAAAGATTGGGCTCCCAAAGCATTTATAATTTCCTTT
Spermophilus_tridecemlineatus|111 CCAAAAATGCTTTATCCTTTGGTTAAAGATTGGGCTCCCAAAGCCTTTATAATTTCCTTT
Oryctolagus_cuniculus|5978        CCAAAAATGCTTTCTCCTTTGGTTAAAGATTGGGCCCCCAAAGCATTTATTATTTCCTTT
Mus_musculus|30335                CCAAAGATGCTTTCCCCTCTGGTCAAAGACTGGGCTCCTAAAGCGTTTGTAGTTTCCTTT
Rattus_norvegicus|28009           CCGAAGATGCTCTCTCCTCTGGTTAAGGACTGGGCTCCCAAAGCATTTATAGTTTCGTTC
Cavia_porcellus|4816              CCAAAAATGCTTTCTCCTTTAGTTAAAGATTGGGCTCCCAAAGCATTTATAATTTCCTTT
Microcebus_murinus|16043          CCAAAAATGCTTTCTCCTTTGGTTAAAGATTGGGCTCCCAAGGCATTTATAATTTCTTTT
Tupaia_belangeri|15053            CCAAAGATGCTTTCTCCTTTGGTTAAAGATTGGGCTCCCAAGGCATTTATAATTTCCTTT
Tarsius_syrichta|4114             CCAAAAATGCTTTCTCCTTTGGTTAAAGATTGGGCTCCCAAAGCATTTATAATTTCCTTT
Callithrix_jacchus|42436          CCAAAAATGCTTTCTCCTTTGGTTAAAGATTGGGCTCCCAAAGCATTTATAATTTCCTTT
Homo_sapiens|2958                 CCAAAACTGCTTTCTCCTTTGGTTAAAGATTGGGCTCCCAAAGCATTTATAATTTCCTTT
Pan_troglodytes|1129              CCAAAACTGCTTTCTCCTTTGGTTAAAGATTGGGCTCCCAAAGCATTTATAATTTCCTTT
Gorilla_gorilla|14601             CCAAAACTGCTTTCTCCTTTGGTTAAAGATTGGGCTCCCAAAGCATTTATAATTTCCTTT
                                  **.**..**** *. *** *.** **.** ***** ** **.** ***.*:.**** ** 

Ochotona_princeps|15985           AAGTTGGAGACTGACCCCTCCATCGTAATTAATCGTGCTCGGAACGCTTTGGAAGTTTAC
Dipodomys_ordii|7941              AAGTTGGAGACTGATCCTTCCATCATAATTAATCGTGCTCGGAACGCTTTGGAAGTTTAT
Spermophilus_tridecemlineatus|111 AAGTTGGAGACCGACCCCTCCATCATAATTAATCGTGCTCGGAATGCTTTGGAAGTTTAT
Oryctolagus_cuniculus|5978        AAGTTGGAGACTGACCCCTCCATCGTAATTAATCGTGCTCGGAACGCTTTGGAAGTTTAC
Mus_musculus|30335                AAGCTGGAGACAGACCCGGACATCATAATCAGTCGGGCTCGGAATGCTTTGGAAGTTTAC
Rattus_norvegicus|28009           AAGCTGGAGACAGACCCGGACATCATCATTAGTCGGGCTCGGAATGCTCTGGAAGTTTAC
Cavia_porcellus|4816              AAGTTGGAGACTGACCCCTCCATCATAATTAGTCGTGCTCGGAACGCTTTGGAAGTTTAT
Microcebus_murinus|16043          AAGTTGGAGACTGATCCCTCCATTGTAATTAATCGTGCTCGGAACGCTTTGGAAATTTAT
Tupaia_belangeri|15053            AAGTTGGAGACTGACCCCTCCATCGTAATTAGTCGTGCTCGGAACGCTTTGGAAATTTAC
Tarsius_syrichta|4114             AAGTTGGAGACTGACCCCTCCATCGTAATTAATCGTGCTCGGAACGCTTTGGAAATTTAT
Callithrix_jacchus|42436          AAGTTGGAGACTGACCCCTCCATTGTAATTAATCGAGCTCGGAAGGCTTTGGAAATTTAT
Homo_sapiens|2958                 AAGTTGGAGACTGACCCCGCCATTGTAATTAATCGAGCTCGGAAGGCTTTGGAAATTTAT
Pan_troglodytes|1129              AAGTTGGAGACTGACCCCGCCATTGTAATTAATCGAGCTCGGAAGGCTTTGGAAATTTAT
Gorilla_gorilla|14601             AAGTTGGAGACTGACCCCGCCATTGTAATTAATCGAGCTCGGAAGGCTTTGGAAATTTAT
                                  *** ******* ** **  .*** .*.** *.*** ******** *** *****.**** 

Ochotona_princeps|15985           CGGCATCAAGTGGTGGTGGCTAATATCCTTGAGTCACTACAGTCCTTTGTGGTTATTGTA
Dipodomys_ordii|7941              CAGCATCAAGTGGTGGTGGCTAATATCCTTGAGTCAATACACTCCTCTGTGGTTATTGTA
Spermophilus_tridecemlineatus|111 CAACATCAACTGGTGGTAGCTAATATCCTTGAGTCAATACATTCCTTTGTTATTATTGTT
Oryctolagus_cuniculus|5978        CGGCATCAAGTGGTGGTGGCTAATATCCTTGAGTCACTACAGTCCTTTGTGGTTATTGTA
Mus_musculus|30335                CAGCATCAGGTGGTGGTGGCCAACATCCTGGAGTCAATAAAGTCCTTTGTGATTATTGTA
Rattus_norvegicus|28009           CAGCATCAAGTAGTGGTGGCCAATATCCTGGAGTCAATAAAGTCCTTTGTGATTATTGTA
Cavia_porcellus|4816              CAGCATCAAGTGGTGGTGGCTAATATCCTCGAGTCATTACAGTCTTTTGTAGTTATTATA
Microcebus_murinus|16043          CAACATCAAGTGGTGGTGGCTAATATCCTTGAATCACGACAGTCCTGTGTGGTTATCGTA
Tupaia_belangeri|15053            CAGCATCAAGTGGTGGTGGCTAACATCCTTGAGTCACGACAGTCCTTTGTGGTTATTGTA
Tarsius_syrichta|4114             CATCATCAAGTGGTGGTGGCTAATATCCTTGAGTCACGACAGTCCTTTGTGGTTATTGTA
Callithrix_jacchus|42436          CAGCATCAAGTGGTTGTGGCTAATATCCTTGAGTCACGGCAGTCCTTCGTGTTTATTGTA
Homo_sapiens|2958                 CAGCATCAAGTGGTGGTGGCTAATATCCTTGAGTCACGACAGTCCTTTGTGTTTATTGTA
Pan_troglodytes|1129              CAGCATCAAGTGGTGGTGGCTAATATCCTTGAGTCACGACAGTCCTTTGTGTTTATTGTA
Gorilla_gorilla|14601             CAGCATCAAGTGGTGGTGGCTAATATCCTTGAGTCACGACAGTCCTTTGTGTTTATTGTA
                                  *. *****. *.** **.** ** ***** **.***  ..* ** *  **  **** .*:

Ochotona_princeps|15985           ACCAAAGACTCAGAAACCAAATTGTTGCTATCAGAGGAAGAAGTAGAAAAAGGCATAGCG
Dipodomys_ordii|7941              ACCAAAGACTCGGAAACCAAGTTATTGCTGACAGAGGAAGAGGTAGCAAAAGGCATAGCG
Spermophilus_tridecemlineatus|111 ACCAAAGACTCAGAAACCAAGTTATTGCTATCAGAGGAAGATGTAGAAAAAGGTGTAGAG
Oryctolagus_cuniculus|5978        ACCAAAGACTCGGAAACCAAATTGTTCCTATCAGAGGAAGAAGTAGAAAAAGGCATAGCG
Mus_musculus|30335                ACCAAAGACTCGGAGACAGAGTTACTGCTGTCCGAGGAGGAGGTGGCAAAAGGCTTGGTG
Rattus_norvegicus|28009           ACCAAAGACTCAGAGACAAAGTTACTGCTGTCTGAGGACGAGGTAGCAAGAGGCATGGTG
Cavia_porcellus|4816              ACCAAAGACTCAGAAACCAAGTTACTGCTATCCGAGGAAGAAGTAGAAAAAGGCATGGTG
Microcebus_murinus|16043          ACCAAAGACTCAGAAACCAAGTTATTGCTATCAGAGGAAGAAGTAGGAAAAGGCATAGAG
Tupaia_belangeri|15053            ACCAAAGACTCAGAAACCAAGTTACTGCTTTCAGAGGAAGAAGTAGAAAACGGCATAGAG
Tarsius_syrichta|4114             ACCAAAGACTCGGAAACCAAGTTATTGCTATCAGAGGAAGAAATAGAAAAAGGCATAGAG
Callithrix_jacchus|42436          ACCAAAGATTCGGAAACCAAGTTACTGCTATCAGAGGAAGAAATAGAAAAAGGCATAGAG
Homo_sapiens|2958                 ACCAAAGACTCGGAAACCAAGTTATTGCTATCAGAGGAAGAAATAGAAAAAGGCGTAGAG
Pan_troglodytes|1129              ACCAAAGACTCGGAAACCAAGTTATTGCTATCAGAGGAAGAAATAGAAAAAGGCATAGAG
Gorilla_gorilla|14601             ACCAAAGACTCGGAAACCAAGTTATTGCTATCAGAGGAAGAAATAGAAAAAGGCATAGAG
                                  ******** **.**.**..*.**. * ** :* ***** ** .*.* **..**  *.* *

Ochotona_princeps|15985           ATAGAACAGAAGATAGTGGATAACCTTCAGGCTCGACACACAGCTTTTATAAGTGAGAAA
Dipodomys_ordii|7941              ATAGAAGAGAAAATAGTAGATAATCTTCAATCTCGACACACAGCTTTTATATGTGACAGA
Spermophilus_tridecemlineatus|111 ATAGAAAAGAAGATAGTGGAGAATCTTCAGTCTCGACACAAAGCTTTTATATGTGACAAA
Oryctolagus_cuniculus|5978        ATAGAAGAGAAGATAGTGGATAACCTTCAGGCTCGACACACAGCTTTTTTAAATGACAAA
Mus_musculus|30335                ATAGAAGAGAAGATAGTAGATGACCTTCGGTCTCGACACACAGCTTTTATATGTGACAAA
Rattus_norvegicus|28009           ATAGAAGAGAAGATCGTAGACGACCTTCGGTCTCGACACACAGCGTTTATATGTGACAGA
Cavia_porcellus|4816              ATAGAACAGAAGATAGTGGATGATCTTCAGTCTCGACACACAGCTTTTATATGTGACAAA
Microcebus_murinus|16043          ATAGAAGAGAAGATAGTGGATAATCTTCGATCTCGACACACAGCCTTTATATGTGAAAAA
Tupaia_belangeri|15053            ATAGAAAAGAAGATAGTGGATAATCTTCAATCTCGACACACAGCTTTTATATGTGACAAA
Tarsius_syrichta|4114             ATAGAAGAGAAGATAGTGGATAATCTTCAGTCTCGACACACAGCTTTTATATGTGGCAAA
Callithrix_jacchus|42436          ATAGAAGAGAAGATAGTCGATAATCTTCAGTCTCGACATACAGCTTTTATAGGTGACAAA
Homo_sapiens|2958                 ATAGAAGAGAAGATAGTGGATAATCTTCAGTCTCGACACACAGCTTTTATAGGTGACAGA
Pan_troglodytes|1129              ATAGAAGAGAAGATAGTGGATAATCTTCAGTCTCGACACACAGCTTTTATAGGTGACAAA
Gorilla_gorilla|14601             ATAGAAGAGAAGATAGTGGATAATCTTCAGTCTCGACACACAGCTTTTATAGGTGACAAA
                                  ****** ****.**.** ** .* ****.. ******* *.*** ***:** .**. *.*

Ochotona_princeps|15985           AACTGA
Dipodomys_ordii|7941              AATTGA
Spermophilus_tridecemlineatus|111 AACTGA
Oryctolagus_cuniculus|5978        AACTGA
Mus_musculus|30335                AACTGA
Rattus_norvegicus|28009           AACTGA
Cavia_porcellus|4816              AACTGA
Microcebus_murinus|16043          AACTGA
Tupaia_belangeri|15053            AACTGA
Tarsius_syrichta|4114             AACTGA
Callithrix_jacchus|42436          AACTGA
Homo_sapiens|2958                 AACTGA
Pan_troglodytes|1129              AACTGA
Gorilla_gorilla|14601             AACTGA
                                  ** ***

multiple sequence alignment in CLUSTALW format


Ochotona_princeps|13932          ----------MAERDLAAEFPRPAGAARWAEVMARFAARLGAQGRRVVLVTSGGTKVPLE
Dipodomys_ordii|7460             ----------MAEVDLVAEFPRPAGAARWAEVMAGFAARLGAQGRRVVLVTSGGTKVPLE
Spermophilus_tridecemlineatus|97 ----------REEMDIVSEFPQPSGAARSAEVIARFAARLGAQGRRWSFVTSGGTKVPLE
Oryctolagus_cuniculus|13578      ----------MAERDLVAEFPRPAGAARWAEVMARFAARLGAQGRRVVLVTSGGTKVPLE
Mus_musculus|2568                ----------MAEMDLVAELPRPAGAARWAEVMARFAARLGEQGRRVVLITSGGTKVPLE
Rattus_norvegicus|13110          ----------MAEMDLVAELPRPEGAARWAEVMARFAARLGEQGRRVVLVTSGGTKVPLE
Cavia_porcellus|3750             ----------MAEMDLGAEFPRPAGAARWAEVMARFAARLGEQGRRVVLVTSGGTKVPLE
Microcebus_murinus|13616         ----------MAEMDLVAEFPRPAGAARWAEVMARFAARLGAQGRRVVLVTSGGTKVPLE
Tupaia_belangeri|13085           ----------MAEKDLVAEFPQPAGAAR-AEVMARFAAGLGAQGRRVVLVTSGGTKVPLE
Tarsius_syrichta|3770            ----------MAEMDLVAEFPQPPGVARWAEVMARFAAGLGAQGRRVVLVTSGGTKVPLE
Callithrix_jacchus|33817         ----------IAEMDLVAEFPQPPGAARWAEVMARFAARLGAQGRRVVLVTSGGTKVPLE
Homo_sapiens|34339               ------------------------------------------------------------
Pan_troglodytes|28457            ----------MAEMDPVAEFPQPPGAARWAEVMARFAARLGAQGRRVVLVTSGGTKVPLE
Gorilla_gorilla|11855            RAQAPAAAVQMAEMDPVAEFPQPPGAARWAEVMARFAARLGAQGRRVVLVTSGGTKVPLE
                                                                                             

Ochotona_princeps|13932          ARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPFAHRFPPQTWLSALRPSGP
Dipodomys_ordii|7460             ARPVRFLDNFSSGRRGAMSVEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLAALRPAGP
Spermophilus_tridecemlineatus|97 ARPVRFLDNFSSGRRGAISAEAFLAAGYGVLFLYRARSCFPFAHRFPPQTWLSALRPSGP
Oryctolagus_cuniculus|13578      ARPVRFLDNFSSG--GAVHSRGF-AAGYGVLFLYPA-PALPFAHRFPPQTWLAALRPSGP
Mus_musculus|2568                ARAVRFLDNFSSGRRGAASAEVFLAAGYGVLFLYRARSAFPYAHRFPPQAWLSALRPSGP
Rattus_norvegicus|13110          ARAVRFLDNFSSGRRGAASAEVFLAAGYGVLFLYRARSAFPYAHRFPPQAWLSALRPSGP
Cavia_porcellus|3750             ARPVRFLDNFSSGRRGAASAEAFLAAGYGVLFLYRARSAFPYAHRFPPQSWLSALRPSGP
Microcebus_murinus|13616         ARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPFAHRFPPQTWLSALRPSGP
Tupaia_belangeri|13085           ARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPFAHRFPPQTWLSALRPSGP
Tarsius_syrichta|3770            ARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLSALRPSGP
Callithrix_jacchus|33817         ARPVRFLDNFSSGRRGAASAEAFLATGYGVLFLYRARSAFPYAHRFPPQTWLSALRPSGP
Homo_sapiens|34339               ------------------------------------------------------------
Pan_troglodytes|28457            ARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLSALRPSGP
Gorilla_gorilla|11855            ARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLSALRPSGP
                                                                                             

Ochotona_princeps|13932          AHSGLLSLEAEEKALPGFAAALQSYQEAEAAGTFLAVEFTTLADYLHLLQAAAQGLNPLX
Dipodomys_ordii|7460             PQAGLLSLEAEEKALPGFAAALRSYQEAATAGTFLAVEFTTLADYLHLLQAAAQALNPLG
Spermophilus_tridecemlineatus|97 AKSGVLSLEAEENALPGFAAALRSYQEAAAAGTFLAVEFSTLADYLHLLKAAAQALSPLG
Oryctolagus_cuniculus|13578      AHSGLLSLEAEENALPGFAAALQSYQEAAAAGTFLAVEFTTLADYLHLLQAAAQALNPLG
Mus_musculus|2568                AQSGKLSLEAEENALPGFAAALQSYQEAAAAGTFLAVEFTTLADYLHLLQAAALALSPLG
Rattus_norvegicus|13110          AQSGKLSLEAEENALPGFAAALQGYQEAAAAGTFLAVEFTTLADYLHLLQAAALALNPLG
Cavia_porcellus|3750             AQSGMLSLEAEENALPGFAEALRSYQEAAAAGTFLAVEFTTLADYLHLLQAAAQALNPLG
Microcebus_murinus|13616         AHSGLLSLEAEENALPGFAAALRSYQEAVAAGTFMAVEFTTLADYLHLLQAAAQALNPLG
Tupaia_belangeri|13085           ASSGVLSLEAEENALPGFAAALRSYQEAAAAGTFLAVEFTTLADYLHLLQAAAQALNPLG
Tarsius_syrichta|3770            AHKGLLSLEAEENALPGFATALRSYQEAAAAGTFLAVEFTTLADYLHLLQAAAQALNPLG
Callithrix_jacchus|33817         AHSGLLSLEAEENALPGFAEGLRSYQEAAAAGTFLAVEFTTLADYLHLLQAAAQALNPLG
Homo_sapiens|34339               ------------------------------------------------------------
Pan_troglodytes|28457            ALSGLLSLEA--------------------------------------------------
Gorilla_gorilla|11855            ALSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLVVEFTTLADYLHLLQAAAQALNPLG
                                                                                             

Ochotona_princeps|13932          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITMKMVPKMLSPLVKDWAPKAFIISF
Dipodomys_ordii|7460             PSAMFY-AAAVSDFYVPVSEMPEHKIQSSGXXXXITMKMVPKMLSPLVKDWAPKAFIISF
Spermophilus_tridecemlineatus|97 PSAMFYLAAAVSDFYVPVSEMPEHKIQSSGGPLQITMKMVPKMLYPLVKDWAPKAFIISF
Oryctolagus_cuniculus|13578      SSAMFYLAAAVSDFYVPVSEMPEHKIQSSAGALQITMKMVPKMLSPLVKDWAPKAFIISF
Mus_musculus|2568                SSAMFYLAAAVSDFYIPVSEMPEHKIHSSGGPLQITMKMVPKMLSPLVKDWAPKAFVVSF
Rattus_norvegicus|13110          SSAMFYLAAAVSDFYIPVSEMPEHKIHSSGGPLQITMKMVPKMLSPLVKDWAPKAFIVSF
Cavia_porcellus|3750             PSAMFYLAAAVSDFYVPVSEMPEHKIQSSGGPLQITMKMVPKMLSPLVKDWAPKAFIISF
Microcebus_murinus|13616         STAMFYLAAAVSDFYVPVSEMPEHKIQSSGGLLQITMKMVPKMLSPLVKDWAPKAFIISF
Tupaia_belangeri|13085           PSAMFYLAAAVSDFYVPVSEMPEHKIQSSGGPLQITMKMVPKMLSPLVKDWAPKAFIISF
Tarsius_syrichta|3770            PSAMFYLAAAVSDFYVPVSEMPEHKIQSSGGPLQITMKMVPKMLSPLVKDWAPKAFIISF
Callithrix_jacchus|33817         PSAMFYLAAAVSDFYVPVSEMPEHKIQSSGGPLQITMKMVPKMLSPLVKDWAPKAFIISF
Homo_sapiens|34339               ---MFYLAAAVSDFYVPVSEMPEHKIQSSGGPLQITMKMVPKLLSPLVKDWAPKAFIISF
Pan_troglodytes|28457            -----------SDFYVPVSEMPEHKIQSSGAPLQITMKMVPKLLSPLVKDWAPKAFIISF
Gorilla_gorilla|11855            PSAMFYLAAAVSDFYVPVSEMPEHKIQSSGGPLQITMKMVPKLLSPLVKDWAPKAFIISF
                                                                   ********:* ***********::**

Ochotona_princeps|13932          KLETDPSIVINRARNALEVYRHQVVVANILESLQSFVVIVTKDSETKLLLSEEEVEKGIA
Dipodomys_ordii|7460             KLETDPSIIINRARNALEVYQHQVVVANILESIHSSVVIVTKDSETKLLLTEEEVAKGIA
Spermophilus_tridecemlineatus|97 KLETDPSIIINRARNALEVYQHQLVVANILESIHSFVIIVTKDSETKLLLSEEDVEKGVE
Oryctolagus_cuniculus|13578      KLETDPSIVINRARNALEVYRHQVVVANILESLQSFVVIVTKDSETKLFLSEEEVEKGIA
Mus_musculus|2568                KLETDPDIIISRARNALEVYQHQVVVANILESIKSFVIIVTKDSETELLLSEEEVAKGLV
Rattus_norvegicus|13110          KLETDPDIIISRARNALEVYQHQVVVANILESIKSFVIIVTKDSETKLLLSEDEVARGMV
Cavia_porcellus|3750             KLETDPSIIISRARNALEVYQHQVVVANILESLQSFVVIITKDSETKLLLSEEEVEKGMV
Microcebus_murinus|13616         KLETDPSIVINRARNALEIYQHQVVVANILESRQSCVVIVTKDSETKLLLSEEEVGKGIE
Tupaia_belangeri|13085           KLETDPSIVISRARNALEIYQHQVVVANILESRQSFVVIVTKDSETKLLLSEEEVENGIE
Tarsius_syrichta|3770            KLETDPSIVINRARNALEIYHHQVVVANILESRQSFVVIVTKDSETKLLLSEEEIEKGIE
Callithrix_jacchus|33817         KLETDPSIVINRARKALEIYQHQVVVANILESRQSFVFIVTKDSETKLLLSEEEIEKGIE
Homo_sapiens|34339               KLETDPAIVINRARKALEIYQHQVVVANILESRQSFVFIVTKDSETKLLLSEEEIEKGVE
Pan_troglodytes|28457            KLETDPAIVINRARKALEIYQHQVVVANILESRQSFVFIVTKDSETKLLLSEEEIEKGIE
Gorilla_gorilla|11855            KLETDPAIVINRARKALEIYQHQVVVANILESRQSFVFIVTKDSETKLLLSEEEIEKGIE
                                 ****** *:*.***:***:*:**:******** :* *.*:******:*:*:*::: .*: 

Ochotona_princeps|13932          IEQKIVDNLQARHTAFISEKN
Dipodomys_ordii|7460             IEEKIVDNLQSRHTAFICDRN
Spermophilus_tridecemlineatus|97 IEKKIVENLQSRHKAFICDKN
Oryctolagus_cuniculus|13578      IEEKIVDNLQARHTAFLNDKN
Mus_musculus|2568                IEEKIVDDLRSRHTAFICDKN
Rattus_norvegicus|13110          IEEKIVDDLRSRHTAFICDRN
Cavia_porcellus|3750             IEQKIVDDLQSRHTAFICDKN
Microcebus_murinus|13616         IEEKIVDNLRSRHTAFICEKN
Tupaia_belangeri|13085           IEKKIVDNLQSRHTAFICDKN
Tarsius_syrichta|3770            IEEKIVDNLQSRHTAFICGKN
Callithrix_jacchus|33817         IEEKIVDNLQSRHTAFIGDKN
Homo_sapiens|34339               IEEKIVDNLQSRHTAFIGDRN
Pan_troglodytes|28457            IEEKIVDNLQSRHTAFIGDKN
Gorilla_gorilla|11855            IEEKIVDNLQSRHTAFIGDKN
                                 **:***::*::**.**:  :*