Orthologs Set ID: EOG4003HV


Orthology Database
OrthoDB4
Gene Symbol(s)
C16orf72

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 22610 226, 307, 583
Cavia porcellus 15665 226, 307, 583
Dipodomys ordii 3908 226, 307, 583
Gorilla gorilla 8058 226, 307, 583
Homo sapiens 30793 226, 307, 583
Mus musculus 14985 226, 307, 583
Ochotona princeps 8337 6, 51, 63, 72, 226, 307, 583
Oryctolagus cuniculus 16602 307, 583
Otolemur garnettii 4046 307, 583
Pan troglodytes 13928 132, 159, 226, 307, 583
Rattus norvegicus 4904 226, 307, 583
Spermophilus tridecemlineatus 9323 18, 81, 201, 307, 583, 656, 710
Tupaia belangeri 5737 307, 583

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 22610 ENSCJAT00000033405 100411218 ENSCJAG00000017187 C12H16orf72 calJac3
Cavia porcellus 15665 ENSCPOT00000011026 100724977 ENSCPOG00000010925 C16orf72 cavPor3
Dipodomys ordii 3908 ENSDORT00000012236 ENSDORG00000012236 1810013L24Rik dipOrd1
Gorilla gorilla 8058 ENSGGOT00000010782 101153472 ENSGGOG00000010744 C16H16orf72 gorGor3
Homo sapiens 30793 ENST00000327827 29035 ENSG00000182831 C16orf72 hg19,GRCh37
Mus musculus 14985 ENSMUST00000023150 69053 ENSMUSG00000022507 1810013L24Rik mm9
Ochotona princeps 8337 ENSOPRT00000007447 101527307 ENSOPRG00000007452 C16orf72 OchPri2.0
Oryctolagus cuniculus 16602 ENSOCUT00000015523 ENSOCUG00000015528 C16orf72 oryCun2.0
Otolemur garnettii 4046 ENSOGAT00000003911 ENSOGAG00000003909 C16orf72 otoGar1
Pan troglodytes 13928 ENSPTRT00000014286 735908 ENSPTRG00000007751 C16H16orf72 panTro2
Rattus norvegicus 4904 ENSRNOT00000003439, NM_001106972 302913 ENSRNOG00000002545 RGD1309748 rn4
Spermophilus tridecemlineatus 9323 ENSSTOT00000009324 ENSSTOG00000009324 C16orf72 speTri1
Tupaia belangeri 5737 ENSTBET00000005738 ENSTBEG00000005757 C16orf72 tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 14907 ENSCJAP00000031601 100411218 ENSCJAG00000017187 C12H16orf72 calJac3
Cavia porcellus 12314 ENSCPOP00000009816 100724977 ENSCPOG00000010925 C16orf72 cavPor3
Dipodomys ordii 3658 ENSDORP00000011505 ENSDORG00000012236 1810013L24Rik dipOrd1
Gorilla gorilla 7029 ENSGGOP00000010474 101153472 ENSGGOG00000010744 C16H16orf72 gorGor3
Homo sapiens 15775 ENSP00000331720 29035 ENSG00000182831 C16orf72 hg19,GRCh37
Mus musculus 49517 ENSMUSP00000023150 69053 ENSMUSG00000022507 1810013L24Rik mm9
Ochotona princeps 7264 ENSOPRP00000006821 101527307 ENSOPRG00000007452 C16orf72 OchPri2.0
Oryctolagus cuniculus 8442 ENSOCUP00000013338 ENSOCUG00000015528 C16orf72 oryCun2.0
Otolemur garnettii 3478 ENSOGAP00000003478 ENSOGAG00000003909 C16orf72 otoGar1
Pan troglodytes 5081 ENSPTRP00000013239 735908 ENSPTRG00000007751 C16H16orf72 panTro2
Rattus norvegicus 12715 ENSRNOP00000003439 302913 ENSRNOG00000002545 RGD1309748 rn4
Spermophilus tridecemlineatus 8368 ENSSTOP00000008367 ENSSTOG00000009324 C16orf72 speTri1
Tupaia belangeri 4959 ENSTBEP00000004942 ENSTBEG00000005757 C16orf72 tupBel1

multiple sequence alignment in CLUSTALW format


Dipodomys_ordii|3908               ATGGAGGAGCGGAAGGAGGAGGGCGAGGCCGAGATCCAGGAGCACGGGCCCGAGCACTGG
Spermophilus_tridecemlineatus|9323 ATGAAGGAGCAGAGGGAG---GGCGAGGCAGAG------------AGCCCCGTGCACTGG
Mus_musculus|14985                 ATGGAGGAGCGGAAGGAGGAGGGCGAGGCGGAGATCCAGGAGCACGGGCCGGAGCATTGG
Rattus_norvegicus|4904             ATGGAGGAGCGAAAGGAGGAGGGCGAGGCGGAGATCCAGGAGCACGGGCCGGAGCACTGG
Cavia_porcellus|15665              ------------------------------------------------------------
Ochotona_princeps|8337             ATGGAGCAAAGGATGGAACAC---------GAGACCCCAAACCAGGAGCCCGTGTCCGTG
Pan_troglodytes|13928              ATGGAGGAGCGGAAGGAGGAGGGCGAGGCTGAGATCCAGGAGCACGGGCCCGAGCACTGG
Oryctolagus_cuniculus|16602        ------------------------------------------------------------
Otolemur_garnettii|4046            ------------------------------------------------------------
Tupaia_belangeri|5737              ------------------------------------------------------------
Callithrix_jacchus|22610           ATGGAGGAGCGGAAGGAGGAGGGCGAGGCCGAGATCCAAGAGCACGGGCCCGAGCACTGG
Gorilla_gorilla|8058               ATGGAGGAGCGGAAGGAGGAGGGCGAGGCCGAGATCCAGGAGCACGGGCCCGAGCACTGG
Homo_sapiens|30793                 ATGGAGGAGCGGAAGGAGGAGGGCGAGGCCGAGATCCAGGAGCACGGGCCCGAGCACTGG
                                                                                               

Dipodomys_ordii|3908               TTCTCCAAGTGGGAGCGGCAGTGCCTGGCCGAGGCGGAGCAGGACGAGCAGCTGCCCCCC
Spermophilus_tridecemlineatus|9323 TTCTCCAAGTGGGAG---CAGTGCTTGGCCCTGGCCCAGGAGGGCGAGCAACTTTCCCCT
Mus_musculus|14985                 TTCTCCAAGTGGGAGCGGCAGTGCCTGGCCGAGGCCGAGCAGGACGAGCAGTTGTCTCCC
Rattus_norvegicus|4904             TTCTCCAAGTGGGAGCGGCAGTGCCTAGCGGAGGCCGAGCAGGACGAGCAGCTGTCCCCC
Cavia_porcellus|15665              ------------------------------------------------------------
Ochotona_princeps|8337             CCTGTTTCAAAGATGCGGCAGTGCCTTGCCGAAGCCGAGCAGGACGAGCAGCTGTTCCCG
Pan_troglodytes|13928              TTCTCCAAGTGGGAGCGGCAGTGCCTGGCCGAGGCCGATCAGGACGAGCAGCTGCCCCCC
Oryctolagus_cuniculus|16602        ------------------------------------------------------------
Otolemur_garnettii|4046            ------------------------------------------------------------
Tupaia_belangeri|5737              ------------------------------------------------------------
Callithrix_jacchus|22610           TTCTCCAAGTGGGAGCGGCAGTGCCTGGCCGAGGCCGAGCAGGACGAGCAGCTGCCACCC
Gorilla_gorilla|8058               TTCTCCAAGTGGGAGCGGCAGTGCCTGGCCGAGGCCGAACAGGACGAGCAGCTGCCCCCC
Homo_sapiens|30793                 TTCTCCAAGTGGGAGCGGCAGTGCCTGGCCGAGGCCGAACAGGACGAGCAGCTGCCCCCC
                                                                                               

Dipodomys_ordii|3908               GAGCTGCAGGAGGAGGCGGCGGCCGCCGCGCAGCCCGAGCACAAGCAGCAGAAGCTGTGG
Spermophilus_tridecemlineatus|9323 GAGCCGCAGGAGGCGGCAGCGGCCGCCCTGCAGCCTGAGCACAAGCAGCACAAGTTGTGG
Mus_musculus|14985                 GAGCTGCAGGAGGAGGCGGCGGCCGCCGCGCAGCCCGAGCACAAGCAACAGAAGCTGTGG
Rattus_norvegicus|4904             GAGCTGCAGGAGGAGGCGGCGGCCGCCGCGCAGCCCGAACACAAGCAGCAGAAGCTGTGG
Cavia_porcellus|15665              ------------------------------------------------------------
Ochotona_princeps|8337             GAGCTGCAGGAGGAGGCGGCGGCGGCCGCGCACCCCGAGCACAAGCAGCAGAAGCTGTGG
Pan_troglodytes|13928              ---------GAGGAGGCGGCGGCCGCCGCGCACCCCGAG---AAGCAGCAGAAGCTGTGG
Oryctolagus_cuniculus|16602        ------------------------------------------------------------
Otolemur_garnettii|4046            ------------------------------------------------------------
Tupaia_belangeri|5737              ------------------------------------------------------------
Callithrix_jacchus|22610           GAGCTGCAGGAGGAGGCAGCGGCCGCCGCGCAGCCCGAACACAAGCAGCAGAAGCTGTGG
Gorilla_gorilla|8058               GAGCTGCAGGAGGAGGCGGCGGCCGCCGCGCAGCCCGAGCACAAGCAGCAGAAGCTGTGG
Homo_sapiens|30793                 GAGCTGCAGGAGGAGGCGGCGGCCGCCGCGCAGCCCGAGCACAAGCAGCAGAAGCTGTGG
                                                                                               

Dipodomys_ordii|3908               CACCTCTTCCAGAACTCGGCCACCGCCGTGGCCCAGCTCTACAAAGNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|9323 CACCTCTTCCAGAACTCGGCC---------------------------CGAGTGTGTCAG
Mus_musculus|14985                 CATCTCTTCCAGAACTCGGCCACGGCCGTGGCTCAGCTCTACAAAGACCGAGTGTGTCAG
Rattus_norvegicus|4904             CATCTCTTCCAGAACTCGGCCACGGCAGTGGCTCAGCTCTACAAAGATCGAGTATGTCAG
Cavia_porcellus|15665              ------TTCCAGAACTCGGCTACCGCCGTGGCCCAGCTCTACAAAGACCGAGTATGTCAG
Ochotona_princeps|8337             CACCTCTTCCAGAACTCGGCCACCGCCGTGGCCCAGCTCTACAAAGACCGTGTGTGTCAG
Pan_troglodytes|13928              CACCTCTTCCAGAACTCCGCCACCGGCGTGGGCCAGCTCTACAAAGACCGAGTGTGTCAG
Oryctolagus_cuniculus|16602        ---------------------------------------------GACCGAGTGTGTCAG
Otolemur_garnettii|4046            ------------------------------------------------CGAGTGTGTCAG
Tupaia_belangeri|5737              ------------------------------------------------CGAGTGTGTCAG
Callithrix_jacchus|22610           CACCTCTTCCAGAACTCGGCCACCGCCGTCGCTCAGCTCTACAAAGACCGAGTGTGTCAG
Gorilla_gorilla|8058               CACCTCTTCCAGAACTCGGCCACCGCCGTGGCCCAGCTCTACAAAGACCGAGTGTGTCAG
Homo_sapiens|30793                 CACCTCTTCCAGAACTCGGCCACCGCCGTGGCCCAGCTCTACAAAGACCGAGTGTGTCAG
                                                                                    . .. ...  .

Dipodomys_ordii|3908               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|9323 CAGCCAGCACTTTCTCTCTGGGTCCCCTTCCAAAACGCAAGCGCCGCCCTCACCAAACTC
Mus_musculus|14985                 CAGCCAGGACTTTCTCTCTGGGTCCCCTTCCAAAACGCAGCCACCGCCGTCACCAACCTC
Rattus_norvegicus|4904             CAGCCAGGACTTTCTCTCTGGGTCCCTTTCCAAAACGCAGCCACCGCAGTCACCAACCTC
Cavia_porcellus|15665              CAGCCAGGACTTTCTCTTTGGGTTCCCTTCCAAAACGCAGCCACTGCTGTCACCAATCTC
Ochotona_princeps|8337             CAGCCAGGACTTTCTCTCTGGGTTCCCTTCCAAAACGCAGCCACCGCGGTGACCAATCTC
Pan_troglodytes|13928              CAGCCAGGACTTTCTCTCTGGGTCCCCTTCCAAAACGCAGCCACCGCCGTCACCAACCTC
Oryctolagus_cuniculus|16602        CAGCCAGGACTTTCTCTCTGGGTCCCCTTCCAAAACGCAGCCACCGCGGTGACCAACCTC
Otolemur_garnettii|4046            CAGCCAGGACTGTCTCTCTGGGTCCCCTTCCAAAATGCAGCCACCGCCGTCACCAATCTC
Tupaia_belangeri|5737              CAGCCAGGCCTTTCTCTCTGGGTCCCGTTCCAAAACGCAGCCACCGCCGTCACCAACCTC
Callithrix_jacchus|22610           CAGCCAGGACTTTCTCTCTGGGTCCCCTTCCAAAACGCAGCCACCGCCGTCACCAACCTC
Gorilla_gorilla|8058               CAGCCAGGACTTTCTCTCTGGGTCCCCTTCCAAAACGCAGCCACCGCCGTCACCAACCTC
Homo_sapiens|30793                 CAGCCAGGACTTTCTCTCTGGGTCCCCTTCCAAAACGCAGCCACCGCCGTCACCAATCTC
                                     .   .   . . . . .....    ..       .        .   .        . 

Dipodomys_ordii|3908               NNNNNNNAAAGCGTGGATACCCATCAGCGAAGTTTTGATATTGGAATTCAGATTGGCTAT
Spermophilus_tridecemlineatus|9323 TACAAAGAAAGTGTGGATACCCATCAGCGAAGTTTTGATATTGGAATTCAGATTGGCTAT
Mus_musculus|14985                 TATAAAGAAAGTGTGGATACCCATCAGCGAAGTTTTGATATTGGAATTCAGATTGGCTAT
Rattus_norvegicus|4904             TATAAAGAAAGTGTGGATACCCATCAGCGAAGTTTTGATATTGGAATTCAGATTGGCTAT
Cavia_porcellus|15665              TACAAAGAAAGCGTGGATACCCATCAGCGAAGTTTTGATATTGGAATTCAGATTGGCTAT
Ochotona_princeps|8337             TACAAAGAGAGCGTGGATACCCATCAACGAAGTTTTGATATTGGAATTCAGATTGGCTAT
Pan_troglodytes|13928              TACAAAGAAAGCGTGGATACCCATCAACGAAGTTTTGATATTGGAATTCAGATTGGCTAT
Oryctolagus_cuniculus|16602        TACAAAGAAAGCGTGGATACCCATCAGCGAAGTTTTGATATTGGAATTCAGATTGGCTAT
Otolemur_garnettii|4046            TACAAAGAAAGCGTGGATACCCATCAGCGAAGTTTTGATATTGGAATTCAGATTGGCTAT
Tupaia_belangeri|5737              TACAAAGAAAGCGTGGATACCCATCAGCGAAGTTTTGATATTGGAATTCAGATTGGCTAT
Callithrix_jacchus|22610           TACAAAGAAAGCGTGGATACCCATCAACGAAGTTTTGATATTGGAATTCAGATTGGCTAT
Gorilla_gorilla|8058               TACAAAGAAAGCGTGGATACCCATCAACGAAGTTTTGATATTGGAATTCAGATTGGCTAT
Homo_sapiens|30793                 TACAAAGAAAGCGTGGATACCCATCAACGAAGTTTTGATATTGGAATTCAGATTGGCTAT
                                   .     .*.** **************.*********************************

Dipodomys_ordii|3908               CAGCGACGCAATAAGGATGTGTTGGCTTGGGTTAAAAAACGCAGAAGAACTATTCGTAGA
Spermophilus_tridecemlineatus|9323 CAGCGACGCAATAAGGATGTGCTGGCTTGGGTTAAAAAACGCAGAAGAACTATTCGTAGA
Mus_musculus|14985                 CAGCGACGCAATAAGGATGTGCTGGCCTGGGTAAAAAAGCGCAGAAGAACTATTCGTAGA
Rattus_norvegicus|4904             CAGCGACGAAATAAGGATGTGCTGGCCTGGGTTAAAAAGCGCAGAAGAACTATTCGTAGA
Cavia_porcellus|15665              CAGCGACGCAATAAGGATGTGTTGGCTTGGGTTAAAAAACGCAGAAGAACTATTCGCAGA
Ochotona_princeps|8337             CAGCGACGCAATAAGGATGTGTTGGCTTGGGTCAAAAAACGCAGAAGAACTATTCGCAGA
Pan_troglodytes|13928              CAGCGACGCAATAAGGATGTGTTGGCTTGGGTTAAAAAACGCAGAAGAACTATTCGTCGA
Oryctolagus_cuniculus|16602        CAGCGACGCAATAAGGATGTGTTGGCTTGGGTTAAAAAACGCAGAAGAACTATTCGTAGA
Otolemur_garnettii|4046            CAGCGACGCAATAAGGATGTGTTGGCTTGGGTTAAAAAACGCAGAAGAACTATTCGTAGA
Tupaia_belangeri|5737              CAGCGGCGCAATAAGGATGTGTTGGCTTGGGTTAAAAAACGCAGAAGAACTATTCGTAGA
Callithrix_jacchus|22610           CAGCGACGCAATAAGGATGTGTTGGCTTGGGTTAAAAAACGCAGAAGAACTATTCGTAGA
Gorilla_gorilla|8058               CAGCGACGCAATAAGGATGTGTTGGCTTGGGTTAAAAAACGCAGAAGAACTATTCGTCGA
Homo_sapiens|30793                 CAGCGACGCAATAAGGATGTGTTGGCTTGGGTTAAAAAACGCAGAAGAACTATTCGTCGA
                                   *****.**.************ **** ***** *****.***************** .**

Dipodomys_ordii|3908               GAAGATTTGATCAGCTTCCTGTGTGGAAAGGTTCCTCCACCACGAAACTCTAGAGCTCCC
Spermophilus_tridecemlineatus|9323 GAAGATTTGATCAGCTTCCTGTGTGGAAAGGTTCCTCCACCACGAAACTCTAGAGCTCCC
Mus_musculus|14985                 GAAGATTTGATCAGCTTCCTGTGTGGAAAGGTTCCTCCACCACGAAACTCTAGAGCTCCC
Rattus_norvegicus|4904             GAAGATTTGATCAGCTTCCTATGTGGAAAGGTTCCTCCACCACGAAACTCTAGAGCTCCC
Cavia_porcellus|15665              GAAGATTTGATCAGCTTCCTGTGTGGAAAGGTTCCTCCACCACGAAACTCTAGAGCTCCC
Ochotona_princeps|8337             GAAGATCTGATCAGCTTCCTGTGTGGCAAGGTTCCTCCACCACGCAATTCTAGAGCTCCC
Pan_troglodytes|13928              GAAGATTTGATCAGCTTCCTGTGTGGAAAAGTTCCTCCACCACGAAACTCTAGAGCTCCC
Oryctolagus_cuniculus|16602        GAAGATTTGATCAGCTTCCTGTGTGGAAAGGTTCCTCCACCACGAAACTCTAGAGCTCCC
Otolemur_garnettii|4046            GAAGATTTGATCAGCTTCCTGTGTGGAAAAGTTCCTCCACCACGAAACTCTAGAGCTCCC
Tupaia_belangeri|5737              GAAGATTTGATCAGCTTCCTGTGTGGAAAAGTTCCTCCACCACGAAACTCTAGAGCTCCC
Callithrix_jacchus|22610           GAAGATTTGATCAGCTTCCTGTGTGGAAAAGTTCCTCCACCACGAAACTCTAGAGCTCCC
Gorilla_gorilla|8058               GAAGATTTGATCAGCTTCCTGTGTGGAAAAGTTCCTCCACCACGAAACTCTAGAGCTCCC
Homo_sapiens|30793                 GAAGATTTGATCAGCTTCCTGTGTGGAAAAGTTCCTCCACCACGAAACTCTAGAGCTCCC
                                   ****** *************.*****.**.**************.** ************

Dipodomys_ordii|3908               CCAAGACTGACTGTAGTGTCCCCTAACCGAGCTACTTCAACGGAAACTAGCTCATCTGTA
Spermophilus_tridecemlineatus|9323 CCAAGACTGACTGTAGTGTCCCCTAACCGAGCTACTTCAACGGAAACTAGCTCATCTGTA
Mus_musculus|14985                 CCAAGACTGACTGTAGTGTCCCCTAACCGAGCTACTTCAACGGAAACTAGCTCATCTGTA
Rattus_norvegicus|4904             CCAAGACTGACTGTAGTGTCCCCTAACAGAGCTACTTCAACGGAAACTAGCTCATCTGTA
Cavia_porcellus|15665              CCAAGACTGACTGTAGTGTCCCCTAACAGAGCTACTTCAGCGGAAACTAGCTCCTCTGTA
Ochotona_princeps|8337             CCACGATTGACTGTAGTGTCCCCTAACCGAGCTACTTCAACGGAAACTAGCTCATCTGTA
Pan_troglodytes|13928              CCAAGACTGACTGTAGTGTCCCCTAACCGAGCTACTTCAACGGAAACTAGCTCATCTGTA
Oryctolagus_cuniculus|16602        CCAAGACTGACTGTAGTGTCCCCTAACCGAGCTACTTCAACGGAAACTAGCTCATCTGTA
Otolemur_garnettii|4046            CCAAGACTGACTGTAGTGTCCCCTAACCGAGCTACTTCAACGGAAACTAGCTCATCTGTA
Tupaia_belangeri|5737              CCAAGACTGACTGTAGTGTCCCCTAACCGAGCTACTTCAACGGAAACTAGCTCATCTGTA
Callithrix_jacchus|22610           CCAAGACTGACTGTAGTGTCCCCTAACCGAGCTACTTCAACGGAAACTAGCTCATCTGTA
Gorilla_gorilla|8058               CCAAGACTGACTGTAGTGTCCCCTAACCGAGCTACTTCAACGGAAACTAGCTCATCTGTA
Homo_sapiens|30793                 CCAAGACTGACTGTAGTGTCCCCTAACCGAGCTACTTCAACGGAAACTAGCTCATCTGTA
                                   ***.** ********************.***********.*************.******

Dipodomys_ordii|3908               GAGACTGATTTGCAACCCTTCCGGGAAGCCATAGCCCTGCATGGTCTTAGTGGTGCAATG
Spermophilus_tridecemlineatus|9323 GAGACTGATTTGCAACCCTTCCGGGAAGCCATAGCTCTGCATGGTCTTAGTGGTGCAATG
Mus_musculus|14985                 GAGACTGATTTGCAACCCTTCCGGGAAGCCATAGCTCTGCATGGTCTTAGTGGTGCAATG
Rattus_norvegicus|4904             GAGACTGATTTGCAACCCTTCCGGGAAGCCATAGCTCTGCATGGTCTTAGTGGTGCAATG
Cavia_porcellus|15665              GAGACTGATTTGCAACCCTTCCGGGAAGCCATAGCTCTGCATGGTCTTAGTGGTGCAATG
Ochotona_princeps|8337             GAGACTGATTTGCAGCCCTTCCGGGAAGCCATAGCTCTGCATGGTCTTAGTGGTGCAATG
Pan_troglodytes|13928              GAGACTGATTTGCAACCCTTCCGGGAAGCCATAGCTCTGCATGGTCTTAGTGGTGCAATG
Oryctolagus_cuniculus|16602        GAGACTGATTTGCAACCCTTCCGGGAAGCCATAGCTCTGCATGGTCTTAGTGGTGCAATG
Otolemur_garnettii|4046            GAGACTGATTTGCAACCCTTCCGGGAAGCCATAGCTCTGCATGGTCTTAGTGGTGCAATG
Tupaia_belangeri|5737              GAGACTGATTTGCAACCCTTCCGGGAAGCCATAGCTCTGCATGGTCTTAGTGGTGCAATG
Callithrix_jacchus|22610           GAGACTGATTTGCAACCCTTCCGGGAAGCCATAGCTCTGCATGGTCTTAGTGGTGCAATG
Gorilla_gorilla|8058               GAGACTGATTTGCAACCCTTCCGGGAAGCCATAGCTCTGCATGGTCTTAGTGGTGCAATG
Homo_sapiens|30793                 GAGACTGATTTGCAACCCTTCCGGGAAGCCATAGCTCTGCATGGTCTTAGTGGTGCAATG
                                   **************.******************** ************************

Dipodomys_ordii|3908               GCTAGTATAAGCGTGCGTTCGAGTACCCCAGGCTCTCCTACACATGTAAGCAGTGGATCG
Spermophilus_tridecemlineatus|9323 GCTAGTATAAGCGTGCGTTCGAGTACCCCAGGCTCTCCTACACATGTAAGCAGTGGATCG
Mus_musculus|14985                 GCTAGTATAAGCGTGCGTTCGAGTACCCCAGGCTCTCCTACACATGTAAGCAGTGGACCG
Rattus_norvegicus|4904             GCTAGTATAAGCGTGCGTTCGAGTACCCCAGGCTCTCCTACACATGTAAGCAGTGGACCG
Cavia_porcellus|15665              GCTAGTATAAGCGTGCGTTCGAGTACCCCAGGCTCTCCTACACATGTAAGCAGTGGATCG
Ochotona_princeps|8337             GCTAGTATAAGCGTGCGTTCGAGTACCCCAGGCTCTCCTACACATGTAAGCAGTGGATCG
Pan_troglodytes|13928              GCTAGTATAAGCGTGCGTTCGAGTACCCCAGGCTCTCCTACACATGTAAGCAGTGGATCG
Oryctolagus_cuniculus|16602        GCTAGTATAAGCGTGCGTTCGAGTACCCCAGGCTCTCCTACACATGTAAGCAGTGGATCG
Otolemur_garnettii|4046            GCTAGTATAAGCGTGCGTTCGAGTACCCCAGGCTCTCCTACACATGTAAGCAGTGGATCG
Tupaia_belangeri|5737              GCTAGTATAAGCGTGCGTTCGAGTACCCCAGGCTCTCCTACACATGTAAGCAGTGGATCG
Callithrix_jacchus|22610           GCTAGTATAAGCGTGCGTTCGAGTACCCCAGGCTCTCCTACACATGTAAGCAGTGGATCG
Gorilla_gorilla|8058               GCTAGTATAAGCGTGCGTTCGAGTACCCCAGGCTCTCCTACACATGTAAGCAGTGGATCG
Homo_sapiens|30793                 GCTAGTATAAGCGTGCGTTCGAGTACCCCAGGCTCTCCTACACATGTAAGCAGTGGATCG
                                   ********************************************************* **

Dipodomys_ordii|3908               AATGCTAGTCGAAGGAGAAATGGACTCCATGATGTCGATTTGAACACTTTCATATCAGAA
Spermophilus_tridecemlineatus|9323 AATGCTAGTCGAAGGAGGAATGGACTCCATGATGTCGATTTGAACACTTTCATATCAGAA
Mus_musculus|14985                 AATGCTAGTCGAAGGAGAAATGGACTCCATGATGTCGATTTGAACACTTTCATAACAGAA
Rattus_norvegicus|4904             AATGCTAGTCGAAGGAGAAATGGACTCCATGATGTCGATTTGAACACTTTCATAACAGAA
Cavia_porcellus|15665              AATGCTAGTCGAAGGAGAAATGGACTCCATGATGTCGATTTGAACACTTTCATATCAGAA
Ochotona_princeps|8337             AATGCTAGTCGAAGGAGAAATGGACTCCATGATGTCGATTTGAACACTTTCATATCAGAA
Pan_troglodytes|13928              AATGCTAGTCGAAGGAGAAATGGACTCCATGATGTCGATTTGAACACTTTCATATCAGAA
Oryctolagus_cuniculus|16602        AATGCTAGTCGAAGGAGAAATGGACTCCATGATGTCGATTTGAACACTTTCATATCAGAA
Otolemur_garnettii|4046            AATGCTAGTCGAAGGAGAAATGGACTCCATGATGTCGATTTGAACACTTTCATATCAGAA
Tupaia_belangeri|5737              AATGCTAGTCGAAGGAGAAATGGACTCCATGATGTCGATTTGAACACTTTCATATCAGAA
Callithrix_jacchus|22610           AATGCTAGTCGAAGGAGAAATGGACTCCATGATGTCGATTTGAACACTTTCATATCAGAA
Gorilla_gorilla|8058               AATGCTAGTCGAAGGAGAAATGGACTCCATGATGTCGATTTGAACACTTTCATATCAGAA
Homo_sapiens|30793                 AATGCTAGTCGAAGGAGAAATGGACTCCATGATGTCGATTTGAACACTTTCATATCAGAA
                                   *****************.************************************:*****

Dipodomys_ordii|3908               GAAATGGCACTCCACTTGGACAATGGTGGAACTAGAAAGCGTACCTCAGCCCAGTGTGGC
Spermophilus_tridecemlineatus|9323 GAAATGGCACTCCACTTGGACAATGGTGGAACTAGAAAGCGTACCTCAGCCCAGTGTGGC
Mus_musculus|14985                 GAAATGGCACTCCACTTGGACAATGGTGGAACTAGAAAGCGTACCTCAGCCCAGTGTGGC
Rattus_norvegicus|4904             GAAATGGCACTCCACTTGGACAATGGTGGAACTAGAAAGCGTACCTCAGCCCAGTGTGGC
Cavia_porcellus|15665              GAAATGGCACTCCACTTGGACAATGGTGGAACTAGAAAGCGTACCTCAGCCCAGTGTGGC
Ochotona_princeps|8337             GAAATGGCACTCCACTTGGACAATGGTGGAACTAGAAAGCGTACCTCAGCCCAGTGTGGC
Pan_troglodytes|13928              GAAATGGCACTCCACTTGGACAATGGTGGAACTAGAAAGCGTACCTCAGCCCAGTGTGGC
Oryctolagus_cuniculus|16602        GAAATGGCACTCCACTTGGACAATGGTGGAACTAGAAAGCGTACCTCAGCCCAGTGTGGC
Otolemur_garnettii|4046            GAAATGGCACTCCACTTGGACAATGGTGGAACTAGAAAGCGTACCTCAGCCCAGTGTGGC
Tupaia_belangeri|5737              GAAATGGCACTCCACTTGGACAATGGTGGAACTAGAAAGCGTACCTCAGCCCAGTGTGGC
Callithrix_jacchus|22610           GAAATGGCACTCCACTTGGACAATGGTGGAACTAGAAAGCGTACCTCAGCCCAGTGTGGC
Gorilla_gorilla|8058               GAAATGGCACTCCACTTGGACAATGGTGGAACTAGAAAGCGTACCTCAGCCCAGTGTGGC
Homo_sapiens|30793                 GAAATGGCACTCCACTTGGACAATGGTGGAACTAGAAAGCGTACCTCAGCCCAGTGTGGC
                                   ************************************************************

Dipodomys_ordii|3908               GATGTCATTACAGACTCACCAACCCATAAACGCAACAGAATGATCTAA
Spermophilus_tridecemlineatus|9323 GATGTCATTACAGACTCACCAACCCATAAACGCAACAGAATGATCTAA
Mus_musculus|14985                 GATGTCATTACAGACTCACCAACCCATAAACGCAACAGAATGCTCTAA
Rattus_norvegicus|4904             GATGTCATTACAGACTCACCAACCCATAAACGCAACAGAATGCTCTAA
Cavia_porcellus|15665              GATGTCATTACAGACTCACCAACCCATAAACGCAACAGAATGATC---
Ochotona_princeps|8337             GATGTCATTACAGACTCACCAACCCATAAACGCAACAGAATGATCTAA
Pan_troglodytes|13928              GATGTCATTACAGACTCACCAACCCATAAACGCAACAGAATGATCTAA
Oryctolagus_cuniculus|16602        GATGTCATTACAGACTCACCAACCCATAAACGCAACAGAATGATCTAA
Otolemur_garnettii|4046            GATGTCATTACAGACTCACCAACCCATAAACGCAACAGAATGATCTAA
Tupaia_belangeri|5737              GATGTCATTACAGACTCACCAACCCATAAACGCAACAGAATGATCTAA
Callithrix_jacchus|22610           GATGTCATTACAGACTCACCAACCCATAAACGCAACAGAATGATCTAA
Gorilla_gorilla|8058               GATGTCATTACAGACTCACCAACCCATAAACGCAACAGAATGATCTAA
Homo_sapiens|30793                 GATGTCATTACAGACTCACCAACCCATAAACGCAACAGAATGATCTAA
                                   ******************************************.**   

multiple sequence alignment in CLUSTALW format


Dipodomys_ordii|3658               MEERKEEGEAEIQEHGPEHWFSKWERQCLAEAEQDEQLPPELQEEAAAAAQPEHKQQKLW
Spermophilus_tridecemlineatus|8368 MKEQRE-GEAE----SPVHWFSKWE-QCLALAQEGEQLSPEPQEAAAAALQPEHKQHKLW
Mus_musculus|49517                 MEERKEEGEAEIQEHGPEHWFSKWERQCLAEAEQDEQLSPELQEEAAAAAQPEHKQQKLW
Rattus_norvegicus|12715            MEERKEEGEAEIQEHGPEHWFSKWERQCLAEAEQDEQLSPELQEEAAAAAQPEHKQQKLW
Cavia_porcellus|12314              ------------------------------------------------------------
Ochotona_princeps|7264             MEQRMEH---ETPNQEPVSVPVSKMRQCLAEAEQDEQLFPELQEEAAAAAHPEHKQQKLW
Pan_troglodytes|5081               MEERKEEGEAEIQEHGPEHWFSKWERQCLAEADQDEQLPP---EEAAAAAHPE-KQQKLW
Oryctolagus_cuniculus|8442         ------------------------------------------------------------
Otolemur_garnettii|3478            ------------------------------------------------------------
Tupaia_belangeri|4959              ------------------------------------------------------------
Callithrix_jacchus|14907           MEERKEEGEAEIQEHGPEHWFSKWERQCLAEAEQDEQLPPELQEEAAAAAQPEHKQQKLW
Gorilla_gorilla|7029               MEERKEEGEAEIQEHGPEHWFSKWERQCLAEAEQDEQLPPELQEEAAAAAQPEHKQQKLW
Homo_sapiens|15775                 MEERKEEGEAEIQEHGPEHWFSKWERQCLAEAEQDEQLPPELQEEAAAAAQPEHKQQKLW
                                                                                               

Dipodomys_ordii|3658               HLFQNSATAVAQLYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXSVDTHQRSFDIGIQIGY
Spermophilus_tridecemlineatus|8368 HLFQNSA---------RVCQQPALSLWVPFQNASAALTKLYKESVDTHQRSFDIGIQIGY
Mus_musculus|49517                 HLFQNSATAVAQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGY
Rattus_norvegicus|12715            HLFQNSATAVAQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGY
Cavia_porcellus|12314              --FQNSATAVAQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGY
Ochotona_princeps|7264             HLFQNSATAVAQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGY
Pan_troglodytes|5081               HLFQNSATGVGQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGY
Oryctolagus_cuniculus|8442         ---------------DRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGY
Otolemur_garnettii|3478            ----------------RVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGY
Tupaia_belangeri|4959              ----------------RVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGY
Callithrix_jacchus|14907           HLFQNSATAVAQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGY
Gorilla_gorilla|7029               HLFQNSATAVAQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGY
Homo_sapiens|15775                 HLFQNSATAVAQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGY
                                                                              *****************

Dipodomys_ordii|3658               QRRNKDVLAWVKKRRRTIRREDLISFLCGKVPPPRNSRAPPRLTVVSPNRATSTETSSSV
Spermophilus_tridecemlineatus|8368 QRRNKDVLAWVKKRRRTIRREDLISFLCGKVPPPRNSRAPPRLTVVSPNRATSTETSSSV
Mus_musculus|49517                 QRRNKDVLAWVKKRRRTIRREDLISFLCGKVPPPRNSRAPPRLTVVSPNRATSTETSSSV
Rattus_norvegicus|12715            QRRNKDVLAWVKKRRRTIRREDLISFLCGKVPPPRNSRAPPRLTVVSPNRATSTETSSSV
Cavia_porcellus|12314              QRRNKDVLAWVKKRRRTIRREDLISFLCGKVPPPRNSRAPPRLTVVSPNRATSAETSSSV
Ochotona_princeps|7264             QRRNKDVLAWVKKRRRTIRREDLISFLCGKVPPPRNSRAPPRLTVVSPNRATSTETSSSV
Pan_troglodytes|5081               QRRNKDVLAWVKKRRRTIRREDLISFLCGKVPPPRNSRAPPRLTVVSPNRATSTETSSSV
Oryctolagus_cuniculus|8442         QRRNKDVLAWVKKRRRTIRREDLISFLCGKVPPPRNSRAPPRLTVVSPNRATSTETSSSV
Otolemur_garnettii|3478            QRRNKDVLAWVKKRRRTIRREDLISFLCGKVPPPRNSRAPPRLTVVSPNRATSTETSSSV
Tupaia_belangeri|4959              QRRNKDVLAWVKKRRRTIRREDLISFLCGKVPPPRNSRAPPRLTVVSPNRATSTETSSSV
Callithrix_jacchus|14907           QRRNKDVLAWVKKRRRTIRREDLISFLCGKVPPPRNSRAPPRLTVVSPNRATSTETSSSV
Gorilla_gorilla|7029               QRRNKDVLAWVKKRRRTIRREDLISFLCGKVPPPRNSRAPPRLTVVSPNRATSTETSSSV
Homo_sapiens|15775                 QRRNKDVLAWVKKRRRTIRREDLISFLCGKVPPPRNSRAPPRLTVVSPNRATSTETSSSV
                                   *****************************************************:******

Dipodomys_ordii|3658               ETDLQPFREAIALHGLSGAMASISVRSSTPGSPTHVSSGSNASRRRNGLHDVDLNTFISE
Spermophilus_tridecemlineatus|8368 ETDLQPFREAIALHGLSGAMASISVRSSTPGSPTHVSSGSNASRRRNGLHDVDLNTFISE
Mus_musculus|49517                 ETDLQPFREAIALHGLSGAMASISVRSSTPGSPTHVSSGPNASRRRNGLHDVDLNTFITE
Rattus_norvegicus|12715            ETDLQPFREAIALHGLSGAMASISVRSSTPGSPTHVSSGPNASRRRNGLHDVDLNTFITE
Cavia_porcellus|12314              ETDLQPFREAIALHGLSGAMASISVRSSTPGSPTHVSSGSNASRRRNGLHDVDLNTFISE
Ochotona_princeps|7264             ETDLQPFREAIALHGLSGAMASISVRSSTPGSPTHVSSGSNASRRRNGLHDVDLNTFISE
Pan_troglodytes|5081               ETDLQPFREAIALHGLSGAMASISVRSSTPGSPTHVSSGSNASRRRNGLHDVDLNTFISE
Oryctolagus_cuniculus|8442         ETDLQPFREAIALHGLSGAMASISVRSSTPGSPTHVSSGSNASRRRNGLHDVDLNTFISE
Otolemur_garnettii|3478            ETDLQPFREAIALHGLSGAMASISVRSSTPGSPTHVSSGSNASRRRNGLHDVDLNTFISE
Tupaia_belangeri|4959              ETDLQPFREAIALHGLSGAMASISVRSSTPGSPTHVSSGSNASRRRNGLHDVDLNTFISE
Callithrix_jacchus|14907           ETDLQPFREAIALHGLSGAMASISVRSSTPGSPTHVSSGSNASRRRNGLHDVDLNTFISE
Gorilla_gorilla|7029               ETDLQPFREAIALHGLSGAMASISVRSSTPGSPTHVSSGSNASRRRNGLHDVDLNTFISE
Homo_sapiens|15775                 ETDLQPFREAIALHGLSGAMASISVRSSTPGSPTHVSSGSNASRRRNGLHDVDLNTFISE
                                   ***************************************.******************:*

Dipodomys_ordii|3658               EMALHLDNGGTRKRTSAQCGDVITDSPTHKRNRMI
Spermophilus_tridecemlineatus|8368 EMALHLDNGGTRKRTSAQCGDVITDSPTHKRNRMI
Mus_musculus|49517                 EMALHLDNGGTRKRTSAQCGDVITDSPTHKRNRML
Rattus_norvegicus|12715            EMALHLDNGGTRKRTSAQCGDVITDSPTHKRNRML
Cavia_porcellus|12314              EMALHLDNGGTRKRTSAQCGDVITDSPTHKRNRMI
Ochotona_princeps|7264             EMALHLDNGGTRKRTSAQCGDVITDSPTHKRNRMI
Pan_troglodytes|5081               EMALHLDNGGTRKRTSAQCGDVITDSPTHKRNRMI
Oryctolagus_cuniculus|8442         EMALHLDNGGTRKRTSAQCGDVITDSPTHKRNRMI
Otolemur_garnettii|3478            EMALHLDNGGTRKRTSAQCGDVITDSPTHKRNRMI
Tupaia_belangeri|4959              EMALHLDNGGTRKRTSAQCGDVITDSPTHKRNRMI
Callithrix_jacchus|14907           EMALHLDNGGTRKRTSAQCGDVITDSPTHKRNRMI
Gorilla_gorilla|7029               EMALHLDNGGTRKRTSAQCGDVITDSPTHKRNRMI
Homo_sapiens|15775                 EMALHLDNGGTRKRTSAQCGDVITDSPTHKRNRMI
                                   **********************************: