Orthologs Set ID: EOG4003HW


Orthology Database
OrthoDB4
Gene Symbol(s)
SIGLEC17P

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 32830 114, 120, 300, 499, 778, 872
Gorilla gorilla 20366 114, 300, 306, 499, 778, 872
Homo sapiens 40890 114, 300, 499, 778, 872
Pan troglodytes 19623 113, 115, 315, 499, 778, 887

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 32830 ENSCJAT00000036502 ENSCJAG00000018613 calJac3
Gorilla gorilla 20366 ENSGGOT00000009047 ENSGGOG00000009008 gorGor3
Homo sapiens 40890 ENST00000305812 284367 ENSG00000171101 SIGLEC17P hg19,GRCh37
Pan troglodytes 19623 ENSPTRT00000021166 748734 ENSPTRG00000011374 LOC748734 panTro2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 24686 ENSCJAP00000034565 ENSCJAG00000018613 calJac3
Gorilla gorilla 16110 ENSGGOP00000008807 ENSGGOG00000009008 gorGor3
Homo sapiens 32109 ENSP00000303760 284367 ENSG00000171101 SIGLEC17P hg19,GRCh37
Pan troglodytes 23079 ENSPTRP00000019545 748734 ENSPTRG00000011374 LOC748734 panTro2

multiple sequence alignment in CLUSTALW format


Pan_troglodytes|19623    CAAGATCTCATGCTCCTCCCCACAGCCCTCTTCTCTGCTCACACAGGAAGCCCAGGAAGC
Callithrix_jacchus|32830 ------------------------------------------------------------
Gorilla_gorilla|20366    ---------------------------------------------------------CAG
Homo_sapiens|40890       ---------------------------------------------------------CAG
                                                                                     

Pan_troglodytes|19623    CTCTGCCTCAGAGAtgctgccgctgctgctgccgctgcccctgctgTGGGCAGGGCCCTC
Callithrix_jacchus|32830 TGCTGCTGCCGC------------TCCTGCTGCCACTACCCCTGCTGTGGGCAGGGGCCC
Gorilla_gorilla|20366    AGATGCTGCCGC------------TGCTGCTGCCGCTGCCCCTGCTGTGGGCAGGGCCCT
Homo_sapiens|40890       AGAtgctgccgc------------tgctgctgccgctgcccctgctgTGGGCAGGGCCCT
                           .***  *.*.                    *     ***       ** ..**  *  

Pan_troglodytes|19623    GCTCAGGATGCAAGATTCCGGCTGGAGATGCCAGAGTCCGTGACGGTGCAGGAGGGTCTG
Callithrix_jacchus|32830 ---TCAGGATGCAGGATTCCG---------GCTGGAGGTGCCAGAGTCCGTGAGGGTGCA
Gorilla_gorilla|20366    CGCTCAGGATGCAAGATTCCG---------GCTGGAGATGCCAGAGTCCGTGACGGTGCA
Homo_sapiens|40890       CGCTCAGGATGCAAGATTCCG---------GCTGGAGATGCCAGAGTCCGTGACGGTGCA
                             ..*.:  .*..:* * *          *:*..   *  * .** *. ** ***  .

Pan_troglodytes|19623    TGCATCTTTGTGCAC---TGTTCGGTCTTC---TACCTCGAGTATGGCTGGAAAGATTCT
Callithrix_jacchus|32830 AGAGGGGCTGTGCGTCTTTGTGCATTGTTCAGTCTCCTACATACAGTATGGCTGGAAAGA
Gorilla_gorilla|20366    GGAGAGTCTGTGCATCTTTGTGCACTGTTCGGTCTTCTACCTCGAGTATGGCTGGAAAGA
Homo_sapiens|40890       GGAGGGTCTGTGCATCTTTGTGCACTGTTCGGTCTTCTACCTCGAGTATGGCTGGAAAGA
                          *..    *****.    *** *. * ***    : **. .   :* .***.:.**:: :

Pan_troglodytes|19623    ACCCCTGCTTATGGCTACTGGTTCCGGGAAGGGGTCAGTGTAGACCAGGAGACTCCAGTG
Callithrix_jacchus|32830 TTCTACTCCTGCTTATGGGTACTGGTTCCGGGAAGGGGTCAGTGTAGACCAGGACACTCC
Gorilla_gorilla|20366    TTCTACCCCTGCTTATGGCTACTGGTTCCGGGAAGGGGTCAGTGTAGACCAGGAGACTCC
Homo_sapiens|40890       TTCTACCCCTGCTTATGGCCACTGGTTCCGGGAAGGGGTCAGTGTAGACCAGGAGACTCC
                         : * .  * *.   .*.   . *     ..**..  .** :. . ... ... : ..   

Pan_troglodytes|19623    GCCACAAACAACTCA------AAAGTGCAG---GAGACCCAGGGCCGATTCCACCTCCTC
Callithrix_jacchus|32830 GCCACAAACAACTCAACTCAAAAAGTGCAGAAGGAGACCCAGGGCCGATTCCACCTCCTC
Gorilla_gorilla|20366    GCCACA---------ACTCAAAAAGTGCAGAAGGAGACCCAGGGCCGATTCCACCTCCTC
Homo_sapiens|40890       GCCACAAACAACTCAACTCAAAAAGTGCAGAAGGAGACCCAGGGCCGATTCCACCTCCTC
                         ******               *********   ***************************

Pan_troglodytes|19623    GGTGACCCCTCAAGGAACAACTGCTCCCTGAGCATCAGAGACGCCAAGAGGAGGGACAAC
Callithrix_jacchus|32830 GGTGATCCCGGGAGGAACAACTGCTCCCTGAGCATCAGAGACGCCAGGAGGAGGGACGAT
Gorilla_gorilla|20366    GGTGACCCCTCAAGGAACAACTGCTCCCTGAGCATCAGAGACGCGAAGAGGAGGGACAAC
Homo_sapiens|40890       GGTGATCCCTCAAGGAACAACTGCTCCCTGAGCATCAGAGACGCCAGGAGGAGGGACAAC
                         ***** ***  .******************************** *.**********.* 

Pan_troglodytes|19623    GGTTCGTACTTCTTTCGGGTGGCGAGAGGAAGAACAAAATTTAGTTACAAATATTCCCCA
Callithrix_jacchus|32830 GGTTCATACTTCTTTCGGGTGGAGAGAGGAAGAATAAAATTTAGTTACAAATATTCCCAG
Gorilla_gorilla|20366    GGTTCGTACTTCTTTCGGGTGGCGAGAGGAAGAACAAAATTTAGTTACAAATATTCCCCA
Homo_sapiens|40890       GGTTCATACTTCTTTTGGGTGGCGAGAGGAAGAACAAAATTTAGTTACAAATATTCCCCG
                         *****.********* ******.*********** ***********************..

Pan_troglodytes|19623    CTCTCTGTGTATGTGACAGCCCTGACCCACAGGCCGGACATCCTCATCCCGGAGTTCCTA
Callithrix_jacchus|32830 CTCTCTGTGCATGTGACAGCCCTGACCCACAAGCCCGATATCCTCATCCCGGAGTTCCTA
Gorilla_gorilla|20366    CTCTCTGTGTATGTGACAGCCCTGACCCACAGGCCTGACATCCTCATCCCGGAGTTCCTA
Homo_sapiens|40890       CTCTCTGTGTATGTGACAGCCCTGACCCACAGGCCCGACATCCTCATCCCGGAGTTCCTA
                         ********* *********************.*** ** *********************

Pan_troglodytes|19623    AAGTCTGGCCATCCCAGCAATCTGACCTGCTCTGTGCCCTGGGTCTGTGAGCAGGGAACG
Callithrix_jacchus|32830 AAGTCTGGCCACCCCAGCAACCTGACCTGCTCTGTGCCCTGGGCCTGTGAGCAAGGGACA
Gorilla_gorilla|20366    AAGTCTGGCCATCCCAGCAATCTGACCTGCTCTGTGCCCTGGGTCTGTGAGCAGGGAACG
Homo_sapiens|40890       AAGTCTGGCCATCCCAGCAACCTGACCTGCTCTGTGCCCTGGGTCTGTGAGCAGGGAACA
                         *********** ******** ********************** *********.**.**.

Pan_troglodytes|19623    CCCCCCATCTTCTCCTGGATGTCAGCTGCCCCCACCTCCCTGGGCCCCAGGACCCTCCAC
Callithrix_jacchus|32830 CCCCCCATCTTCTCCTGGATGTCCGCTGCCCCCACCTCCCTGGGCCCCAGGACTCTCCAC
Gorilla_gorilla|20366    CCCCCCATCTTCTCCTGGATGTCAGCTGCCCCCACCTCCCTGGGCCCCAGGACCCTCCAC
Homo_sapiens|40890       CCCCCCATCTTCTCCTGGATGTCAGCTGCCCCCACCTCCCTGGGCCCCAGGACCCTCCAC
                         ***********************.***************************** ******

Pan_troglodytes|19623    TCCTCAGTGCTCACGATCATCCCATGGCCTCAGGACCACGGCACCAACCTCACCTGTCAG
Callithrix_jacchus|32830 TCCTCAGTGCTCATGATCACCCCACGGCCCCAGGACCACAGAACCAACCTCACCTGTCAG
Gorilla_gorilla|20366    TCCTCAGTGCTCATGATCATCCCACGGCCTCAGGACCACGGCACCAACCTCACCTGTCAG
Homo_sapiens|40890       TCCTCAGTGCTCACGATCATCCCACGGCCTCAGGACCACGGCACCAACCTCATCTGTCAG
                         ************* ***** **** **** *********.*.********** *******

Pan_troglodytes|19623    GTGACGTTCCCTGGAGCTGGTGTGACCACGGAGAGAACCATCCAGCTCAGTGTCTCCTGG
Callithrix_jacchus|32830 GTGACGTTCCCTGGAGCTGGTGTGGCCACAGAGAGAATCATCCAGCTCAGTGTCTCTTGG
Gorilla_gorilla|20366    GTGACATTCCCTGGAGCTGGTGTGACCACGGAGAGAACCATCCAGCTCAGTGTCTCCTGG
Homo_sapiens|40890       GTGACGTTCCCCGGAGCTGGTGTGACCACGGAGAGAACCATCCAGCTCAGTGTCTCCTGG
                         *****.***** ************.****.******* ****************** ***

Pan_troglodytes|19623    AAATCAGGAACCGTGGAAGAGGTGGTTGTTTTGGCCGTGGGGGTAGTGGCTGTGAAGATC
Callithrix_jacchus|32830 AAATCAGGAACCATGGCAGAGGTGGTTGTTTTGGCCGTGGGAGTAGCGGCTGTGAAGATC
Gorilla_gorilla|20366    AAATCAGGAACCGTGGAAGAGGTGGTTGTTTTGGCCGTGGGGGTAGTGGCTGTGAAGATC
Homo_sapiens|40890       AAATCAGGAACCGTGGAAGAGGTGGTTGTTTTGGCCGTGGGGGTAGTGGCTGTGAAGATC
                         ************.***.************************.**** *************

Pan_troglodytes|19623    CTGCTTCTCTGCCTTTGCCTCATCATCCTC---------------AGGTCCTTGACTCTT
Callithrix_jacchus|32830 CTGCTTCTCTGCCTCTGCCTCATCATCCTCAGTGTCAATTTCTACAAGAAGGCAGCGGTG
Gorilla_gorilla|20366    TTGCTTCTCTGCCTTTGCCTCATCATCCTCAGT------TTCCACAAGAAGAAGGCGGTG
Homo_sapiens|40890       CTGCTTCTCTGCCTTTGCCTCATCATCCTCAGT------TTCCACAAGAAGAAGGCGGTG
                          ************* ***************               *.*:.   ..*  * 

Pan_troglodytes|19623    CACTCAATGTCAGTTTCCACAAGAAGAAGGCGG---------TGA
Callithrix_jacchus|32830 AAGGCAGTAGAGGTCCAGGAGAATGTATACACTGTCATGGGTTAA
Gorilla_gorilla|20366    AGGGCAGTGGAGGTTGAGGAGAATGTATATGCTGTCATGGGTTAA
Homo_sapiens|40890       AGGGCAGTGGAGGTTGAGGAGAATGTATATGCTGTCATGGGTTAA
                         ..  **.*. ..**  . ...*.:. *:.             *.*

multiple sequence alignment in CLUSTALW format


Pan_troglodytes|23079    QDLMLLPTALFSAHTGSPGSLCLRDAAAAAAAAPAVGRALAQDARFRLEMPESVTVQEGL
Callithrix_jacchus|24686 --------------------CCCR----SCCHYPCCGQGP-SGCRIP---AGGARVREGA
Gorilla_gorilla|16110    -------------------QRCCR----CCCRCPCCGQGPRSGCKIP---AGDARVRDGA
Homo_sapiens|32109       -------------------QRCCR----CCCRCPCCGQGPRSGCKIP---AGDARVRDGA
                                              * *    ...  *. *:.  ...::    . .. *::* 

Pan_troglodytes|23079    CIFVH-CSVF-YLEYGWKDSTPAYGYWFREGVSVDQETPVATNNS--KVQ-ETQGRFHLL
Callithrix_jacchus|24686 RGAVRLCALFSLLHTVWLERFYSCLWVLVPGRGQCRPGHSATNNSTQKVQKETQGRFHLL
Gorilla_gorilla|16110    GESVHLCALFGLLPRVWLERFYPCLWLLVPGRGQCRPGDSAT---TQKVQKETQGRFHLL
Homo_sapiens|32109       GGSVHLCALFGLLPRVWLERFYPCLWPLVPGRGQCRPGDSATNNSTQKVQKETQGRFHLL
                            *: *::*  *   * :   .  : :  * .  :    **     *** *********

Pan_troglodytes|23079    GDPSRNNCSLSIRDAKRRDNGSYFFRVARGRTKFSYKYSPLSVYVTALTHRPDILIPEFL
Callithrix_jacchus|24686 GDPGRNNCSLSIRDARRRDDGSYFFRVERGRIKFSYKYSQLSVHVTALTHKPDILIPEFL
Gorilla_gorilla|16110    GDPSRNNCSLSIRDAKRRDNGSYFFRVARGRTKFSYKYSPLSVYVTALTHRPDILIPEFL
Homo_sapiens|32109       GDPSRNNCSLSIRDARRRDNGSYFFWVARGRTKFSYKYSPLSVYVTALTHRPDILIPEFL
                         ***.***********:***:***** * *** ******* ***:******:*********

Pan_troglodytes|23079    KSGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTLHSSVLTIIPWPQDHGTNLTCQ
Callithrix_jacchus|24686 KSGHPSNLTCSVPWACEQGTPPIFSWMSAAPTSLGPRTLHSSVLMITPRPQDHRTNLTCQ
Gorilla_gorilla|16110    KSGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTLHSSVLMIIPRPQDHGTNLTCQ
Homo_sapiens|32109       KSGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTLHSSVLTIIPRPQDHGTNLICQ
                         **************.***************************** * * **** *** **

Pan_troglodytes|23079    VTFPGAGVTTERTIQLSVSWKSGTVEEVVVLAVGVVAVKILLLCLCLIIL-----RSLTL
Callithrix_jacchus|24686 VTFPGAGVATERIIQLSVSWKSGTMAEVVVLAVGVAAVKILLLCLCLIILSVNFYKKAAV
Gorilla_gorilla|16110    VTFPGAGVTTERTIQLSVSWKSGTVEEVVVLAVGVVAVKILLLCLCLIILS--FHKKKAV
Homo_sapiens|32109       VTFPGAGVTTERTIQLSVSWKSGTVEEVVVLAVGVVAVKILLLCLCLIILS--FHKKKAV
                         ********:*** ***********: *********.**************     :. ::

Pan_troglodytes|23079    HSMSVSTRRRR---
Callithrix_jacchus|24686 KAVEVQENVYTVMG
Gorilla_gorilla|16110    RAVEVEENVYAVMG
Homo_sapiens|32109       RAVEVEENVYAVMG
                         :::.*. .