Orthologs Set ID: EOG4003HX


Orthology Database
OrthoDB4
Gene Symbol(s)
CENPQ

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 32018 114, 178, 299, 377, 507, 627, 705
Cavia porcellus 16912 48, 74, 117, 169, 299, 377, 507, 627, 705
Dipodomys ordii 5129 42, 66, 69, 114, 178, 299, 377, 507, 627, 705
Gorilla gorilla 14798 114, 178, 299, 377, 507, 627, 705
Homo sapiens 74063 114, 178, 299, 377, 507, 627, 705
Microcebus murinus 2829 88, 224, 293, 507, 627, 705
Mus musculus 17608 114, 169, 299, 377, 507, 627, 705
Ochotona princeps 15176 114, 187, 299, 377, 507, 626, 627
Oryctolagus cuniculus 26862
Oryctolagus cuniculus 3644 114, 178, 299, 377, 507, 641, 705
Otolemur garnettii 15115 114, 128, 178, 299, 377, 507, 630
Otolemur garnettii 17288 377, 477, 507, 627, 705
Pan troglodytes 32047 114, 299, 377, 507, 627, 705
Rattus norvegicus 35328 114, 178, 299, 377, 507
Spermophilus tridecemlineatus 1425 27, 72, 114, 178, 299, 377, 507, 627, 705
Tarsius syrichta 3509 114, 178, 299, 377, 507, 627, 705
Tupaia belangeri 4317 114, 178, 299, 377, 507, 627, 705

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 32018 ENSCJAT00000022840 100388896 ENSCJAG00000011759 CENPQ calJac3
Cavia porcellus 16912 ENSCPOT00000008376 100717734 ENSCPOG00000008301 CENPQ cavPor3
Dipodomys ordii 5129 ENSDORT00000004446 ENSDORG00000004444 Cenpq dipOrd1
Gorilla gorilla 14798 ENSGGOT00000024187 101132555 ENSGGOG00000024998 CENPQ gorGor3
Homo sapiens 74063 ENST00000371200 55166 ENSG00000031691 CENPQ hg19,GRCh37
Microcebus murinus 2829 ENSMICT00000002632 ENSMICG00000002634 CENPQ micMur1
Mus musculus 17608 ENSMUST00000087114, NM_031863 83815 ENSMUSG00000023919 mm9
Ochotona princeps 15176 ENSOPRT00000014654 ENSOPRG00000014663 CENPQ OchPri2.0
Oryctolagus cuniculus 3644 ENSOCUT00000006103 103349773 ENSOCUG00000006103 CENPQ oryCun2.0
Oryctolagus cuniculus 26862 ENSOCUT00000030847 ENSOCUG00000021978 oryCun2.0
Otolemur garnettii 17288 ENSOGAT00000016616 ENSOGAG00000016614 otoGar1
Otolemur garnettii 15115 ENSOGAT00000014520 ENSOGAG00000014517 otoGar1
Pan troglodytes 32047 ENSPTRT00000033755 462754 ENSPTRG00000018257 CENPQ panTro2
Rattus norvegicus 35328 ENSRNOT00000065470 363198 ENSRNOG00000042828 LOC100361893 rn4
Spermophilus tridecemlineatus 1425 ENSSTOT00000001425 101967341 ENSSTOG00000001426 Cenpq speTri1
Tarsius syrichta 3509 ENSTSYT00000014260 ENSTSYG00000014260 CENPQ tarSyr1
Tupaia belangeri 4317 ENSTBET00000004318 ENSTBEG00000004322 CENPQ tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 23911 ENSCJAP00000021606 100388896 ENSCJAG00000011759 CENPQ calJac3
Cavia porcellus 13334 ENSCPOP00000007464 100717734 ENSCPOG00000008301 CENPQ cavPor3
Dipodomys ordii 4804 ENSDORP00000004158 ENSDORG00000004444 Cenpq dipOrd1
Gorilla gorilla 12002 ENSGGOP00000020032 101132555 ENSGGOG00000024998 CENPQ gorGor3
Homo sapiens 67741 ENSP00000360243 55166 ENSG00000031691 CENPQ hg19,GRCh37
Microcebus murinus 2404 ENSMICP00000002403 ENSMICG00000002634 CENPQ micMur1
Mus musculus 17713 ENSMUSP00000084353 83815 ENSMUSG00000023919 mm9
Ochotona princeps 13231 ENSOPRP00000013377 ENSOPRG00000014663 CENPQ OchPri2.0
Oryctolagus cuniculus 15382 ENSOCUP00000024023 ENSOCUG00000021978 oryCun2.0
Oryctolagus cuniculus 17122 ENSOCUP00000005285 103349773 ENSOCUG00000006103 CENPQ oryCun2.0
Otolemur garnettii 14870 ENSOGAP00000014869 ENSOGAG00000016614 otoGar1
Otolemur garnettii 13006 ENSOGAP00000013007 ENSOGAG00000014517 otoGar1
Pan troglodytes 24920 ENSPTRP00000031196 462754 ENSPTRG00000018257 CENPQ panTro2
Rattus norvegicus 21597 ENSRNOP00000060916 363198 ENSRNOG00000042828 LOC100361893 rn4
Spermophilus tridecemlineatus 1279 ENSSTOP00000001278 101967341 ENSSTOG00000001426 Cenpq speTri1
Tarsius syrichta 3220 ENSTSYP00000013097 ENSTSYG00000014260 CENPQ tarSyr1
Tupaia belangeri 3737 ENSTBEP00000003732 ENSTBEG00000004322 CENPQ tupBel1

multiple sequence alignment in CLUSTALW format


Dipodomys_ordii|5129               ------ATGCCTACTAAAACAACTGATTCCAAGAAAAAGGCTCAG---------------
Ochotona_princeps|15176            ------ATGCTTGGAAAATCAAGTGTGTCCAAGAAG---ACTCAACAGGAAAAGAGAAAT
Microcebus_murinus|2829            ------------GTTAGAAACACAGCAAAAAGAAAGCAAAATCATCCAAAGCATCTGTCC
Spermophilus_tridecemlineatus|1425 ------ATGCCTGGTAAAGCAAATGCCAAGAAA---------------------AGAAGT
Otolemur_garnettii|15115           ------ATGCCTGGTAAACCACATGTTTCCAAGAAAAAGTCTCAACAGTTAAAAAGAAAT
Otolemur_garnettii|17288           ------------------------------------------------------------
Cavia_porcellus|16912              ATCAAGATGCGTGATAAAGCAAATAATTCCAGGAAAAAGCCTCAACAAATGAAGTGGAGT
Mus_musculus|17608                 ATGAAAATGTCTGGTAAAGCACGTGCTTCTAGGAAAAAACCTCAACAGGTGAAAAGAAGT
Rattus_norvegicus|35328            ------ATGTCTGGTAAAGCAAATACTTCTAAGAAAAAATCTCAACGGGTGAAAAGAAAT
Oryctolagus_cuniculus|3644         ATGAAGATGCCTGGTAAAACAAATGTTTCCAAGAAG---TCTCAGCAGTTAAAAAGAAAT
Oryctolagus_cuniculus|26862        ------ATGCCTGGTAAAACAAATGTTTCCAAGAAG---TCTCAGCAGGTAAAAAGAAAT
Callithrix_jacchus|32018           ------ATGTCTGATAAAGCAGGTGCTTCCAAGAAAAACTCTCAAGAGTTAAAAAGAAAT
Gorilla_gorilla|14798              ------ATGTCTGGTAAAGCAAATGCTTCCAAGAAAAATGCTCAACAGTTAAAAAGAAAT
Homo_sapiens|74063                 ------ATGTCTGGTAAAGCAAATGCTTCCAAGAAAAACGCTCAACAGTTAAAAAGAAAT
Pan_troglodytes|32047              ------ATGTCTGGTAAAGCAAATGCTTCCAAGAAAAACGCTCAACAGTTAAAAAGAAAT
Tupaia_belangeri|4317              ------ATGCCTGGTAAAGCAAGTGCTTCCAAGAAAAAGTCTCAACAATTGAAACGAAAT
Tarsius_syrichta|3509              ------ATGTCTGGTAAAGCAAATACTTTCAAGAAAGCATCTCAGCAGTTGAAAAGAAAT
                                                                                               

Dipodomys_ordii|5129               TTAAAAAATAGAAAGAGTGATGAGGAAGGCAACTTA------TCAGAGAAAAAGNNNNNN
Ochotona_princeps|15176            CCAAAAAGAAAACTTGATGATGAGGAAACAAAGCTG------CCGGAGAAAGAGNNNNNN
Microcebus_murinus|2829            CCTGAA---------------------GNNNNNNNN------NNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|1425 TCAAAAAGAAAATTTTTTTATGAGGCAGCAGAGTTC------TCTGCGAAACAGNNNNNN
Otolemur_garnettii|15115           TCAAAAAGAAAAACTGATGATGATGAA---GAGTTA------TCAGAGAAAAAGGTTAGA
Otolemur_garnettii|17288           ------------------------------------------------------------
Cavia_porcellus|16912              TCTCAGAGGAAGTGGAGTTTTATAACA---AGACTT------GTAAAAAATAGTTTGGTT
Mus_musculus|17608                 TTGAAACAAAGAGCCAATAAGGAAGCG---GATTTG------CCAGAGAATGAGGTTGGA
Rattus_norvegicus|35328            GTAAAACAAAGAGCCGATAAAGAAGATGAGGAATTGGATTCACCAGAGAATAAGGTTGGA
Oryctolagus_cuniculus|3644         CCAAAAAGAAAAATTGATGATGAAGAAGTAAAGTTG------CCAGAGAAAGAGGTTAGA
Oryctolagus_cuniculus|26862        CCAAAAAGAAAAATTGATGATGAAGAAGTAAAGTTG------CCAGAGAAAGAGGTTAGA
Callithrix_jacchus|32018           CCAAAGAGAAAAAAGGATAGTGAGGAAGTGGTGTTG------TCAGAGAAAAAGTTTAGA
Gorilla_gorilla|14798              CCAAAGAGAAAAAAGGATAATGAGGAAGTTGTGTTG------TCAGAGAATAAGGTTAGA
Homo_sapiens|74063                 CCAAAGAGAAAAAAGGATAATGAGGAAGTTGTGTTG------TCAGAGAATAAGGTTAGA
Pan_troglodytes|32047              CCAAAGAGAAAAAAGGATAATGAGGAAGTTGTGTTG------TCAGAGAATAAG------
Tupaia_belangeri|4317              CCAAAAAAAAAAGCTGATGAAGAAGAAGTGGGATTT------TCAGAGAAAGAGGTTAGA
Tarsius_syrichta|3509              CCAAAAAGAAAAACTGATGATGAGGAAGCAAAGGTG------TCAGAGAAAAAGGTTAGA
                                                                                               

Dipodomys_ordii|5129               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------NGA
Ochotona_princeps|15176            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------
Microcebus_murinus|2829            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------NNN
Spermophilus_tridecemlineatus|1425 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------NNN
Otolemur_garnettii|15115           AACACAGGGAAAAGAAATAAAAATCATCCAAACCATCTGTCTTCTAAA---------GGA
Otolemur_garnettii|17288           ------------------------------------------------------------
Cavia_porcellus|16912              AGAAGCACAAAAAGAATTAAAAATCATCCAAAGCATACATCTTCTGAAGTAATAACAGGA
Mus_musculus|17608                 AACACAGCAAAAAGAAACAGAAGTCATGCAAAGCATCTGTCCTCTAAAGTA---ACAGGA
Rattus_norvegicus|35328            AACAGAGCGAAAAGAAACAGAAGTCATGCAGGACATCTGTCCTCTAAA---------GAA
Oryctolagus_cuniculus|3644         AAAACAGTAAAAAGAAATAAAAATCATACAAAACGTCTGTCTTCTGAA---------GCA
Oryctolagus_cuniculus|26862        AAAACAGTAAAAAGAAATAAAAATCATACAAAACGTCTGTCTTCTGAA---------GGG
Callithrix_jacchus|32018           AACACAATGAAAAGAAATAAAAATCATCTGAAAGATCTGTCTTCTGAA---------GGA
Gorilla_gorilla|14798              AACACAGTGAAAAAAAATAAAAATCATCTGAAAGATCTGTCTTCTGAA---------GGA
Homo_sapiens|74063                 AACACAGTGAAAAAAAATAAAAATCATCTGAAAGATCTGTCTTCTGAA---------GGA
Pan_troglodytes|32047              ------------------------------------------------------------
Tupaia_belangeri|4317              AACACAGCAAAACGAAATAAAAATCATCTAAAGCGTTTATCTTCGGAA---------GGA
Tarsius_syrichta|3509              AATACAGTGAAAAGAAAT---AATCATACAAAGCATCTGTCTTCGGAA---------GGA
                                                                                               

Dipodomys_ordii|5129               CAAGTGAAATGTACTCAGCTAAAACAGATCAAAATAGCATCCAAAAAGAGAAAATCCTGG
Ochotona_princeps|15176            ------NAGCAAGCAAATCTAAAACGGGTAAAAATAAGTGTCAACAAGAGACGAACTTGG
Microcebus_murinus|2829            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|1425 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|15115           CAAACAAAGCATACTAATATAAAACAGATAAAGATAGCACCCAACAAAAGGAAAACCTGG
Otolemur_garnettii|17288           ---ACAAAGCATACTAATATAAAACAGATAAAGATAGTACCCAACAAAAGAAAAACCTGG
Cavia_porcellus|16912              CAAACAAATCATATTAATCTAAAACAGATAAAGATAGCATCCAACAAGAGAAAAACCTGG
Mus_musculus|17608                 CAAGCAACGTATGTTCATCTAAAACGGGTAAAAATATCATCCAGCAAGAGAACAACCTGG
Rattus_norvegicus|35328            CAAACAAAATGTGTTCATCTAAAACGGGTGAAAATATCATCCAACAAGAGAACAGCCTGG
Oryctolagus_cuniculus|3644         ATGACAGGGCAAACAAATCTAAAACGGGTAAAGATAAGTTCCACCAAGAGAAAAACTTGG
Oryctolagus_cuniculus|26862        CAAACA---------AATCTAAAAAGGGTAAAGATAAGCTCCACCAAGAGAAAAACTTGG
Callithrix_jacchus|32018           CAAACAAGGCACACTAACCTAAAACAGGTAAAGACAGCATCCAGCAAGAGAAAAACTTGG
Gorilla_gorilla|14798              CAAACAAAGCACACTAACCTAAAACATGTAAAGATAGCAGCCAGCAAGAGAAAAACCTGG
Homo_sapiens|74063                 CAAACAAAGCACACTAACCTAAAACACGGAAAGACAGCAGCCAGCAAGAGAAAAACCTGG
Pan_troglodytes|32047              CAAACAAAGCACACTAACCTAAAACACGTAAAGATAGCAGCCAGCAAGAGAAAAACCTGG
Tupaia_belangeri|4317              CAAACAGAGCAT------CTAAGACAGATAAAGATAACATCCAAGAAGAGAAAAACATGG
Tarsius_syrichta|3509              CAAACAAAGCATACTAATATAAAACAAGTAAAGATAGCATCCATCAAGAGGAAAACCTGG
                                                      .                             .       ...

Dipodomys_ordii|5129               CAACCTCTTCCAAAGAGTACCAAAGAACATTTACAGATTAAGATAGAATCAGTGATGTTA
Ochotona_princeps|15176            CAGCCTCTTTCAAGTAACACCAGGGAGCATTTGCAGACTGTGATGGAATCAGTAATAATA
Microcebus_murinus|2829            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|1425 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|15115           CAACCACTTTCAAAGAGTAGCAGAGAACATTTGCAAACAATAATGGAATCAGTAATAATA
Otolemur_garnettii|17288           CAACCCCTTTCAAAGGGTAGCAGAAAGCATTTGCAAACAATAATGGAATCAGAAATA---
Cavia_porcellus|16912              CAACCTCTTTCAAAGAGTATGAGGGAGCATTTGGAAACTGTGATAGAAGCAGTGATTATA
Mus_musculus|17608                 CAACCTCTTCCAAAGGATACTGAAGAGTATTTGCAAAGTATGATGGAGTCAGTCATTCTT
Rattus_norvegicus|35328            CAACCTCTTCCAAAGAATACTGAAGAGTATTTGCAAAGTATGATGGACTCAGCAATTCTT
Oryctolagus_cuniculus|3644         CAGCCTCTTTCAAGGAGTACCAGAGAGCATTTGCAAACTATGATGGAATCAGTAATAATA
Oryctolagus_cuniculus|26862        CAGCCTCTTTCAAGGAGTACCAGAGAGCATTTGCAAACTATGATGGAATCAGTAATAATA
Callithrix_jacchus|32018           CAACCTCTTTCAAAGAGTAGCAGAGACAATTTGCAAACTATGATGGAATCAGTAATAATA
Gorilla_gorilla|14798              CAACCTCTGTCAAAGAGTACCAGAGACCATTTGCAAACTATGATGGAATCAGTAATAATG
Homo_sapiens|74063                 CAACCTCTGTCAAAGAGTACCAGAGACCATTTGCAAACTATGATGGAATCAGTAATAATG
Pan_troglodytes|32047              CAACCTCTGTCAAAGAGTACCAGAGACCATTTGCAAACTATGATGGAATCAGTAATAATG
Tupaia_belangeri|4317              CATTCTCTATCAAAGAGCACCAGAGAGCATTTGCTAGCTATTATTGAATCAGCAGTAATN
Tarsius_syrichta|3509              CAACCTGTTTCAAAGAGTAGCAGAGAGCATTTGGGAACTATAATGGAATCAGTAATAATN
                                          .                     ...           . .     .   .    

Dipodomys_ordii|5129               GCAACTTTAGGCCAGGCTAAAAAAAGTAAACAACAAATTGAACAGATCCAATATCATCTC
Ochotona_princeps|15176            GCAATTTTGAGTAAAAGCATTAAAGACAAA---------GAGCAAATCCAATATCATCTC
Microcebus_murinus|2829            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------NNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|1425 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------NNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|15115           ACAATTTTGAGTAATAGTAAGAGAGAAAAA---------GAAGAAATACAGTATCATCTC
Otolemur_garnettii|17288           ACAATTTTGAATAACAGGAGTAGAGAAAAA---------GAAGAAATGCTGTACCATCTC
Cavia_porcellus|16912              GCAATTTTGAGTAATACT---AAAGAAAAA---------GAACCAATTCAGTGTCATCTC
Mus_musculus|17608                 GGAATTTTATTCAAC---ATAAAAAGAAAA---------GAAGAAATTCAGTGTCATCTC
Rattus_norvegicus|35328            GGAATTTTAAACAAAAACATTAAAAGAAAA---------GAACAAATTCAGTATCATCTC
Oryctolagus_cuniculus|3644         ACAATTTTGAGTAATAGTATTAAAGACAAA---------GAACAAATTCAATATCATCTC
Oryctolagus_cuniculus|26862        GCAATTTTGAGTAACACTATTAAAGACAAA---------GAACAAATTCAATATCATCTC
Callithrix_jacchus|32018           ACAATTTTGATTAAGAGTATTAAAGAAAAA---------GAAGAAATACAATACCATCTC
Gorilla_gorilla|14798              ACAATTTTGAGTAACAGTATTAAAGAAAAA---------GAAGAAATACAATACCATCTC
Homo_sapiens|74063                 ACAATTTTGAGTAACAGTATTAAAGAAAAA---------GAAGAAATACAATACCATCTC
Pan_troglodytes|32047              ACAATTTTGAGTAACAGTATTAAAGAAAAA---------GAAGAAATACAATACCATCTC
Tupaia_belangeri|4317              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------NNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|3509              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------NNNNNNNNNNNNNNNNNNNNN
                                        ...                               .      .    .    . . 

Dipodomys_ordii|5129               AACTTCTTACATGAAAGTTTGATACAGGAATGTGAAACCCTGAAAGCGCCTCACAGAAAG
Ochotona_princeps|15176            AACTTTCTGAAGAAAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|2829            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|1425 NNNNNNNNNNNNNNNNNATTACTACAGTTGTGTGAAACTATGAAAGTCCCTCCCAGAAAG
Otolemur_garnettii|15115           AACTTACTGAAAAAAAGATTGCTACAATTTTGTGAAACCCTGGAAGTCCCTCCTGAAAAG
Otolemur_garnettii|17288           AACTTACTGAAGAAAAGATTGCTACAACTTTGTGAAATCCCGAAAGTCCCTCCTGAAAAA
Cavia_porcellus|16912              AACTGCCTGAAGAGAAGGTTGCTACAACTGTGTGAAACCCTGAAAGCCCCTCGCCAAAAG
Mus_musculus|17608                 AACCAGTTGAAGAAAAGACTACTACAACAATGTGCAACACTGAAAGTCCCTCCAAGAAAG
Rattus_norvegicus|35328            GACCAGTTGAAGAAAAGATTTCTGCAACAGTGTGCAACACTGAAAGTCCCCCCAGGAAAG
Oryctolagus_cuniculus|3644         AACTGTCTGAAGAAAAGGTTGCTACAACTGTATGAAACTCTCAAAGCCCCTTCCAAAAAG
Oryctolagus_cuniculus|26862        AACTGTCTGAAGAAAAGGTTGCTACAACTGTATGAAACTCTCAAAGCCCCTTCCAAAAAG
Callithrix_jacchus|32018           AATTTCCTAAAGAAAAGATTGCTACAACTGTGTGAAACTCTGAAAGTTCCTCCCAAAAAG
Gorilla_gorilla|14798              AACTTCCTGAAGAAAAGATTGCTACAACTGTGTGAAACTCTGAAAGTCCCTCCCAAAAAG
Homo_sapiens|74063                 AACTTCCTGAAGAAAAGATTGCTACAACAGTGTGAAACTCTGAAAGTCCCTCCCAAAAAG
Pan_troglodytes|32047              AACTTCCTGAAGAAAAGATTTCTACAAGTGTGTGAAACTCTGAAAGTCCCTCCCAAAAAG
Tupaia_belangeri|4317              NNNNNNNNNNNNNNNNNATTGTTGCAACGGTGTGAAACCCTGAAAGTCCCTCCAAAAAAG
Tarsius_syrichta|3509              NNNNNNNNNNNNNNNNNATTGCTACAAGTATGTGAAACCCTGGAAGTCCCTCCCAAAAAG
                                          .        .  .  .       . ..           .              

Dipodomys_ordii|5129               CTGAACTATTTAACTGATGTTTCAAATCTACTAAAGATGGAGCAGGCACAGGAAGTAGCT
Ochotona_princeps|15176            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|2829            NNNNNNNNN---------------------------------------------------
Spermophilus_tridecemlineatus|1425 CTGAAATATTTAACTAATGTTTCAAATCTACTGAAAATGGAAAAGGCACAAGAAACAGCT
Otolemur_garnettii|15115           CTGAAGGATTTAACTCACGTGTCAAGTCTGCTGGATGTGGAAAGGGCACGGGAGCAAGAT
Otolemur_garnettii|17288           CTGAAAGATTTGACTCCCGTGTCAAGTCTACTGAATGTGGAA------TTACAGGAGGCT
Cavia_porcellus|16912              CTAACATATTTAACTAATATGTCAAGTCTACTGAAGATAGAAAGAGCACAGGACAGAGCT
Mus_musculus|17608                 TTGAACTATTTAAAGGATGTGTCAAAAATGCTGAAAATGGAAAAGGCACAGGAAAGAGCA
Rattus_norvegicus|35328            CTCAACTATTTAAGAGATATGTCAAAGCTGCTGAAGGTGGAAAGGGAACAGGAAAGGGCG
Oryctolagus_cuniculus|3644         CTAAAAGATTTAACTAATGTGTCAAGTCTACTGAATATGGAAAGAGCACAAGAAAGAGTT
Oryctolagus_cuniculus|26862        CTAAAAGATTTAACTAATGTGTCAAGTCTACTGAATATGGAAAGAGCACAGGAAAGAGTT
Callithrix_jacchus|32018           ACAGAAGATTTAGCTAATGTGTCAAGTCTGCTGAATGTGGAAAGGGCACGAAACAAAGCT
Gorilla_gorilla|14798              ATGGAAGATTTAACTAATGTATCAAGTCTACTGAATATGGAAAGGGCACGAGACAAAGCT
Homo_sapiens|74063                 ATGGAAGATTTAACTAATGTATCAAGTCTACTGAATATGGAAAGGGCACGAGACAAAGCT
Pan_troglodytes|32047              ATGGAAGATTTAACTAATGTATCAAGTCTACTGAATATGGAAAGGGCACGAGACAAAGCT
Tupaia_belangeri|4317              CTGAAAGATTTAACTAACGTGTCAAGTCTACTGAAAATGGAAACAGTACAGAACAGAGCT
Tarsius_syrichta|3509              CTAAAAGATTTAACTAACGTGTCAAGTCTACTGAATATGGAAAGGGCACAGGAAAAAGCT
                                           .                                                   

Dipodomys_ordii|5129               AATGAAGCAAGTCTGATGTCATTGCAGGAAGAAATAAATAAAACAGTGGGAGCAATAGAA
Ochotona_princeps|15176            NNNNNNNNNNNNNNNNNNNNNNNNNNNGAAGAAATAGATAAAATAGTAGAGAATGCAGAG
Microcebus_murinus|2829            ------------------------NNNGAAGAAATAGATAAAATGGTAGAGACCACAGAG
Spermophilus_tridecemlineatus|1425 AATGAAGAAGGTCTGGCATTATTGCAGGAAGAAATAGATAAAATGGTAGAGACCACAGAA
Otolemur_garnettii|15115           AACGAAGAAGGTCTGGCATTACTGCAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|17288           AATAAAGCAGGTCTGGCATTACTGCAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|16912              AATGAAGAAGGAATGGCGTTATTGCAGGAAGAAATAGATAAAATAGTACAGACTACAGAG
Mus_musculus|17608                 AATGAAGAGAGCCTGGCTTCACTGCAGGAAGAAATAGACAAAATAGTAGAGACCACAGAG
Rattus_norvegicus|35328            AATGAGGAGAGCCTGGCTTCACTGCAGGAAGAAATAGACAAAATAGTAGAGACCACAGAG
Oryctolagus_cuniculus|3644         AATGAAGATGGTCTGACATTACTACAGGAAGAAATAGATAAACTAGTGGAGACCACAGAG
Oryctolagus_cuniculus|26862        AATGAAGATGGTCTGACATTACTACAGGAAGAAATAGATAAACTAGTGGAGACCACAGAG
Callithrix_jacchus|32018           AATGAAGAAAGTCTGGCATTACTGCAGGAAGAAATAGATAAAATGGTAGAGACTGCAGAG
Gorilla_gorilla|14798              AATGAAGAAGGTCTGGCATTACTACAGGAAGAAATAGATAAAATGGTAGAGACCACAGAG
Homo_sapiens|74063                 AATGAAGAAGGTCTGGCATTACTACAGGAAGAAATAGATAAAATGGTAGAGACCACAGAG
Pan_troglodytes|32047              AATGAAGAAGGTCTGGCATTACTACAGGAAGAAATAGATAAAATGGTAGAGACCACAGAG
Tupaia_belangeri|4317              AATGAAGAAGGTCTGGCATTACTGCAGGAAGAAACAGATAAAATAGTAGAGACCGTGGAG
Tarsius_syrichta|3509              AATAAAGAAGGTCTGGCATTACTGCAGGAAGAACTAGAAAAAATGGTAAAGAACACAGAG
                                                             ..  .              ..          .  

Dipodomys_ordii|5129               GTTATGAAAGAGAATATTGAAAGCATTAAAAGCAAAGTTCAAAAGTTGGCACGTGATACA
Ochotona_princeps|15176            GTGATGACGGGAAATATTCAGAGCCTCAAGAAAAAAATTCAGATTCTGGCAAATGAAGTG
Microcebus_murinus|2829            TTGATGACTGGGAATATTCAGAGCCTAAAGAACAAAATTGAAATTCTGGCAAGTGAGGTG
Spermophilus_tridecemlineatus|1425 TCAATGACTGAAAATATTCATAGACTAAAGAACAAAATTCAAATTGTGGCACATGAGGTA
Otolemur_garnettii|15115           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|17288           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|16912              TCAGTGACTGGGAATATTAAGAGTCTAAAAAACAAAATTGAAATTTTGACACATGAAATA
Mus_musculus|17608                 TCAATGACTGAGAGTATTCAAAGCCTAAAGAATAAAATTCAAATTTTGACAAGTGAAGTA
Rattus_norvegicus|35328            TCAATGACTGAGAATATTGAAAGCCTAAAGACCAAAATTGAAATCCTAACAAATGAAGTA
Oryctolagus_cuniculus|3644         TTGATGACTGGGAAGATTCAAAGCCTAAAGAACAAAATACGGATTCTGGCAAGTGAGGTG
Oryctolagus_cuniculus|26862        TTGATGACTGGGAAGATTCAGAGCCTAAAGAACAAAATACAGATTCTGGCAAGTGAGGTA
Callithrix_jacchus|32018           TTAATGACTGGGAATATTCAGAGGCTAGAGAACAAAATTGAAATTCTGGCAAGTGTGGTG
Gorilla_gorilla|14798              TTAATGACTGAGAATATTCAGAGCCTAAAGAACAAAATTCAGATTCTGGCAAGTGAGGTG
Homo_sapiens|74063                 TTAATGACTGGGAATATTCAGAGCCTAAAGAACAAAATTCAGATTCTGGCAAGTGAGGTG
Pan_troglodytes|32047              TTAATGACTGGGAATATTCAGAGCCTAAAGAACAAAATTAAGATTCTGGCAAGTGAGGTG
Tupaia_belangeri|4317              TCAGTAACTGGAAATATTCAGAGACTAAAGAACAAAATTCAAATTCTGACAAGTGAAGTG
Tarsius_syrichta|3509              TTGATGACTGAAAATATTCAGAATCTAACGAGCAAAATTCAGATTCTGGAAAGTGAGGTA
                                       .    .      ..       .           .        .      ..     

Dipodomys_ordii|5129               AAAAAAGAAGAGGAGATAATACAAAAGGTACATCAGTTAGGTACCAAAGGGCTACTTTCT
Ochotona_princeps|15176            GAAGAAGAGGAGCAGAAGGTAAACCATATGCTTCAAATGGGTGCTAGTGGGGTACTCTCG
Microcebus_murinus|2829            GAAGAAGAAGAGAAGACACTAAAACAGGTGCTCCAAGTGGATAGTAGTGGTGTACTTGCT
Spermophilus_tridecemlineatus|1425 GAAGAAGAGGAGGAGAAGGTAAAACAGATGCTTCAAATGGATAGTAGTGGGGTACTCTCT
Otolemur_garnettii|15115           NNN---NNNNNNNNNNNNNNNNNNNNNNNNCTTCAAATGGATAGTAGGAGTGTACTCTGT
Otolemur_garnettii|17288           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|16912              GAAGAGGAGGAGGAAAAGGCAAAAGAGGTGCTTCAACTGGATAGACATAACGTACTTTCT
Mus_musculus|17608                 GAAGAAGAGGAACAGGAGGTGAAACAGGTATTTCACATAGATAGCAATAAAGTACTTGCT
Rattus_norvegicus|35328            GAG---------------------------------------------------------
Oryctolagus_cuniculus|3644         GAAGAGGAGGAGCAGAAGGTAAAACATTTTTTATTGTTAGATAGTAGCGGGGTACTCTCT
Oryctolagus_cuniculus|26862        GAAGAGGAGGAGCAGAAG---------ATGCTTCAAATGAGTAGTAGCGGGGTACTCTCT
Callithrix_jacchus|32018           GAAGAAGAGGAGGAGAAGGTAAAACAGATGCATCAAATAAATAATAGCGGAGTCCTCTCT
Gorilla_gorilla|14798              GAAGAAGAAGAGGAGAGAGTAAAACAGATGCATCAAATAAATAGTAGTGGAGTACTCTCT
Homo_sapiens|74063                 GAAGAAGAAGAGGAGAGAGTAAAACAGATGCATCAAATAAATAGTAGTGGAGTACTCTCT
Pan_troglodytes|32047              GAAGAAGAAGAGGAGAGAGTAAAACAGATGCATCAAATAAATAGTAGTGGAGTACTCTCT
Tupaia_belangeri|4317              GAAGAAGAGGAGGAGAAGGTAAAACAGATGTTTCATATGGATAGCACTAGAGTACTGTCT
Tarsius_syrichta|3509              AAAGAAGAGGAGGAGAAGACAAAACAGGTGGCTGACATGGACAGTAATGGGGTACTCGCT
                                                                                               

Dipodomys_ordii|5129               CTTCCAAAACTTTGTCAGGAAAGTCTCAAAGCACCCACACTTCAAGAAGAAATTTTGGCA
Ochotona_princeps|15176            CTTCCACAACTTCCTCAGGACAGCCTTAAAGCACCTACACTTCAG---------------
Microcebus_murinus|2829            CTTCCAGAACTTTCTCAGAATAGTCTTAAAGCACCCATACTTCAGAAAGAAATTTTGGCA
Spermophilus_tridecemlineatus|1425 CTTCCAGAACTTTCTCAGAACAGTCTTAAAGCACCCACACTTCACAAAGAAATTTTGATG
Otolemur_garnettii|15115           CTTCCGGAACTTTCTCAGAAGAGTCTCAAAGCACCCACACTTCAGAAAGAAATTCTGTCA
Otolemur_garnettii|17288           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAGAAATTCTGTCA
Cavia_porcellus|16912              CTCCCAGAGCTGTCTCAGAACAGTCTAAAAACACCCACGCTGCAGAAAGAAATGTTGATG
Mus_musculus|17608                 CTTCCAGAACTTTCTCAGAAAAGTCTTAAAGCACCCATACTTCAAGAAGAAATTTTGGCA
Rattus_norvegicus|35328            ------------------------------------------------------------
Oryctolagus_cuniculus|3644         CTTCCACAGCTTTCTCAGAACAGTCTGAAAGCACCCACACTTCAGAAAGAAATTTTGACA
Oryctolagus_cuniculus|26862        CTTCCACAGCTTTCTCAGAACAGTCTGAAAGCACCCACACTTCAGAAAGAAATTTTGACA
Callithrix_jacchus|32018           CTTCCAGAACTTTCTCAGAAAACTCTCAAAGCACCCACACTTCAGAAAGAGATTTTGGCA
Gorilla_gorilla|14798              CTTCCGGAACTTTCTCAGAAAACTCTCAAAGCACCCACACTTCAGAACGAAATTTTGGCG
Homo_sapiens|74063                 CTTCCGGAACTTTCTCAGAAAACTCTCAAAGCACCCACACTTCAGAAAGAAATTTTGGCG
Pan_troglodytes|32047              CTTCCGGAACTTTCTCAGAAAACTCTCAAAGCACCCACACTTCAGAAAGAAATTTTGGCG
Tupaia_belangeri|4317              CTTCCAGAACTTCCTCAGAACAGTCTCAAAGCACCCACACTTCAGGAAGAAATTTTGACA
Tarsius_syrichta|3509              CTTCCAAACCTTTCTCAAAAGAGTCTCAAAGCACCCATCCTTCAGAAAGAAATTTTGACA
                                                                                               

Dipodomys_ordii|5129               ATGATTCCAAACCAGAAAGCTCTTCTAAAGGACTTGAATGTTCTTCACAATTCATCCCAA
Ochotona_princeps|15176            ------------------------------------------------------------
Microcebus_murinus|2829            CTAATTCCAAACCAGAAAGCTCTTCTAAAGGACTTGGATATTCTTCATAATTCATCCCAG
Spermophilus_tridecemlineatus|1425 CTAATTCCAAACCAAAATGCTCTTCTAAAGGACTTGGATGTTCTTCACAGTTCATCCCAG
Otolemur_garnettii|15115           CTAATTCCAAACCAGAATGCTCTTCTAAAGGACTTGGATGTTCTTCATAATTCCTCCCAG
Otolemur_garnettii|17288           CTAATTCCAAACCAGAATGCTCTTCTAAAGGACTTGGATGTTCTTCATAATTCCTCCCAG
Cavia_porcellus|16912              CTAATTCCAAACCAGAAGGTTCTTCTGAAAGACTTGGATATTCTTCATAATTCATCCCAG
Mus_musculus|17608                 CTAATTCCAAACCAGAATGCTCTTCTGAAGGACTTGGATGTTCTTCATGATTCAGCCCCA
Rattus_norvegicus|35328            ------------------------------------------------------------
Oryctolagus_cuniculus|3644         CTAATTCCAAACCAGGATGCTCTCCTAAAGGACTTGGATGTTCTTCATACTTCATCCGAG
Oryctolagus_cuniculus|26862        CTAATTCCAAACCAGGATGCTCTCCTAAAGGACTTGGATGTTCTTCATACTTCATCCGAG
Callithrix_jacchus|32018           CTAATTCCAAACCAGAATGCTCTTCTAAAGGACTTGGATATTCTTCATAATTCATCACAG
Gorilla_gorilla|14798              CTAATTCCAAACCAGAATGCTCTTCTAAAGGACTTGGATATTCTTCATAATTCATCACAG
Homo_sapiens|74063                 CTAATTCCAAACCAGAATGCTCTTCTAAAGGACTTGGATATTCTTCATAATTCATCACAG
Pan_troglodytes|32047              CTAATTCCAAACCAGAATGCTCTTCTAAGGGACTTGGATATTCTTCATAATTCATCACAG
Tupaia_belangeri|4317              CTAATTCCAAACCATAACGCTCTTCTAAAAGACTTGGATGTTCTTCATAATTCATCACAG
Tarsius_syrichta|3509              ATAATTCCAAACCAGGATGCTCTTCTAAAGGACTTGGATATTCTTCATAATTCGTCCCAG
                                                                                               

Dipodomys_ordii|5129               GTGCAGAGCATGTCAGCATTCATTGAAGAAGCTTATGAGAAACTAGATCCTTCTTGA
Ochotona_princeps|15176            ---------------------------------------------------------
Microcebus_murinus|2829            ATTAAGGACATGTTAATGTTCATTGAAGAAGCCTATAAGAAATTGGATGCCACTTGA
Spermophilus_tridecemlineatus|1425 ATGAAGAACTTGTCAATGTTCATCGAAGAAGCCTATAAGAAACTAGATGCCTCGTAA
Otolemur_garnettii|15115           ATTAAGAACATGGTAACACCCATTGAGGAAGCCTATAAGAAACTAGATGCCACCTGA
Otolemur_garnettii|17288           ATTAAGAACATGGTGACGCTCATTGAGGAAGCCTATAAGAAACTGGATGCCACCTGA
Cavia_porcellus|16912              ATGAAGAACATGGCAATGTTCATTGAAGAAGCCTATAAGAAACTAAATGCC------
Mus_musculus|17608                 GTGAAGAATGTGTCAGCATTCATTGAAGAAGCCTATAAGAAACTTGACTCC---TAA
Rattus_norvegicus|35328            ---------------------------------------------------------
Oryctolagus_cuniculus|3644         GTGAAAAACATGTTAATCTTCATTGAAGAAGCCTATAAGAAACTAGATGCC------
Oryctolagus_cuniculus|26862        ATT------------------------------------------------------
Callithrix_jacchus|32018           ATGAAGAGCATGTTAACATTCATTGAAGAAGCCTATAAGAAACTGGATGCCTCTTAA
Gorilla_gorilla|14798              ATGAAGAGCATGTCAACCTTCATTGAAGAAGCCTATAAGAAACTGGATGCATCTTAA
Homo_sapiens|74063                 ATGAAGAGCATGTCAACCTTCATTGAAGAAGCCTATAAGAAACTGGATGCATCTTAA
Pan_troglodytes|32047              ATGAAGAGCATGTCAACCTTCATTGAAGAAGCCTATAAGAAACTGGATGCATCTTAA
Tupaia_belangeri|4317              ATGAAGAACTTACTAACATTCATCGAAGAAGCCTATAAGAAATTGGATGCCTCTTAA
Tarsius_syrichta|3509              ATTAAGGATATGTCAGTATTCATTGAAGAAGCCTATAAGAAACTAGATGCCTCTTAA
                                                                                            

multiple sequence alignment in CLUSTALW format


Dipodomys_ordii|4804               --MPTKTTDSKKKAQ-----LKNRKSDEEGNL--SEKKXXXXXXXXXXXXXXXXXX---X
Ochotona_princeps|13231            --MLGKSSVSKK-TQQEKRNPKRKLDDEETKL--PEKEXXXXXXXXXXXXXXXXXX----
Microcebus_murinus|2404            ----VRNTAKRKQNHPKHLSPE-------XXX--XXXXXXXXXXXXXXXXXXXXXX---X
Spermophilus_tridecemlineatus|1279 --MPGKANAKK-------RSSKRKFFYEAAEF--SAKQXXXXXXXXXXXXXXXXXX---X
Otolemur_garnettii|13006           --MPGKPHVSKKKSQQLKRNSKRKTDDDE-EL--SEKKVRNTGKRNKNHPNHLSSK---G
Otolemur_garnettii|14870           ------------------------------------------------------------
Cavia_porcellus|13334              IKMRDKANNSRKKPQQMKWSSQRKWSFIT-RL--VKNSLVRSTKRIKNHPKHTSSEVITG
Mus_musculus|17713                 MKMSGKARASRKKPQQVKRSLKQRANKEA-DL--PENEVGNTAKRNRSHAKHLSSKV-TG
Rattus_norvegicus|21597            --MSGKANTSKKKSQRVKRNVKQRADKEDEELDSPENKVGNRAKRNRSHAGHLSSK---E
Oryctolagus_cuniculus|17122        MKMPGKTNVSKK-SQQLKRNPKRKIDDEEVKL--PEKEVRKTVKRNKNHTKRLSSE---A
Oryctolagus_cuniculus|15382        --MPGKTNVSKK-SQQVKRNPKRKIDDEEVKL--PEKEVRKTVKRNKNHTKRLSSE---G
Callithrix_jacchus|23911           --MSDKAGASKKNSQELKRNPKRKKDSEEVVL--SEKKFRNTMKRNKNHLKDLSSE---G
Gorilla_gorilla|12002              --MSGKANASKKNAQQLKRNPKRKKDNEEVVL--SENKVRNTVKKNKNHLKDLSSE---G
Homo_sapiens|67741                 --MSGKANASKKNAQQLKRNPKRKKDNEEVVL--SENKVRNTVKKNKNHLKDLSSE---G
Pan_troglodytes|24920              --MSGKANASKKNAQQLKRNPKRKKDNEEVVL--SENK----------------------
Tupaia_belangeri|3737              --MPGKASASKKKSQQLKRNPKKKADEEEVGF--SEKEVRNTAKRNKNHLKRLSSE---G
Tarsius_syrichta|3220              --MSGKANTFKKASQQLKRNPKRKTDDEEAKV--SEKKVRNTVKRN-NHTKHLSSE---G
                                                                                               

Dipodomys_ordii|4804               QVKCTQLKQIKIASKKRKSWQPLPKSTKEHLQIKIESVMLATLGQAKKSKQQIEQIQYHL
Ochotona_princeps|13231            --XQANLKRVKISVNKRRTWQPLSSNTREHLQTVMESVIIAILSKSIKDK---EQIQYHL
Microcebus_murinus|2404            XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXX
Spermophilus_tridecemlineatus|1279 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXX
Otolemur_garnettii|13006           QTKHTNIKQIKIAPNKRKTWQPLSKSSREHLQTIMESVIITILSNSKREK---EEIQYHL
Otolemur_garnettii|14870           -TKHTNIKQIKIVPNKRKTWQPLSKGSRKHLQTIMESEI-TILNNRSREK---EEMLYHL
Cavia_porcellus|13334              QTNHINLKQIKIASNKRKTWQPLSKSMREHLETVIEAVIIAILSNT-KEK---EPIQCHL
Mus_musculus|17713                 QATYVHLKRVKISSSKRTTWQPLPKDTEEYLQSMMESVILGILFN-IKRK---EEIQCHL
Rattus_norvegicus|21597            QTKCVHLKRVKISSNKRTAWQPLPKNTEEYLQSMMDSAILGILNKNIKRK---EQIQYHL
Oryctolagus_cuniculus|17122        MTGQTNLKRVKISSTKRKTWQPLSRSTREHLQTMMESVIITILSNSIKDK---EQIQYHL
Oryctolagus_cuniculus|15382        QT---NLKRVKISSTKRKTWQPLSRSTREHLQTMMESVIIAILSNTIKDK---EQIQYHL
Callithrix_jacchus|23911           QTRHTNLKQVKTASSKRKTWQPLSKSSRDNLQTMMESVIITILIKSIKEK---EEIQYHL
Gorilla_gorilla|12002              QTKHTNLKHVKIAASKRKTWQPLSKSTRDHLQTMMESVIMTILSNSIKEK---EEIQYHL
Homo_sapiens|67741                 QTKHTNLKHGKTAASKRKTWQPLSKSTRDHLQTMMESVIMTILSNSIKEK---EEIQYHL
Pan_troglodytes|24920              QTKHTNLKHVKIAASKRKTWQPLSKSTRDHLQTMMESVIMTILSNSIKEK---EEIQYHL
Tupaia_belangeri|3737              QTEH--LRQIKITSKKRKTWHSLSKSTREHLLAIIESAVXXXXXXXXXXX---XXXXXXX
Tarsius_syrichta|3220              QTKHTNIKQVKIASIKRKTWQPVSKSSREHLGTIMESVIXXXXXXXXXXX---XXXXXXX
                                                                                               

Dipodomys_ordii|4804               NFLHESLIQECETLKAPHRKLNYLTDVSNLLKMEQAQEVANEASLMSLQEEINKTVGAIE
Ochotona_princeps|13231            NFLKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEIDKIVENAE
Microcebus_murinus|2404            XXXXXXXXXXXXXXXXXXXXXXX-------------------------XEEIDKMVETTE
Spermophilus_tridecemlineatus|1279 XXXXXXLLQLCETMKVPPRKLKYLTNVSNLLKMEKAQETANEEGLALLQEEIDKMVETTE
Otolemur_garnettii|13006           NLLKKRLLQFCETLEVPPEKLKDLTHVSSLLDVERAREQDNEEGLALLQXXXXXXXXXXX
Otolemur_garnettii|14870           NLLKKRLLQLCEIPKVPPEKLKDLTPVSSLLNVE--LQEANKAGLALLQXXXXXXXXXXX
Cavia_porcellus|13334              NCLKRRLLQLCETLKAPRQKLTYLTNMSSLLKIERAQDRANEEGMALLQEEIDKIVQTTE
Mus_musculus|17713                 NQLKKRLLQQCATLKVPPRKLNYLKDVSKMLKMEKAQERANEESLASLQEEIDKIVETTE
Rattus_norvegicus|21597            DQLKKRFLQQCATLKVPPGKLNYLRDMSKLLKVEREQERANEESLASLQEEIDKIVETTE
Oryctolagus_cuniculus|17122        NCLKKRLLQLYETLKAPSKKLKDLTNVSSLLNMERAQERVNEDGLTLLQEEIDKLVETTE
Oryctolagus_cuniculus|15382        NCLKKRLLQLYETLKAPSKKLKDLTNVSSLLNMERAQERVNEDGLTLLQEEIDKLVETTE
Callithrix_jacchus|23911           NFLKKRLLQLCETLKVPPKKTEDLANVSSLLNVERARNKANEESLALLQEEIDKMVETAE
Gorilla_gorilla|12002              NFLKKRLLQLCETLKVPPKKMEDLTNVSSLLNMERARDKANEEGLALLQEEIDKMVETTE
Homo_sapiens|67741                 NFLKKRLLQQCETLKVPPKKMEDLTNVSSLLNMERARDKANEEGLALLQEEIDKMVETTE
Pan_troglodytes|24920              NFLKKRFLQVCETLKVPPKKMEDLTNVSSLLNMERARDKANEEGLALLQEEIDKMVETTE
Tupaia_belangeri|3737              XXXXXXLLQRCETLKVPPKKLKDLTNVSSLLKMETVQNRANEEGLALLQEETDKIVETVE
Tarsius_syrichta|3220              XXXXXXLLQVCETLEVPPKKLKDLTNVSSLLNMERAQEKANKEGLALLQEELEKMVKNTE
                                                                                               

Dipodomys_ordii|4804               VMKENIESIKSKVQKLARDTKKEEEIIQKVHQLGTKGLLSLPKLCQESLKAPTLQEEILA
Ochotona_princeps|13231            VMTGNIQSLKKKIQILANEVEEEEQKVNHMLQMGASGVLSLPQLPQDSLKAPTLQ-----
Microcebus_murinus|2404            LMTGNIQSLKNKIEILASEVEEEEKTLKQVLQVDSSGVLALPELSQNSLKAPILQKEILA
Spermophilus_tridecemlineatus|1279 SMTENIHRLKNKIQIVAHEVEEEEEKVKQMLQMDSSGVLSLPELSQNSLKAPTLHKEILM
Otolemur_garnettii|13006           XXXXXXXXXXXXXXXXXXXXX-XXXXXXXXLQMDSRSVLCLPELSQKSLKAPTLQKEILS
Otolemur_garnettii|14870           XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEILS
Cavia_porcellus|13334              SVTGNIKSLKNKIEILTHEIEEEEEKAKEVLQLDRHNVLSLPELSQNSLKTPTLQKEMLM
Mus_musculus|17713                 SMTESIQSLKNKIQILTSEVEEEEQEVKQVFHIDSNKVLALPELSQKSLKAPILQEEILA
Rattus_norvegicus|21597            SMTENIESLKTKIEILTNEVE---------------------------------------
Oryctolagus_cuniculus|17122        LMTGKIQSLKNKIRILASEVEEEEQKVKHFLLLDSSGVLSLPQLSQNSLKAPTLQKEILT
Oryctolagus_cuniculus|15382        LMTGKIQSLKNKIQILASEVEEEEQK---MLQMSSSGVLSLPQLSQNSLKAPTLQKEILT
Callithrix_jacchus|23911           LMTGNIQRLENKIEILASVVEEEEEKVKQMHQINNSGVLSLPELSQKTLKAPTLQKEILA
Gorilla_gorilla|12002              LMTENIQSLKNKIQILASEVEEEEERVKQMHQINSSGVLSLPELSQKTLKAPTLQNEILA
Homo_sapiens|67741                 LMTGNIQSLKNKIQILASEVEEEEERVKQMHQINSSGVLSLPELSQKTLKAPTLQKEILA
Pan_troglodytes|24920              LMTGNIQSLKNKIKILASEVEEEEERVKQMHQINSSGVLSLPELSQKTLKAPTLQKEILA
Tupaia_belangeri|3737              SVTGNIQRLKNKIQILTSEVEEEEEKVKQMFHMDSTRVLSLPELPQNSLKAPTLQEEILT
Tarsius_syrichta|3220              LMTENIQNLTSKIQILESEVKEEEEKTKQVADMDSNGVLALPNLSQKSLKAPILQKEILT
                                                                                               

Dipodomys_ordii|4804               MIPNQKALLKDLNVLHNSSQVQSMSAFIEEAYEKLDPS
Ochotona_princeps|13231            --------------------------------------
Microcebus_murinus|2404            LIPNQKALLKDLDILHNSSQIKDMLMFIEEAYKKLDAT
Spermophilus_tridecemlineatus|1279 LIPNQNALLKDLDVLHSSSQMKNLSMFIEEAYKKLDAS
Otolemur_garnettii|13006           LIPNQNALLKDLDVLHNSSQIKNMVTPIEEAYKKLDAT
Otolemur_garnettii|14870           LIPNQNALLKDLDVLHNSSQIKNMVTLIEEAYKKLDAT
Cavia_porcellus|13334              LIPNQKVLLKDLDILHNSSQMKNMAMFIEEAYKKLNA-
Mus_musculus|17713                 LIPNQNALLKDLDVLHDSAPVKNVSAFIEEAYKKLDS-
Rattus_norvegicus|21597            --------------------------------------
Oryctolagus_cuniculus|17122        LIPNQDALLKDLDVLHTSSEVKNMLIFIEEAYKKLDA-
Oryctolagus_cuniculus|15382        LIPNQDALLKDLDVLHTSSEI-----------------
Callithrix_jacchus|23911           LIPNQNALLKDLDILHNSSQMKSMLTFIEEAYKKLDAS
Gorilla_gorilla|12002              LIPNQNALLKDLDILHNSSQMKSMSTFIEEAYKKLDAS
Homo_sapiens|67741                 LIPNQNALLKDLDILHNSSQMKSMSTFIEEAYKKLDAS
Pan_troglodytes|24920              LIPNQNALLRDLDILHNSSQMKSMSTFIEEAYKKLDAS
Tupaia_belangeri|3737              LIPNHNALLKDLDVLHNSSQMKNLLTFIEEAYKKLDAS
Tarsius_syrichta|3220              IIPNQDALLKDLDILHNSSQIKDMSVFIEEAYKKLDAS