Orthologs Set ID: EOG4003J0


Orthology Database
OrthoDB4
Gene Symbol(s)
SIGMAR1

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 46654 151, 352, 445
Cavia porcellus 11695 151, 352, 445
Dipodomys ordii 11695 151, 352, 445
Gorilla gorilla 19936 151, 352, 445
Homo sapiens 92504 151, 352, 445
Microcebus murinus 2561 151, 352, 445
Mus musculus 28465 151, 352, 445
Ochotona princeps 15747 151, 352, 361, 378, 393, 445
Otolemur garnettii 3564 102, 151, 178, 195, 267, 344
Pan troglodytes 36749 151, 352, 445
Rattus norvegicus 26943 151, 352, 445
Spermophilus tridecemlineatus 2830 151, 352, 445, 474
Tupaia belangeri 4644 151, 352, 445

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 46654 ENSCJAT00000017126 100396237 ENSCJAG00000008767 SIGMAR1 calJac3
Cavia porcellus 11695 ENSCPOT00000020038 100135589 ENSCPOG00000024938 Sigmar1 cavPor3
Dipodomys ordii 11695 ENSDORT00000001725 ENSDORG00000001726 Sigmar1 dipOrd1
Gorilla gorilla 19936 ENSGGOT00000002938 101129697 ENSGGOG00000002924 SIGMAR1 gorGor3
Homo sapiens 92504 ENST00000277010, NM_005866 10280 ENSG00000147955 SIGMAR1 hg19,GRCh37
Microcebus murinus 2561 ENSMICT00000002383 ENSMICG00000002386 SIGMAR1 micMur1
Mus musculus 28465 ENSMUST00000059354 18391 ENSMUSG00000036078 Sigmar1 mm9
Ochotona princeps 15747 ENSOPRT00000009214 101516894 ENSOPRG00000009222 SIGMAR1 OchPri2.0
Otolemur garnettii 3564 ENSOGAT00000003445 ENSOGAG00000003442 SIGMAR1 otoGar1
Pan troglodytes 36749 ENSPTRT00000038642 465062 ENSPTRG00000020885 SIGMAR1 panTro2
Rattus norvegicus 26943 ENSRNOT00000019795 29336 ENSRNOG00000014604 Sigmar1 rn4
Spermophilus tridecemlineatus 2830 ENSSTOT00000002830 101969964 ENSSTOG00000002835 SIGMAR1 speTri1
Tupaia belangeri 4644 ENSTBET00000004645 ENSTBEG00000004664 SIGMAR1 tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 37847 ENSCJAP00000016201 100396237 ENSCJAG00000008767 SIGMAR1 calJac3
Cavia porcellus 9147 ENSCPOP00000019032 100135589 ENSCPOG00000024938 Sigmar1 cavPor3
Dipodomys ordii 10993 ENSDORP00000001612 ENSDORG00000001726 Sigmar1 dipOrd1
Gorilla gorilla 15797 ENSGGOP00000002873 101129697 ENSGGOG00000002924 SIGMAR1 gorGor3
Homo sapiens 47161 ENSP00000277010 10280 ENSG00000147955 SIGMAR1 hg19,GRCh37
Microcebus murinus 2179 ENSMICP00000002178 ENSMICG00000002386 SIGMAR1 micMur1
Mus musculus 5260 ENSMUSP00000056027 18391 ENSMUSG00000036078 Sigmar1 mm9
Ochotona princeps 13725 ENSOPRP00000008431 101516894 ENSOPRG00000009222 SIGMAR1 OchPri2.0
Otolemur garnettii 3068 ENSOGAP00000003068 ENSOGAG00000003442 SIGMAR1 otoGar1
Pan troglodytes 8753 ENSPTRP00000035724 465062 ENSPTRG00000020885 SIGMAR1 panTro2
Rattus norvegicus 9379 ENSRNOP00000019795 29336 ENSRNOG00000014604 Sigmar1 rn4
Spermophilus tridecemlineatus 2538 ENSSTOP00000002533 101969964 ENSSTOG00000002835 SIGMAR1 speTri1
Tupaia belangeri 4022 ENSTBEP00000004003 ENSTBEG00000004664 SIGMAR1 tupBel1

multiple sequence alignment in CLUSTALW format


Ochotona_princeps|15747            ATGCGGTGGGCCGCGGGCCGGCGGTGGGCGTGGGCTGCGCTGCTTCTGGCCGCCGCGGCG
Mus_musculus|28465                 ATGCCGTGGGCCGCGGGACGGCGGTGGGCATGGATCACCCTGATTCTGACTATTATCGCA
Rattus_norvegicus|26943            ATGCCGTGGGCTGTGGGCCGGCGGTGGGCATGGATCACCCTGTTTCTGACTATTGTGGCG
Dipodomys_ordii|11695              ATGCAGTGGGCAGTGGGTCGGCGGTGGGCGTGGGCCGCGCTGTTTCTGGCTGCCGCGGCG
Cavia_porcellus|11695              ATGCAGTGGGCCGTGGGCCGGCGATGGCTGTGGGTTGCGCTGTTTCTGGCTGCCGTGGCG
Spermophilus_tridecemlineatus|2830 ------------------------------------------------------------
Otolemur_garnettii|3564            ATGCAGTGGGCCGTGGGTCGGCGGTGGGTTTGGGCCGCGCTGCTTTTGGCTGCCATAGCT
Tupaia_belangeri|4644              ATGCAGTGGGCGGTGGGCCGGCGGTGGGTGTGGGCCGCGCTACTCCTGGCTGCCGCGGCG
Callithrix_jacchus|46654           ATGCAGTGGGCCGCGGGCCGGCTGTGGGCGCGGGCCGCGCTGCTCCTGGCTGTCGCAGCG
Microcebus_murinus|2561            ATGCAGTGGGCCGTGGGCCGGCGGTGGGCGTGGGCTGCGCTGCTTCTGGCTGCCGCAGCT
Gorilla_gorilla|19936              ATGCAGTGGGCCGTGGGCCGGCGGTGGGCGTGGGCCGCGCTGCTCCTGGCTGTCGCAGCG
Homo_sapiens|92504                 ATGCAGTGGGCCGTGGGCCGGCGGTGGGCGTGGGCCGCGCTGCTCCTGGCTGTCGCAGCG
Pan_troglodytes|36749              ATGCAGTGGGCCGTGGGCCGGCGGTGGGCGTGGGCCGCGCTGCTGCTGGCTGTCGCAGCG
                                                                                               

Ochotona_princeps|15747            GTGCTGACCCAGGTG------CTCTGGCTGGGGACGCAGAACTTCGTCTTCGAGCGCGAA
Mus_musculus|28465                 GTGCTGATCCAGGCCGCCTGGTTGTGGCTGGGCACTCAAAACTTCGTCTTCTCTAGAGAA
Rattus_norvegicus|26943            GTGCTGATCCAGGCGGTCTGGCTGTGGCTGGGTACTCAGAGCTTCGTCTTCCAGAGAGAA
Dipodomys_ordii|11695              GTGCTAACCCAAGTCCTCTGGCTCTGGCTGGGTACGCAGACCTTCGTCTTCCAGCCCGAA
Cavia_porcellus|11695              GTTCTAACCCAAATCGTGTGGCTCTGGCTGGGCACGCAGAACTTCGTCTTCCAGCGCGAA
Spermophilus_tridecemlineatus|2830 ---------CAGCTTGTCTGGCTCTGGCTGGGAACGCGGAGCTTCGTCTTCCAGCACGAA
Otolemur_garnettii|3564            GTGCTGACCCAGGTCGTCTGGCTCTGGCTGGGTACGCAGAGCTTCGTTTTCCAGAGGGAA
Tupaia_belangeri|4644              GTGCTGACCCAGGTGGTCTGGCTCTGGCTGGGTACTCAGAACTTCGTCTTCCAGCGTGAA
Callithrix_jacchus|46654           GTGCTGACCCAGGTCGTCTGGCTCTGGCTTGGTACTCAGAGCTTCGTCTTCCAGCGCGAA
Microcebus_murinus|2561            GTGCTAGCCCAGGTCGTTTGGCTCTGGCTGGGTACGCAGAGCTTCGTCTTCCAGCAGGAA
Gorilla_gorilla|19936              GTGCTGACCCAGGTCGTCTGGCTCTGGCTGGGTACGCAGAGCTTCGTCTTCCAGCGCGAA
Homo_sapiens|92504                 GTGCTGACCCAGGTCGTCTGGCTCTGGCTGGGTACGCAGAGCTTCGTCTTCCAGCGCGAA
Pan_troglodytes|36749              GTGCTGACCCAGGTCGTCTGGCTCTGGCTGGGTACGCAGAGCTTCGTCTTCCAGCGCGAA
                                            **.          * ***** ** ** *..* ****** *** . .  ***

Ochotona_princeps|15747            GAGATCGCGCTGCTGGCGCGGAAGTACGCGGGGCTGGACCATGAGCTGGCCTTCTCTCGG
Mus_musculus|28465                 GAAATAGCGCAGCTTGCTCGACAGTATGCGGGGCTGGACCATGAGCTTGCCTTCTCTCGG
Rattus_norvegicus|26943            GAGATAGCTCAGCTTGCTCGACAGTACGCAGGGCTGGACCATGAGCTGGCCTTCTCTCGG
Dipodomys_ordii|11695              GAGATCGCGCAGTTGGCGCGGCAGTACGCTGGGCTGGATCAAGAGCTGGCCTTCTCCCGC
Cavia_porcellus|11695              GAAATCGCGCAGCTGGCGCGGCAGTACGCTGGTCTGGACCACGAACTGGCCTTCTCTAAG
Spermophilus_tridecemlineatus|2830 GAGATCGCGCAGCTAGCGCGGCAGTACGCTGGGCTGGACCACGAGCTAGCCTTCTCTCGG
Otolemur_garnettii|3564            GAGATCGCGCAGCTGGCGCGGCAGTACGCTGGGCTGGACCATGAACTGGCTTTCTCTCGG
Tupaia_belangeri|4644              GAGATCGCGCAGTTGGCGCGGCAGTACGCTGGGCTGGACCATGAGCTGGCCTTCTCCCGG
Callithrix_jacchus|46654           GAGATCGCGCAGCTGGCGCGGCAATACGCTGGGCTGGACCACGAGCTAGCCTTCTCTCGG
Microcebus_murinus|2561            GAGATCGCTCAGCTGGCGCGGCAGTACGCTGGGCTGGACCACGAGCTGGCCTTCTCTCGG
Gorilla_gorilla|19936              GAGATAGCGCAGTTGGCGCGGCAGTACGCTGGGCTGGACCACGAGCTGGCCTTCTCTCGG
Homo_sapiens|92504                 GAGATAGCGCAGTTGGCGCGGCAGTACGCTGGGCTGGACCACGAGCTGGCCTTCTCTCGT
Pan_troglodytes|36749              GAGATAGCGCAGTTGGCGCGGCAGTACGCTGGGCTGGACCACGAGCTGGCCTTCTCTCGG
                                   **.**.** *:* * ** **..*.** ** ** ***** ** **.** ** ***** .. 

Ochotona_princeps|15747            CTGATTGTGGAGCTGCGGCGGCTGCACCCAGGCCACGTGCTGCCCGACGAGGAGCTGCAG
Mus_musculus|28465                 CTGATCGTGGAGCTGCGGAGGCTGCACCCAGGCCACGTGCTGCCGGATGAGGAGCTGCAG
Rattus_norvegicus|26943            CTGATCGTGGAGCTGCGGAGGCTGCACCCAGGCCACGTGCTGCCGGATGAGGAGCTGCAG
Dipodomys_ordii|11695              TTGATCGTGGAGCTGCGGCGGCTGCACCCAGGCCACGTGCTGCCCGACGAGGAGCTGCAG
Cavia_porcellus|11695              CTGATCGTGGAGCTGCGGCGGCTGCACCCGGGACACGTACTGCCCGATGAGGAGCTGCAG
Spermophilus_tridecemlineatus|2830 TTGATCGTGGAGCTGCGGCGGCTGCACCCAGGCCACGTGCTACCTGACGAGGAGCTGCAG
Otolemur_garnettii|3564            CTGATTGTGGAGCTG---CGTCTGCACCCAGGCCATGTGCTGCCGGACGAGAAGCTGCAG
Tupaia_belangeri|4644              CTGATCGTGGAACTGCGGCGTCTGCACCCAGGCCACGTGCTGCCCGATGAAGAGCTGCAG
Callithrix_jacchus|46654           TTGATCGTGGAGCTGCGACGGCTGCACCCAGGCCATGTGCTGCCCGACGAGGAGCTGCAG
Microcebus_murinus|2561            CTGATTGTGGAGCTGCGGCGGCTGCACCCAGGCCACGTGCTGCCAGACGAGGAGCTGCAG
Gorilla_gorilla|19936              CTGATCGTGGAGCTGCGGCGGCTGCACCCAGGCCACGTGCTGCCCGACGAGGAGCTGCAG
Homo_sapiens|92504                 CTGATCGTGGAGCTGCGGCGGCTGCACCCAGGCCACGTGCTGCCCGACGAGGAGCTGCAG
Pan_troglodytes|36749              CTGATCGTGGAGCTGCGGCGGCTGCACCCAGGCCACGTGCTGCCCGACGAGGAGCTGCAG
                                    **** *****.***   .* ********.**.** **.**.** ** **..********

Ochotona_princeps|15747            TGGGTGTTCGTGAACGCGGGCGGCTGGATGGGTGCCATGTGCCTTCTGCACGCCTCGCTG
Mus_musculus|28465                 TGGGTATTTGTGAACGCGGGCGGCTGGATGGGCGCCATGTGTATTCTGCACGCCTCGCTG
Rattus_norvegicus|26943            TGGGTGTTTGTGAACGCGGGCGGCTGGATGGGCGCCATGTGTCTTTTGCACGCCTCGCTG
Dipodomys_ordii|11695              TGGGTGTTTGTGAACGCGGGCGGCTGGATGGGCGCCATGTGCCTTCTGCACGCCTCGCTG
Cavia_porcellus|11695              TGGGTGTTCGTGAACGCGGGCGGCTGGATGGGCGCCATGTGCCTTCTGCATGCCTCGCTG
Spermophilus_tridecemlineatus|2830 TGGGTGTTCGTGAACGCGGGTGGCTGGATGGGTGCCATGTGCCTTCTGCACGCCTCGCTG
Otolemur_garnettii|3564            TGGGTGTTTGTGAACGCGGGCGGCTGG---GGTGCCATGTGTCTTCTGCACGCCTCGTTG
Tupaia_belangeri|4644              TGGGTGTTCGTGAACGCGGGCGGCTGGATGGGTGCCATGTGCCTTCTGCACGCCTCGCTG
Callithrix_jacchus|46654           TGGGTGTTCGTGAATGCAGGCGGCTGGATGGGCGCCATGTGCCTTCTGCACGCCTCGCTG
Microcebus_murinus|2561            TGGGTGTTCGTTAACGCGGGCGGCTGGATGGGCGCCATGTGCCTCCTGCACGCCTCGCTG
Gorilla_gorilla|19936              TGGGTGTTCGTGAATGCGGGTGGCTGGATGGGCGCCATGTGCCTTCTGCACGCCTCGCTG
Homo_sapiens|92504                 TGGGTGTTCGTGAATGCGGGTGGCTGGATGGGCGCCATGTGCCTTCTGCACGCCTCGCTG
Pan_troglodytes|36749              TGGGTGTTCGTGAATGCGGGTGGCTGGATGGGCGCCATGTGCCTTCTGCACGCCTCGCTG
                                   *****.** ** ** **.** ******   ** ******** .*  **** ****** **

Ochotona_princeps|15747            TCCGAGTACGTGCTGCTGTTCGGCACCGCCCTGGGCTCCCGCGGCCACTCGGGGCGCTAT
Mus_musculus|28465                 TCTGAGTACGTGCTGCTCTTCGGCACCGCCCTGGGCTCCCATGGCCATTCGGGACGATAC
Rattus_norvegicus|26943            TCTGAGTACGTGCTGCTCTTCGGCACCGCCCTGGGCTCCCATGGCCATTCGGGACGATAC
Dipodomys_ordii|11695              TCCGAGTACGTGCTGCTCTTCGGCACCGCCCTGGGCTCCAGCGGCCACTCGGGGCGCTAT
Cavia_porcellus|11695              TCCGAGTATGTGCTGCTCTTCGGCACCGCCCTGGGCTCCCGCGGCCACTCGGGCCGCTAT
Spermophilus_tridecemlineatus|2830 TCTGAGTACGTGCTGCTCTTCGGCACAGCCCTGGGCTCCCGCGGCCATTCGGGGCGCTAT
Otolemur_garnettii|3564            TCAGAGTATGTGCTGCTCTTCGGCACCGCCCTGGGCTCCCGTGGCCACTCG---------
Tupaia_belangeri|4644              TCCGAGTACGTGCTGCTCTTCGGCACCGCTCTGGGCTCCCGCGGCCACTCGGGACGCTAT
Callithrix_jacchus|46654           TCCGAGTATGTGCTGCTCTTCGGCACCGCCCTGGGCTCCCGCGGCCACTCGGGGCGCTAC
Microcebus_murinus|2561            TCCGAGTATGTGCTGCTCTTCGGCACCGCCCTGGGCTCCCGCGGCCACTCGGGGCGCTAC
Gorilla_gorilla|19936              TCCGAGTATGTGCTGCTCTTCGGCACCGCCTTGGGCTCCCGCGGCCACTCGGGGCGCTAC
Homo_sapiens|92504                 TCCGAGTATGTGCTGCTCTTCGGCACCGCCTTGGGCTCCCGCGGCCACTCGGGGCGCTAC
Pan_troglodytes|36749              TCCGAGTATGTGCTGCTCTTCGGCACCGCCTTGGGCTCCCGCGGCCACTCGGGGCGCTAC
                                   ** ***** ******** ********.**  ********.. ***** ***         

Ochotona_princeps|15747            TGGGCTGAGATCTCTGATATCATC------TCTACCTTCCACCAGTGGANNNNNNNNNNN
Mus_musculus|28465                 TGGGCTGAGATTTCTGACACCATCATCTCTGGCACCTTCCACCAATGGAAAGAGGGCACC
Rattus_norvegicus|26943            TGGGCTGAGATTTCAGATACCATCATCTCTGGCACTTTCCACCAGTGGAGAGAGGGCACC
Dipodomys_ordii|11695              TGGGCTGAAATTTCTGACACCATCATCTCTGGCACCTTCTACCAGTGGAGAGAGGGCACC
Cavia_porcellus|11695              TGGGCTGAGATCTCCGACACCATTATCTCTGGCACTTTCCACCAGTGGAGAGAGGGCACC
Spermophilus_tridecemlineatus|2830 TGGGCTGAGATCTCAGACACGATCATCTCTGGCATCTTCCACCAGTGGAGAGAGGGTACC
Otolemur_garnettii|3564            ------------------------------------------------------------
Tupaia_belangeri|4644              TGGGCTGAGATCTCGGACACCATCATCTCTGGCACTTTCCACCAATGGAGAGAGGGCACC
Callithrix_jacchus|46654           TGGGCTGAGATCTCGGATACCATCATCTCTGGCACCTTCCACCAGTGGAGAGAGGGCACT
Microcebus_murinus|2561            TGGGCTGAGATATCGGACACCATCATCTCTGGCACTTTCCACCAGTGGAGAGAGGGCACC
Gorilla_gorilla|19936              TGGGCTGAGATCTCGGATACCATCATCTCTGGCACCTTCCACCAGTGGAGAGAGGGCACC
Homo_sapiens|92504                 TGGGCTGAGATCTCGGATACCATCATCTCTGGCACCTTCCACCAGTGGAGAGAGGGCACC
Pan_troglodytes|36749              TGGGCTGAGATCTCGGATACCATCATCTCTGGCACCTTCCACCAGTGGAGAGAGGGCACC
                                                                                               

Ochotona_princeps|15747            NNNNNNNNNNNNNNNNNNNNNNNNNGAGAGACGGTGGTGCATGGACCTGGAGAAGCGACA
Mus_musculus|28465                 ACGAAAAGTGAGGTCTTCTACCCAGGAGAGACAGTTGTACACGGGCCTGGAGAAGCAACG
Rattus_norvegicus|26943            ACAAAAAGTGAGGTCTATTACCCAGGAGAGACGGTTGTCCATGGACCTGGAGAGGCAACA
Dipodomys_ordii|11695              ACCAAAAGTGAGGTTTTCTATCCAGGGGAGACAGTTGTGCACAGGCCTGGCGAGGCAACG
Cavia_porcellus|11695              ACCAAAAGTGAGGTCTTCTATCCAGGGGAGACAGTGGTGCACGGGCCTGGTGAAGCAACG
Spermophilus_tridecemlineatus|2830 ACCAAAAGTGAGGTATTCTACCCAGGGGAAACAGTGATGCACGGGCCTGCCGAGGCAACA
Otolemur_garnettii|3564            ------------------------------------------------------------
Tupaia_belangeri|4644              ACCAAAAGTGAGGTTTTCTACCCAGGGGAGACAGTGGTGCACGGGCCCGGCGAGGCAACG
Callithrix_jacchus|46654           ACCAAAAGTGAGGTTTTCTACCCAGGAGAGACGGTAGTACATGGGCCTGGTGAAGCCACG
Microcebus_murinus|2561            ACCAAAAGTGAGGTCTTCTACCCAGGGGAGACGGTAGTGCATGGGCCTGGAGAGGCAACT
Gorilla_gorilla|19936              ACCAAAAGTGAGGTCTTCTACCCAGGGGAGACGGTAGTGCACGGGCCTGGTGAGGCAACA
Homo_sapiens|92504                 ACCAAAAGTGAGGTCTTCTACCCAGGGGAGACGGTAGTACACGGGCCTGGTGAGGCAACA
Pan_troglodytes|36749              ACCAAAAGTGAGGTCTTCTACCCAGGGGAGACGGTAGTACACGGGCCTGGTGAGGCAACA
                                                                                               

Ochotona_princeps|15747            GCTGTGGAGTGGGGACCCAACACGTGGATGGTGGAGTATGGCCGGGGTGTCATCCCGTCT
Mus_musculus|28465                 GCTCTGGAGTGGGGACCAAACACGTGGATGGTGGAGTACGGCCGGGGTGTTATTCCGTCT
Rattus_norvegicus|26943            GCTGTGGAGTGGGGACCAAACACGTGGATGGTGGAGTATGGCCGGGGTGTTATTCCGTCT
Dipodomys_ordii|11695              GCTGTGGAATGGGCGCCAAACACATGGATGGTGGAGTACGGCCGGGGTGTCATCCCATCT
Cavia_porcellus|11695              GCTGTGGAATGGGGACCAAACACATGGATGGTGGAGTACGGCCGGGGTGTCATCCCGTCT
Spermophilus_tridecemlineatus|2830 GCTGTGGAGTGGGGGCCAAACACATGGATGGTGGAGTAT---------------------
Otolemur_garnettii|3564            ------------------------------------------------------------
Tupaia_belangeri|4644              GCTGTGGAGTGGGGGCCAAACACATGGATGGTGGAATACGGTCGGGGTGTCATTCCATCT
Callithrix_jacchus|46654           GCTGTGGAGTGGGGGCCAAACACATGGATGGTGGAGTACGGCCGGGGTGTCATCCCATCC
Microcebus_murinus|2561            GCTGTGGAATGGGGCCCAAACACATGGATGGTGGAGTATGGTCGGGGTGTCATCCCATCT
Gorilla_gorilla|19936              GCTGTGGAGTGGGGGCCAAACACATGGATGGTGGAGTACGGCCGGGGTGTCATCCCATCC
Homo_sapiens|92504                 GCTGTGGAGTGGGGGCCAAACACATGGATGGTGGAGTACGGCCGGGGCGTCATCCCATCC
Pan_troglodytes|36749              GCTGTGGAGTGGGGGCCAAACACATGGATGGTGGAGTACGGCCGGGGCGTCATCCCATCC
                                                                                               

Ochotona_princeps|15747            ACCCTGGCATTCGCGCTGGCCGACACCGTCTTCAGCACCCAGGACTTCCTCACTCTCTTC
Mus_musculus|28465                 ACCCTGTTCTTTGCACTAGCCGACACTTTCTTCAGCACCCAGGACTACCTCACACTCTTC
Rattus_norvegicus|26943            ACCCTGGCATTTGCACTTAGTGACACTATTTTCAGCACCCAGGACTTCCTCACCCTCTTC
Dipodomys_ordii|11695              ACCCTGGCCTTCGCACTGGCCGACACTGTCTTCAGCACTCAGGACTTCTTCACCCTCTTC
Cavia_porcellus|11695              ACCCTGGGATTTGCACTGGCTGACACTGTCTTCAGCACCCAGGACTTCCTCACCCTCTTC
Spermophilus_tridecemlineatus|2830 ------------------------------------------------------------
Otolemur_garnettii|3564            ------------------------------------------------------------
Tupaia_belangeri|4644              ACCCTGGCATTTGCCCTGGCTGACACTGTCTTCAGCACCCAGGACTTCCTCACCCTCTTC
Callithrix_jacchus|46654           ACCCTGGCCTTTGCCCTGGCTGACACTGTCTTCAGCACCCAGGACTTCCTCACCCTCTTC
Microcebus_murinus|2561            ACCCTGGCCTTCGCACTGGCTGACACTGTCTTCAGCACCCAGGACTTCCTCACCCTCTTC
Gorilla_gorilla|19936              ACCCTGGCCTTCGCGCTGGCCGACACTGTCTTCAGCACCCAGGACTTCCTCACCCTCTTC
Homo_sapiens|92504                 ACCCTGGCCTTCGCGCTGGCCGACACTGTCTTCAGCACCCAGGACTTCCTCACCCTCTTC
Pan_troglodytes|36749              ACCCTGGCCTTCGCGCTGGCCGACACTGTCTTCAGCACCCAGGACTTCCTCACCCTCTTC
                                                                                               

Ochotona_princeps|15747            TACACCCTTCGTGCATATGCCCGGGGCCTCCGACTTGAACTTACCACCTACCTCTTTGGC
Mus_musculus|28465                 TATACCCTTCGGGCCTATGCCCGGGGCCTCCGGCTTGAGCTTACCACCTACCTCTTTGGC
Rattus_norvegicus|26943            TATACCCTTCGCGCCTATGCCCGGGGCCTCCGGCTTGAGCTCACCACCTACCTCTTTGGC
Dipodomys_ordii|11695              TATACCCTCCGCTCCTATGCCCGGGGCCTCCGACTTGAGCTCACCACCTACCTCTTTGGC
Cavia_porcellus|11695              TATACCCTTCGAGTCTATGCCCGGGCCCTCCAGCTTGAACTCACCACCTACCTCTTCGGC
Spermophilus_tridecemlineatus|2830 ------------------------------------------------------------
Otolemur_garnettii|3564            ------------------------------------------------------------
Tupaia_belangeri|4644              TATACTCTTCGCTCCTATGCCCGGGCCCTCCGGCTCGAGCTTACTACCTACCTCTTTGGC
Callithrix_jacchus|46654           TATACTCTTCGCTCCTATGCCCGGGGCCTCCGGCTTGAGCTCACCACCTACCTCTTCGGC
Microcebus_murinus|2561            TACACTCTTCGCTCCTATGCCCGGGGCCTCCGACTTGAGCTTACCACCTACCTCTTCGGC
Gorilla_gorilla|19936              TATACTCTTCGCTCCTATGCTCGGGGCCTCCGGCTTGAGCTCACCACCTACCTCTTCGGC
Homo_sapiens|92504                 TATACTCTTCGCTCCTATGCTCGGGGCCTCCGGCTTGAGCTCACCACCTACCTCTTTGGC
Pan_troglodytes|36749              TATACTCTTCGCTCCTATGCTCGGGGCCTCCGGCTTGAGCTCACCACCTACCTCTTCGGC
                                                                                               

Ochotona_princeps|15747            CAGGACCCTTGA
Mus_musculus|28465                 CAAGACTCCTGA
Rattus_norvegicus|26943            CAAGACCCCTGA
Dipodomys_ordii|11695              CAGGACCCCTGA
Cavia_porcellus|11695              CAAGACCCTTGA
Spermophilus_tridecemlineatus|2830 ------------
Otolemur_garnettii|3564            ------------
Tupaia_belangeri|4644              CAAGACCCCTGA
Callithrix_jacchus|46654           CAGGACCCTTGA
Microcebus_murinus|2561            CAGGACCCCTGA
Gorilla_gorilla|19936              CAGGACCCTTGA
Homo_sapiens|92504                 CAGGACCCTTGA
Pan_troglodytes|36749              CAGGACCCTTGA
                                               

multiple sequence alignment in CLUSTALW format


Ochotona_princeps|13725            MRWAAGRRWAWAALLLAAAAVLTQV--LWLGTQNFVFEREEIALLARKYAGLDHELAFSR
Mus_musculus|5260                  MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSR
Rattus_norvegicus|9379             MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
Dipodomys_ordii|10993              MQWAVGRRWAWAALFLAAAAVLTQVLWLWLGTQTFVFQPEEIAQLARQYAGLDQELAFSR
Cavia_porcellus|9147               MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
Spermophilus_tridecemlineatus|2538 -----------------------QLVWLWLGTRSFVFQHEEIAQLARQYAGLDHELAFSR
Otolemur_garnettii|3068            MQWAVGRRWVWAALLLAAIAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
Tupaia_belangeri|4022              MQWAVGRRWVWAALLLAAAAVLTQVVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSR
Callithrix_jacchus|37847           MQWAAGRLWARAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
Microcebus_murinus|2179            MQWAVGRRWAWAALLLAAAAVLAQVVWLWLGTQSFVFQQEEIAQLARQYAGLDHELAFSR
Gorilla_gorilla|15797              MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
Homo_sapiens|47161                 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
Pan_troglodytes|8753               MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
                                                          *   *****:.***. **** ***:*****:*****:

Ochotona_princeps|13725            LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
Mus_musculus|5260                  LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRY
Rattus_norvegicus|9379             LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
Dipodomys_ordii|10993              LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSSGHSGRY
Cavia_porcellus|9147               LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
Spermophilus_tridecemlineatus|2538 LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
Otolemur_garnettii|3068            LIVEL-RLHPGHVLPDEKLQWVFVNAGGW-GAMCLLHASLSEYVLLFGTALGSRGHS---
Tupaia_belangeri|4022              LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
Callithrix_jacchus|37847           LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
Microcebus_murinus|2179            LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
Gorilla_gorilla|15797              LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
Homo_sapiens|47161                 LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
Pan_troglodytes|8753               LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
                                   ***** ***********:*********** ****:****************** ***   

Ochotona_princeps|13725            WAEISDII--STFHQWXXXXXXXXXXXXXETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
Mus_musculus|5260                  WAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIPS
Rattus_norvegicus|9379             WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
Dipodomys_ordii|10993              WAEISDTIISGTFYQWREGTTKSEVFYPGETVVHRPGEATAVEWAPNTWMVEYGRGVIPS
Cavia_porcellus|9147               WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
Spermophilus_tridecemlineatus|2538 WAEISDTIISGIFHQWREGTTKSEVFYPGETVMHGPAEATAVEWGPNTWMVEY-------
Otolemur_garnettii|3068            ------------------------------------------------------------
Tupaia_belangeri|4022              WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
Callithrix_jacchus|37847           WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
Microcebus_murinus|2179            WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
Gorilla_gorilla|15797              WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
Homo_sapiens|47161                 WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
Pan_troglodytes|8753               WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
                                                                                               

Ochotona_princeps|13725            TLAFALADTVFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
Mus_musculus|5260                  TLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS
Rattus_norvegicus|9379             TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
Dipodomys_ordii|10993              TLAFALADTVFSTQDFFTLFYTLRSYARGLRLELTTYLFGQDP
Cavia_porcellus|9147               TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
Spermophilus_tridecemlineatus|2538 -------------------------------------------
Otolemur_garnettii|3068            -------------------------------------------
Tupaia_belangeri|4022              TLAFALADTVFSTQDFLTLFYTLRSYARALRLELTTYLFGQDP
Callithrix_jacchus|37847           TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Microcebus_murinus|2179            TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Gorilla_gorilla|15797              TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Homo_sapiens|47161                 TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Pan_troglodytes|8753               TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP