Orthologs Set ID: EOG4003HZ


Orthology Database
OrthoDB4
Gene Symbol(s)
RAB11B

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 20019 39, 236, 430, 486
Cavia porcellus 8318 40, 236, 430, 511
Dipodomys ordii 6163 40, 236, 430, 511
Gorilla gorilla 27326 40, 236, 430, 511
Homo sapiens 38292 40, 236, 430, 511
Mus musculus 17228 40, 236, 430, 511
Otolemur garnettii 3339 40, 236, 430, 511
Pan troglodytes 18215 40, 236, 430, 511
Rattus norvegicus 31330 40, 236, 430, 511
Tupaia belangeri 652 40, 236, 430, 511

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 20019 ENSCJAT00000021019 100415694 ENSCJAG00000010778 RAB11B calJac3
Cavia porcellus 8318 ENSCPOT00000028204 100713700 ENSCPOG00000021908 RAB11B cavPor3
Dipodomys ordii 6163 ENSDORT00000006305 ENSDORG00000006304 Rab11b dipOrd1
Gorilla gorilla 27326 ENSGGOT00000014564 101133992 ENSGGOG00000014516 RAB11B gorGor3
Homo sapiens 38292 ENST00000328024 9230 ENSG00000185236 RAB11B hg19,GRCh37
Mus musculus 17228 ENSMUST00000057373 19326 ENSMUSG00000077450 Rab11b mm9
Otolemur garnettii 3339 ENSOGAT00000003230 ENSOGAG00000003227 RAB11B otoGar1
Pan troglodytes 18215 ENSPTRT00000019157 743711 ENSPTRG00000010422 RAB11B panTro2
Rattus norvegicus 31330 ENSRNOT00000010197, NM_032617 79434 ENSRNOG00000007648 Rab11b rn4
Tupaia belangeri 652 ENSTBET00000000653 ENSTBEG00000000667 RAB11B tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 12445 ENSCJAP00000019889 100415694 ENSCJAG00000010778 RAB11B calJac3
Cavia porcellus 6510 ENSCPOP00000019558 100713700 ENSCPOG00000021908 RAB11B cavPor3
Dipodomys ordii 5788 ENSDORP00000005901 ENSDORG00000006304 Rab11b dipOrd1
Gorilla gorilla 21250 ENSGGOP00000014156 101133992 ENSGGOG00000014516 RAB11B gorGor3
Homo sapiens 79461 ENSP00000333547 9230 ENSG00000185236 RAB11B hg19,GRCh37
Mus musculus 13807 ENSMUSP00000110021 19326 ENSMUSG00000077450 Rab11b mm9
Otolemur garnettii 2882 ENSOGAP00000002883 ENSOGAG00000003227 RAB11B otoGar1
Pan troglodytes 7549 ENSPTRP00000017733 743711 ENSPTRG00000010422 RAB11B panTro2
Rattus norvegicus 2500 ENSRNOP00000010197 79434 ENSRNOG00000007648 Rab11b rn4
Tupaia belangeri 580 ENSTBEP00000000567 ENSTBEG00000000667 RAB11B tupBel1

multiple sequence alignment in CLUSTALW format


Otolemur_garnettii|3339  ATGGGGACCCGGGACGACGAATATGACTACCTATTCAAAGNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|652     ATGGGGACCCGGGACGACGAGTACGACTACCTCTTCAAAGNNNNNNNNNNNNNNNNNNNN
Callithrix_jacchus|20019 ATGGGGACTCGGGACGACGAGTACGACTACCTATTCAAAGTGGTGCTCATCGGGGACTCG
Mus_musculus|17228       ATGGGGACCCGGGACGACGAGTACGATTACCTATTCAAAGTGGTGCTTATTGGGGACTCA
Dipodomys_ordii|6163     ATGGGGACCCGGGACGATGAGTACGACTACCTATTCAAAGTGGTGCTCATCGGGGACTCG
Cavia_porcellus|8318     ATGGGGACCCGGGACGACGAGTACGACTACCTATTCAAAGTGGTGCTCATTGGAGACTCC
Gorilla_gorilla|27326    ATGGGGACCCGGGACGACGAGTATGACTACCTATTCAAAGTGGTGCTCATCGGGGACTCA
Homo_sapiens|38292       ATGGGGACCCGGGACGACGAGTACGACTACCTATTCAAAGTGGTGCTCATCGGGGACTCA
Pan_troglodytes|18215    ATGGGGACCCGGGACGACGAGTACGACTACCTATTCAAAGTGGTGCTCATCGGGGACTCA
Rattus_norvegicus|31330  ATGGGGACCCGGGACGACGAGTACGATTACCTATTCAAAGTGGTGCTTATTGGGGACTCA
                         ******** ******** **.** ** *****.*******..... .  . .. .  .  

Otolemur_garnettii|3339  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|652     NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Callithrix_jacchus|20019 GGCGTGGGCAAGAGCAACCTGCTGTCCCGCTTCACCCGCAACGAGTTCAACCTGGAGAGC
Mus_musculus|17228       GGTGTAGGTAAGAGCAACCTGCTGTCACGCTTCACCAGAAACGAATTCAACCTAGAGAGC
Dipodomys_ordii|6163     GGTGTGGGCAAGAGCAACCTGCTGTCCCGCTTCACCCGCAACGAGTTCAACCTGGAGAGC
Cavia_porcellus|8318     GGCGTGGGAAAGAGCAACCTGCTGTCACGCTTCACCCGCAACGAGTTCAACCTGGAGAGC
Gorilla_gorilla|27326    GGCGTGGGCAAGAGCAACCTGCTGTCGCGCTTCACCCGCAACGAGTTCAACCTGGAGAGC
Homo_sapiens|38292       GGCGTGGGCAAGAGCAACCTGCTGTCGCGCTTCACCCGCAACGAGTTCAACCTGGAGAGC
Pan_troglodytes|18215    GGCGTGGGCAAGAGCAACCTGCTGTCGCGCTTCACCCGCAACGAGTTCAACCTGGAGAGC
Rattus_norvegicus|31330  GGTGTAGGTAAGAGCAACCTGCTGTCACGCTTCACCAGAAACGAGTTCAACCTAGAGAGC
                         .. .. ..   . .     .. ...   . ..     .    .  ..     . . . . 

Otolemur_garnettii|3339  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|652     NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Callithrix_jacchus|20019 AAGAGCACCATTGGCGTGGAGTTCGCCACCCGCAGCATCCAGGTGGACGGCAAGACCATC
Mus_musculus|17228       AAGAGTACCATCGGAGTGGAGTTCGCCACTCGCAGCATTCAGGTGGACGGCAAGACCATC
Dipodomys_ordii|6163     AAGAGCACCATAGGCGTGGAGTTCGCCACACGCAGCATCCAAGTGGACGGCAAGACCATC
Cavia_porcellus|8318     AAGAGCACCATCGGCGTCGAGTTCGCCACCCGCAGCATCCAGGTGGACGGCAAGACCATC
Gorilla_gorilla|27326    AAGAGCACCATCGGCGTGGAGTTCGCCACCCGCAGCATCCAGGTGGACGGCAAGACCATC
Homo_sapiens|38292       AAGAGCACCATCGGCGTGGAGTTCGCCACCCGCAGCATCCAGGTGGACGGCAAGACCATC
Pan_troglodytes|18215    AAGAGCACCATCGGCGTGGAGTTCGCCACCCGCAGCATCCAGGTGGACGGCAAGACCATC
Rattus_norvegicus|31330  AAGAGCACCATTGGAGTGGAGTTTGCCACTCGCAGCATTCAGGTGGACGGCAAGACCATC
                           . .     . .. .. . ... .      .  .  .    ....  ..   .    . 

Otolemur_garnettii|3339  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTAC
Tupaia_belangeri|652     NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTAC
Callithrix_jacchus|20019 AAGGCACAGATCTGGGACACCGCCGGCCAGGAGCGCTACCGCGCCATCACCTCCGCGTAC
Mus_musculus|17228       AAGGCTCAGATCTGGGACACTGCTGGCCAGGAGCGCTACCGTGCCATTACCTCTGCGTAC
Dipodomys_ordii|6163     AAGGCACAGATCTGGGACACAGCCGGCCAGGAGCGCTACCGGGCCATCACCTCCGCGTAC
Cavia_porcellus|8318     AAGGCGCAGATCTGGGACACGGCTGGCCAGGAGCGCTACCGCGCCATCACCTCTGCGTAC
Gorilla_gorilla|27326    AAGGCGCAGATCTGGGACACCGCTGGCCAGGAGCGCTACCGCGCCATCACCTCTGCGTAC
Homo_sapiens|38292       AAGGCGCAGATCTGGGACACCGCTGGCCAGGAGCGCTACCGCGCCATCACCTCCGCGTAC
Pan_troglodytes|18215    AAGGCGCAGATCTGGGACACCGCTGGCCAGGAGCGCTACCGCGCCATCACCTCCGCGTAC
Rattus_norvegicus|31330  AAGGCTCAGATCTGGGATACTGCTGGCCAGGAGCGCTACCGTGCCATTACCTCTGCGTAC
                           ..    . . ....     .  ..   .. . . .   . .   .    .  . ****

Otolemur_garnettii|3339  TATCGTGGTGCTGTGGGTGCCCTGCTGGTGTATGACATCGCCAAACACCTGACCTATGAG
Tupaia_belangeri|652     TACCGAGGCGCGGTGGGCGCCCTGTTGGTCTACGACATTGCCAAGCACCTGACCTACGAG
Callithrix_jacchus|20019 TACCGCGGTGCTGTGGGCGCCCTGCTGGTATATGACATCGCCAAGCACCTGACTTACGAG
Mus_musculus|17228       TACCGTGGTGCAGTGGGTGCACTGCTGGTATATGACATTGCCAAGCACTTGACATATGAG
Dipodomys_ordii|6163     TATCGTGGTGCAGTGGGTGCCCTACTGGTGTACGACATTGCCAAGCACCTGACCTATGAG
Cavia_porcellus|8318     TACCGTGGCGCGGTGGGCGCTCTGCTGGTCTATGACATTGCCAAGCACCTTACCTATGAG
Gorilla_gorilla|27326    TACCGTGGCGCAGTGGGCGCCCTGCTGGTGTACGACATCGCCAAGCACCTGACCTATGAG
Homo_sapiens|38292       TACCGTGGTGCAGTGGGCGCCCTGCTGGTGTACGACATCGCCAAGCACCTGACCTATGAG
Pan_troglodytes|18215    TACCGTGGTGCAGTGGGCGCCCTGCTGGTGTACGACATCGCCAAGCACCTGACCTATGAA
Rattus_norvegicus|31330  TACCGTGGTGCAGTGGGTGCACTGCTGGTATATGACATTGCCAAGCACTTGACATATGAG
                         ** ** ** ** ***** ** **. **** ** ***** *****.*** * ** ** **.

Otolemur_garnettii|3339  AACGTGGAGCGCTGGCTGAAGGAGCTTCGGGACCATGCTGACAGCAACATCGTCATCATG
Tupaia_belangeri|652     AACGTGGAGCGCTGGCTGAAGGAGCTGCGGGACCACGCGGACAGCAACATCGTCATCATG
Callithrix_jacchus|20019 AACGTGGAGCGCTGGCTGAAGGAGCTTCGGGACCATGCAGATAGCAACATCGTCATTATG
Mus_musculus|17228       AACGTGGAGCGCTGGCTGAAGGAGCTGCGGGATCATGCAGATAGCAACATTGTCATCATG
Dipodomys_ordii|6163     AACGTGGAGCGCTGGCTGAAGGAGCTGCGTGACCATGCCGACAGCAACATTGTCATCATG
Cavia_porcellus|8318     AACGTGGAGCGCTGGCTGAAGGAGCTGCGGGACCATGCGGACAGCAACATTGTCATCATG
Gorilla_gorilla|27326    AACGTGGAGCGCTGGCTGAAGGAGCTGCGGGACCACGCAGACAGCAACATCGTCATCATG
Homo_sapiens|38292       AACGTGGAGCGCTGGCTGAAGGAGCTGCGGGACCACGCAGACAGCAACATCGTCATCATG
Pan_troglodytes|18215    AACGTGGAGCGCTGGCTGAAGGAGCTGCGGGACCACGCAGACAGCAACATCGTCATCATG
Rattus_norvegicus|31330  AATGTGGAGCGCTGGCTGAAGGAGCTGCGGGATCATGCAGATAGCAACATTGTTATCATG
                         ** *********************** ** ** ** ** ** ******** ** ** ***

Otolemur_garnettii|3339  CTGGTGGGCAACAAGAGTGACCTGCGCCACCTGCGAGCTGTGCCTACTGACGAGGCCCGC
Tupaia_belangeri|652     CTGGTGGGCAACAAGAGCGACCTGCGCCACCTGCGGGCCGTGCCCACCGACGAGGCCCGC
Callithrix_jacchus|20019 CTGGTGGGGAACAAGAGTGACTTGCGCCACCTGCGGGCTGTGCCCACCGACGAGGCCCGG
Mus_musculus|17228       CTGGTGGGCAACAAGAGTGACCTGCGCCACCTTCGGGCTGTGCCCACTGATGAGGCCCGT
Dipodomys_ordii|6163     TTGGTGGGCAACAAGAGCGACCTGCGCCACCTGCGGGCTGTGCCCACCGACGAGGCCCGC
Cavia_porcellus|8318     CTGGTGGGCAACAAGAGCGACCTGCGCCACCTGCGGGCTGTGCCCACTGACGAGGCTCGA
Gorilla_gorilla|27326    CTGGTGGGCAACAAGAGTGACCTGCGCCACCTGCGGGCTGTGCCCACTGACGAGGCCCGC
Homo_sapiens|38292       CTGGTGGGCAACAAGAGTGACCTGCGCCACCTGCGGGCTGTGCCCACTGACGAGGCCCGC
Pan_troglodytes|18215    CTGGTGGGCAACAAGAGTGACCTGCGCCACCTGCGGGCTGTGCCCACTGACGAGGCCCGC
Rattus_norvegicus|31330  CTGGTGGGCAACAAGAGCGACCTGCGCCATCTTCGGGCTGTGCCCACTGACGAGGCCCGT
                          ******* ******** *** ******* ** **.** ***** ** ** ***** ** 

Otolemur_garnettii|3339  GCCTTTGCAGAAAAGAACAACTTGTCCTTCATTGAGACTTCAGCTTTGGATTCCACCAAC
Tupaia_belangeri|652     GCCTTCGCAGAAAAGAACAACTTGTCCTTCATTGAGACCTCGGCCTTGGACTCCACCAAC
Callithrix_jacchus|20019 GCCTTCGCAGAAAAGAACAACTTGTCCTTCATCGAAACCTCGGCCTTGGATTCCACCAAC
Mus_musculus|17228       GCCTTTGCAGAAAAGAACAACTTGTCCTTCATTGAGACCTCAGCCTTGGATTCCACCAAT
Dipodomys_ordii|6163     GCCTTTGCAGAAAAGAACAACTTGTCCTTCATTGAGACCTCAGCTTTGGATTCTACCAAC
Cavia_porcellus|8318     GCCTTTGCAGAAAAGAACAACCTGTCCTTCATTGAGACCTCAGCCTTGGACTCCACCAAC
Gorilla_gorilla|27326    GCCTTCGCAGAAAAGAACAACTTGTCCTTCATCGAGACCTCAGCCTTGGATTCCACTAAC
Homo_sapiens|38292       GCCTTCGCAGAAAAGAACAACTTGTCCTTCATCGAGACCTCAGCCTTGGATTCCACTAAC
Pan_troglodytes|18215    GCCTTCGCAGAAAAGAACAACTTGTCTTTCATCGAGACCTCAGCCTTGGATTCCACTAAC
Rattus_norvegicus|31330  GCCTTTGCAGAAAAGAACAACTTGTCCTTCATTGAGACCTCAGCCTTGGATTCCACCAAT
                         ***** *************** **** ***** **.** **.** ***** ** ** ** 

Otolemur_garnettii|3339  GTAGAAGAAGCATTCAAGAACATCCTCACAGAGATCTACAGAATTGTGTCCCAAAAGCAG
Tupaia_belangeri|652     GTGGAGGAGGCTTTCAAGAACATCCTCACAGAGATCTACCGCATCGTGTCCCAGAAGCAG
Callithrix_jacchus|20019 GTAGAGGAAGCCTTCAAGAACATTCTCACAGAGATCTACCACATCATGTCACAGAAACAG
Mus_musculus|17228       GTAGAGGAAGCATTCAAGAACATCCTCACAGAAATCTACCGTATTGTGTCACAGAAGCAA
Dipodomys_ordii|6163     GTAGAAGAAGCATTCAAGAACATTCTTACAGAGATCTACCGCATTGTGTCACAGAAGCAA
Cavia_porcellus|8318     GTAGAGGAAGCGTTCAAGAACATCCTCACAGAAATCTACCGCATCGTGTCACAGAAGCAG
Gorilla_gorilla|27326    GTAGAGGAAGCATTCAAGAACATCCTCACAGAGATCTACCGCATCGTGTCACAGAAACAG
Homo_sapiens|38292       GTAGAGGAAGCATTCAAGAACATCCTCACAGAGATCTACCGCATCGTGTCACAGAAACAG
Pan_troglodytes|18215    GTAGAGGAAGCATTCAAGAACATCCTCACAGAGATCTACCGCATCGTGTCACAGAAACAG
Rattus_norvegicus|31330  GTAGAGGAAGCATTCAAGAACATCCTCACAGAAATCTACCGTATTGTGTCACAGAAGCAA
                         **.**.**.** *********** ** *****.******.. ** .****.**.**.**.

Otolemur_garnettii|3339  ATTGCCGACCGTGCAGCCCACGACGAGTCCCCTGGCAACAACGTGGTGGACATCAGCGTG
Tupaia_belangeri|652     ATCGCCGACCGCGCGGCGCATGACGAGTCCCCCGGCAACAACGTGGTGGACATCAGCGTG
Callithrix_jacchus|20019 ATCGCAGACTGTGCAGCCCAC---AAGTCCCCTGGGAACAACGTGGTGGACATCAGCGTG
Mus_musculus|17228       ATCGCTGACCGTGCAGCCCACGATGAGTCCCCTGGCAACAACGTGGTGGACATCAGTGTG
Dipodomys_ordii|6163     ATCGCAGACCGCGCAGCCCACGACGAATCCCCCGGCAACAACGTGGTAGACATCAGCGTG
Cavia_porcellus|8318     ATAGCTGACCGCGCAGCCCACGACGAGTCCCCCGGCAACAACGTGGTGGACATCAGCGTG
Gorilla_gorilla|27326    ATCGCAGACCGCGCTGCCCACGACGAGTCCCCGGGGAACAACGTAGTGGACATCAGCGTG
Homo_sapiens|38292       ATCGCAGACCGCGCTGCCCACGACGAGTCCCCGGGGAACAACGTGGTGGACATCAGCGTG
Pan_troglodytes|18215    ATCGCAGACCGCGCTGCCCACGACGAGTCCCCGGGGAACAACGTGGTGGACATCAGCGTG
Rattus_norvegicus|31330  ATTGCTGACCGTGCAGCTCATGATGAGTCCCCTGGCAACAATGTGGTGGACATCAGTGTG
                         ** ** *** * ** ** **    .*.***** ** ***** **.**.******** ***

Otolemur_garnettii|3339  CCACCTACCACCGACGGACAGAAACCCAACAAGCTGCAGTGTTGCCAGAACCTGTGA
Tupaia_belangeri|652     CCGCCCACCACCGACGGCCAGAAGCCCAACAAGCTGCAGTGCTGCCAGAACCTGTGA
Callithrix_jacchus|20019 CTGCTCACGACAGATGGACAGAAGCCCAACAAGCTGCATTGCTGCCAGAACCTGTGA
Mus_musculus|17228       CCACCCACCACCGATGGACAGAGACCCAACAAGCTGCAGTGCTGCCAGAGCCTGTGA
Dipodomys_ordii|6163     CCGCCCACCACCGACGGCCAGAGACCCAACAGGCTGCAGTGCTGCCAGAACCTGTGA
Cavia_porcellus|8318     CCCCCCACCACCGACGGACAAAAACCCAGCAAGCTGCAGTGCTGCCAGAACCTGTGA
Gorilla_gorilla|27326    CCGCCCACCACGGACGGACAGAAGCCCAACAAGCTGCAGTGCTGCCAGAACCTGTGA
Homo_sapiens|38292       CCGCCCACCACGGACGGACAGAAGCCCAACAAGCTGCAGTGCTGCCAGAACCTGTGA
Pan_troglodytes|18215    CCGCCCACCACGGACGGACAGAAGCCCAACAAGCTGCAGTGCTGCCAGAACCTGTGA
Rattus_norvegicus|31330  CCACCCACCACCGATGGACAGAAACCCAATAAGCTGCAGTGCTGCCAGAACCTGTGA
                         *  *  ** ** ** **.**.*..****. *.****** ** *******.*******

multiple sequence alignment in CLUSTALW format


Otolemur_garnettii|2882  MGTRDDEYDYLFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tupaia_belangeri|580     MGTRDDEYDYLFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Callithrix_jacchus|12445 MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
Mus_musculus|13807       MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
Dipodomys_ordii|5788     MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
Cavia_porcellus|6510     MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
Gorilla_gorilla|21250    MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
Homo_sapiens|79461       MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
Pan_troglodytes|7549     MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
Rattus_norvegicus|2500   MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
                         *************                                               

Otolemur_garnettii|2882  XXXXXXXXXXXXXXXXXXXYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
Tupaia_belangeri|580     XXXXXXXXXXXXXXXXXXXYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
Callithrix_jacchus|12445 KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
Mus_musculus|13807       KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
Dipodomys_ordii|5788     KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
Cavia_porcellus|6510     KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
Gorilla_gorilla|21250    KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
Homo_sapiens|79461       KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
Pan_troglodytes|7549     KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
Rattus_norvegicus|2500   KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
                                            *****************************************

Otolemur_garnettii|2882  LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ
Tupaia_belangeri|580     LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ
Callithrix_jacchus|12445 LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYHIMSQKQ
Mus_musculus|13807       LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ
Dipodomys_ordii|5788     LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ
Cavia_porcellus|6510     LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ
Gorilla_gorilla|21250    LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ
Homo_sapiens|79461       LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ
Pan_troglodytes|7549     LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ
Rattus_norvegicus|2500   LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ
                         *****************************************************:*:****

Otolemur_garnettii|2882  IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL
Tupaia_belangeri|580     IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL
Callithrix_jacchus|12445 IADCAAH-KSPGNNVVDISVLLTTDGQKPNKLHCCQNL
Mus_musculus|13807       IADRAAHDESPGNNVVDISVPPTTDGQRPNKLQCCQSL
Dipodomys_ordii|5788     IADRAAHDESPGNNVVDISVPPTTDGQRPNRLQCCQNL
Cavia_porcellus|6510     IADRAAHDESPGNNVVDISVPPTTDGQKPSKLQCCQNL
Gorilla_gorilla|21250    IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL
Homo_sapiens|79461       IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL
Pan_troglodytes|7549     IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL
Rattus_norvegicus|2500   IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL
                         *** *** :***********  *****:*.:*:***.*