Orthologs Set ID: EOG4003J3


Orthology Database
OrthoDB4
Gene Symbol(s)
SMN2,SMN1

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 46016 323, 462, 576, 685, 912
Cavia porcellus 7681 105, 177, 327, 528, 690, 795, 906
Dipodomys ordii 7239 105, 177, 327
Gorilla gorilla 11041 105, 177, 327, 528, 690
Gorilla gorilla 1944 105, 177, 327, 528, 690, 714, 826, 861, 882, 885
Homo sapiens 69197 105, 177, 327, 528, 690, 795, 906
Homo sapiens 69220 105, 177, 327, 528, 690, 795, 906
Mus musculus 11625 105, 177, 327, 528, 690, 795, 906
Ochotona princeps 15656 177, 327, 528, 690, 795
Oryctolagus cuniculus 19299 259, 709, 953
Oryctolagus cuniculus 21004 105, 177, 327, 528, 690, 709, 795, 906
Oryctolagus cuniculus 21316 709, 953
Pan troglodytes 29425 105, 177, 327, 528, 690, 795, 906
Rattus norvegicus 17826 105, 177, 327, 528, 690, 795, 906
Spermophilus tridecemlineatus 12288 105, 177, 317, 327, 528, 690, 795, 906
Tarsius syrichta 2731 327, 528, 690, 795
Tupaia belangeri 2381 105, 177, 327, 528

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 46016 ENSCJAT00000017512 ENSCJAG00000009045 calJac3
Cavia porcellus 7681 ENSCPOT00000012445 100713418 ENSCPOG00000012328 cavPor3
Dipodomys ordii 7239 ENSDORT00000007081 ENSDORG00000007082 Smn1 dipOrd1
Gorilla gorilla 1944 ENSGGOT00000034028 101148291 ENSGGOG00000026704 gorGor3
Gorilla gorilla 11041 ENSGGOT00000003893 101149971 ENSGGOG00000003872 SMN1 gorGor3
Homo sapiens 69197 ENST00000380743, NM_017411 6607 ENSG00000205571 SMN2 hg19,GRCh37
Homo sapiens 69220 ENST00000380707, NM_017411 6607 ENSG00000172062 SMN1 hg19,GRCh37
Mus musculus 11625 ENSMUST00000022147 20595 ENSMUSG00000021645 Smn1 mm9
Ochotona princeps 15656 ENSOPRT00000002005 ENSOPRG00000002015 OchPri2.0
Oryctolagus cuniculus 19299 ENSOCUT00000025146 ENSOCUG00000026649 oryCun2.0
Oryctolagus cuniculus 21004 ENSOCUT00000017096 100341643 ENSOCUG00000017097 LOC100341643 oryCun2.0
Oryctolagus cuniculus 21316 ENSOCUT00000024474 ENSOCUG00000025183 oryCun2.0
Pan troglodytes 29425 ENSPTRT00000031451 461829 ENSPTRG00000016955 LOC461829 panTro2
Rattus norvegicus 17826 ENSRNOT00000024456 64301 ENSRNOG00000018067 Smn1 rn4
Spermophilus tridecemlineatus 12288 ENSSTOT00000012289 101965836 ENSSTOG00000012288 LOC101965836 speTri1
Tarsius syrichta 2731 ENSTSYT00000012039 ENSTSYG00000012058 tarSyr1
Tupaia belangeri 2381 ENSTBET00000002382 ENSTBEG00000002399 tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 37231 ENSCJAP00000016562 ENSCJAG00000009045 calJac3
Cavia porcellus 5981 ENSCPOP00000011091 100713418 ENSCPOG00000012328 cavPor3
Dipodomys ordii 6802 ENSDORP00000006637 ENSDORG00000007082 Smn1 dipOrd1
Gorilla gorilla 1847 ENSGGOP00000017774 101148291 ENSGGOG00000026704 gorGor3
Gorilla gorilla 9223 ENSGGOP00000003799 101149971 ENSGGOG00000003872 SMN1 gorGor3
Homo sapiens 17394 ENSP00000370119 6607 ENSG00000205571 SMN2 hg19,GRCh37
Homo sapiens 18813 ENSP00000370083 6607 ENSG00000172062 SMN1 hg19,GRCh37
Mus musculus 53927 ENSMUSP00000022147 20595 ENSMUSG00000021645 Smn1 mm9
Ochotona princeps 13645 ENSOPRP00000001850 ENSOPRG00000002015 OchPri2.0
Oryctolagus cuniculus 11677 ENSOCUP00000014693 100341643 ENSOCUG00000017097 LOC100341643 oryCun2.0
Oryctolagus cuniculus 10723 ENSOCUP00000023090 ENSOCUG00000026649 oryCun2.0
Oryctolagus cuniculus 8003 ENSOCUP00000020212 ENSOCUG00000025183 oryCun2.0
Pan troglodytes 9055 ENSPTRP00000029048 461829 ENSPTRG00000016955 LOC461829 panTro2
Rattus norvegicus 24409 ENSRNOP00000024456 64301 ENSRNOG00000018067 Smn1 rn4
Spermophilus tridecemlineatus 11013 ENSSTOP00000011013 101965836 ENSSTOG00000012288 LOC101965836 speTri1
Tarsius syrichta 2501 ENSTSYP00000011045 ENSTSYG00000012058 tarSyr1
Tupaia belangeri 2078 ENSTBEP00000002061 ENSTBEG00000002399 tupBel1

multiple sequence alignment in CLUSTALW format


Dipodomys_ordii|7239                ------------------------ATGGCGATGAGCAGCGGCGGCGGCGGCGGCGGCGTC
Callithrix_jacchus|46016            ------------------------CTGGCAATGGGAAGTGCCAGCAGTGGCCATGGCATC
Cavia_porcellus|7681                CGTCAACCCCGTAGGAGGCTCGCCATGGCGATGAGCAGCAGCGGCGATGGTGGCTGCGTC
Mus_musculus|11625                  ------------------------ATGGCGATGGGCAGTGGCGGAGCGGGC---------
Rattus_norvegicus|17826             ------------------------ATGGCGATGGGCAGCGGCGGCGCGGGC---------
Ochotona_princeps|15656             ------------------------------------------------------------
Spermophilus_tridecemlineatus|12288 ------------------------ATGGCGATGGGTCCAGGTGGAGGTAGCAGCGGCGTC
Tarsius_syrichta|2731               ------------------------------------------------------------
Oryctolagus_cuniculus|21316         ------------------------ATGGCGATGAGCAGTGGCGGCGGCGGC------GTT
Oryctolagus_cuniculus|19299         ------------------------ATGGCGATGAGCAGTGGCGGCGGCGGC------ATT
Oryctolagus_cuniculus|21004         ------------------------CTCACTATGGCGATGGGCAGTGGCGGCGGCGGCGTT
Tupaia_belangeri|2381               ------------------------ATGGCGATG---------GGCGGCGGCGGCGGCGTC
Gorilla_gorilla|1944                ------------------------ATGGCGATGAGCAGCGGCGGCAGTGGTGGCGGCGTC
Gorilla_gorilla|11041               ------------------------ATGGCGATGAGCAGCGGCGGCAGTGGTGGCGGCGTC
Homo_sapiens|69220                  ------------------------ATGGCGATGAGCAGCGGCGGCAGTGGTGGCGGCGTC
Homo_sapiens|69197                  ------------------------ATGGCGATGAGCAGCGGCGGCAGTGGTGGCGGCGTC
Pan_troglodytes|29425               ------------------------ATGGCGATGAGCAGCGGCGGCAGTGGTGGCGGCGTC
                                                                                                

Dipodomys_ordii|7239                TCGGAGCAGGAAGATTCGGTGCTGTTCCGGCGTGGCACGGGCCAGAGTGATGATTCTGAC
Callithrix_jacchus|46016            CTGGAGCAGGAGGATTTGGTGTGTTTCTGGTGTGGCACAGGCCAGAGTGATGATTCTGAC
Cavia_porcellus|7681                CCAGAGCAGGAAAACTCGGTGCTGTTTCGGCGCGGGACAGGCCAGAGTGATGACTCTGAC
Mus_musculus|11625                  TCCGAGCAGGAAGATACGGTGCTGTTCCGGCGTGGCACCGGCCAGAGTGATGATTCTGAC
Rattus_norvegicus|17826             TCTGAGCAGGAAGACACCGTGCTGTTCCGGCGTGGCACCGGCCAGAGTGATGATTCTGAC
Ochotona_princeps|15656             ---------------------------------------------AGTGATGATTCTGAC
Spermophilus_tridecemlineatus|12288 CCCGAGCAGGAAGACTCGGTGCTGTTCCGGCGCGGCACAGGCCAGNNNNNNNNNNNNNNN
Tarsius_syrichta|2731               ------------------------------------------------------------
Oryctolagus_cuniculus|21316         TCGGAGCCGGAGGACTCGGTGCTGTTCCGGCGCGGAACGGGCCAGAGTGATGATTCTGAC
Oryctolagus_cuniculus|19299         TCGGAGCCGGAGGACTCGGTGCTGTTCCGGCGCGGAACGGGCCAGAGTGATGATTCTGAC
Oryctolagus_cuniculus|21004         TCGGAGCCGGAGGACTCGGTGCTGTTCCGGCGCGGAACGGGCCAGAGTGATGATTCTGAC
Tupaia_belangeri|2381               CAGGAGCAGGAGGATTCAGTGCTGTTCCGTCGTGGCACAGGCCAGAGTGATGATTCCGAT
Gorilla_gorilla|1944                CCGGAGCAGGAGGATTCCGTGCTGTTCCGGCGCGGCACAGGCCAGAGCGATGATTCTGAC
Gorilla_gorilla|11041               CCGGAGCAGGAGGATTCCGTGCTGTTCCGGCGCGGCACAGGCCAGAGCGATGATTCTGAC
Homo_sapiens|69220                  CCGGAGCAGGAGGATTCCGTGCTGTTCCGGCGCGGCACAGGCCAGAGCGATGATTCTGAC
Homo_sapiens|69197                  CCGGAGCAGGAGGATTCCGTGCTGTTCCGGCGCGGCACAGGCCAGAGCGATGATTCTGAC
Pan_troglodytes|29425               CCGGAGCAGGAGGATTCCGTGCTGTTCCGGCGCGGCACAGGCCAGAGCGATGATTCTGAC
                                                                                                

Dipodomys_ordii|7239                ATCTGGGATGATACAGCATTGATAAAGGCGTATGATAAAGCTGTGGCTTCCTTTAAGNNN
Callithrix_jacchus|46016            ATTTGGGATGCTACGGCACTGCTAAAAGTGGATGATAAAGCTGTGGCTTCATTTAATCAT
Cavia_porcellus|7681                ATTTGGGATGATACAGCATTGATAAAAGCTTATGATAAAGCTGTGGCTTCCTTTAAGTAC
Mus_musculus|11625                  ATTTGGGATGATACAGCATTGATAAAAGCTTATGATAAAGCTGTGGCTTCCTTTAAGCAT
Rattus_norvegicus|17826             ATTTGGGATGATACAGCATTGATAAAAGCTTACGATAAAGCCGTGGCTTCCTTTAAGCAT
Ochotona_princeps|15656             ATTTGGGACGACACGGCGTTGATAAAGGCTTACGATAAGGCTGTAGCGTCATTTAAGCAT
Spermophilus_tridecemlineatus|12288 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAT
Tarsius_syrichta|2731               ---------------------------------------------------------CAT
Oryctolagus_cuniculus|21316         ATTTGGGATGATACAGCATTGATAAAAGCTTATGACAAAGCTGTAGCGTCATTTAAGCAT
Oryctolagus_cuniculus|19299         ATTTGGGATGATACAGCATTGATAAAAGCTTATGACAAAGCTGTAGCGTCATTTAAGCAT
Oryctolagus_cuniculus|21004         ATTTGGGATGATACAGCATTGATAAAAGCTTATGACAAAGCTGTAGCGTCATTTAAGCAT
Tupaia_belangeri|2381               ATTTGGGACGATACAGCATTGATAAAAGCTTATGATAAAGCTGTGGCTTCATTTAAGCAT
Gorilla_gorilla|1944                ATTTGGGATGATACAGCATTGATAAAAGCGTATGATAAAGCTGTGGCTTCATTTAAGCAT
Gorilla_gorilla|11041               ATTTGGGATGATACAGCATTGATAAAAGCGTATGATAAAGCTGTGGCTTCATTTAAGCAT
Homo_sapiens|69220                  ATTTGGGATGATACAGCACTGATAAAAGCATATGATAAAGCTGTGGCTTCATTTAAGCAT
Homo_sapiens|69197                  ATTTGGGATGATACAGCACTGATAAAAGCATATGATAAAGCTGTGGCTTCATTTAAGCAT
Pan_troglodytes|29425               ATTTGGGATGATACAGCATTGATAAAAGCATATGATAAAGCTGTGGCTTCATTTAAGCAT
                                                                                                

Dipodomys_ordii|7239                NNNNNNNNNNNNNNNNNNNNNNNN---------------NNNNNNNNNNNNNNNNNNNNN
Callithrix_jacchus|46016            GTGCTAAAGAATGGTGACATTTGT---------------GAAACTTCAGATAAACCAAAA
Cavia_porcellus|7681                GCTCTAAAGAATGGTGACATTTCAGATAAACCACAAGGAGAAATGTCCGGCAAACCGAAG
Mus_musculus|11625                  GCTCTAAAGAACGGTGACATTTGT---------------GAAACTCCAGATAAGCCAAAA
Rattus_norvegicus|17826             GCTCTAAAGAACGGTGACATGTGT---------------GAAACTTCAGATAAGCCAAAA
Ochotona_princeps|15656             GCGCTGAAGAACGGCGACATTGGT---------------GAAACTTCAGAGAAACCAAAA
Spermophilus_tridecemlineatus|12288 GCTCTAAAGAATGGTGACATTTGT---------------GAAACTTCAGATAAGCCAAAG
Tarsius_syrichta|2731               GCTCTAAAGAATGGTGACATTTGT---------------GAAACTTCAGATAAGCCAAAA
Oryctolagus_cuniculus|21316         GCTCTGAAGAATGGTGACATTTGT---------------GCAACTTCAGATAAACCTAAA
Oryctolagus_cuniculus|19299         GCTCTGAAGAATGGTGACATTTGT---------------GCAACTTCAGATAAACCTAAA
Oryctolagus_cuniculus|21004         GCTCTGAAGAATGGTGACATTTGT---------------GCAACTTCAGATAAACCTAAA
Tupaia_belangeri|2381               GCTCTAAAGAATGGTGACATTTGT---------------GAAACGTCAGATAAACCAAAA
Gorilla_gorilla|1944                GCTCTAAAGAATGGTGACATTTGT---------------GAAACTTCAGGTAAACCAAAA
Gorilla_gorilla|11041               GCTCTAAAGAATGGTGACATTTGT---------------GAAACTTCAGGTAAACCAAAA
Homo_sapiens|69220                  GCTCTAAAGAATGGTGACATTTGT---------------GAAACTTCGGGTAAACCAAAA
Homo_sapiens|69197                  GCTCTAAAGAATGGTGACATTTGT---------------GAAACTTCGGGTAAACCAAAA
Pan_troglodytes|29425               GCTCTAAAGAATGGTGACATTTGT---------------GAAACTTCAGGTAAACCAAAA
                                    .   .   .   .. .   .                   .        .           

Dipodomys_ordii|7239                NNNNNNNNN---------------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Callithrix_jacchus|46016            AGCATGCCT---------------AATAGACAATCTTCTAAGAATAATAAAAGCCAAGAA
Cavia_porcellus|7681                GGCACACCC---------------AGAAGAAAACCTGTTAAGAAGAGTAAAAGCCAGAAG
Mus_musculus|11625                  GGCACAGCC---------------AGAAGAAAACCTGCCAAGAAGAATAAAAGCCAAAAG
Rattus_norvegicus|17826             GGCACAGCT---------------AGAAGAAAACCTGCTAAGAAGAATAAAAACCAAAAG
Ochotona_princeps|15656             ATCACACCC---------------AGAAGAAAACCTGTTAAGAAGAATAAAAGCCAAAAG
Spermophilus_tridecemlineatus|12288 GGCACACCC---------------AGGCGAAAACCTGTTAAGAAGAATAAAAGCCAGAAG
Tarsius_syrichta|2731               ACCACACCT---------------AAAAGAAAACCTGCTAAGAAGAATAAAAGCCAAAAA
Oryctolagus_cuniculus|21316         GTCACACCT---------------AAAAGAAAACCTGTTAAGAAGAATAAATGCCAAAAG
Oryctolagus_cuniculus|19299         GTCACACCTAAAAGAAAACAAAAAAAAAGAAAACCTGTTAAGAAGAATAAATGCCAAAAG
Oryctolagus_cuniculus|21004         GTCACACCT---------------AAAAGAAAACCTGTTAAGAAGAATAAATGCCAAAAG
Tupaia_belangeri|2381               GGCATGCCT---------------AAAAGAAAACCTGCTAAGAAGAATAAATGCCAGAAG
Gorilla_gorilla|1944                ACCACACCT---------------AAAAGAAAACCTGCTAAGAAGAATAAAAGCCAAAAG
Gorilla_gorilla|11041               ACCACACCT---------------AAAAGAAAACCTGCTAAGAAGAATAAAAGCCAAAAG
Homo_sapiens|69220                  ACCACACCT---------------AAAAGAAAACCTGCTAAGAAGAATAAAAGCCAAAAG
Homo_sapiens|69197                  ACCACACCT---------------AAAAGAAAACCTGCTAAGAAGAATAAAAGCCAAAAG
Pan_troglodytes|29425               ACCACACCT---------------AAAAGAAAACCTGCTAAGAAGAATAAAAGCCAAAAG
                                                                .      .     .     .            

Dipodomys_ordii|7239                NNNNNNNNNNNNNNNNNNNNNNNNNNNTGGAAGGTTGGTGACAAATGTTCTGCTATTTGG
Callithrix_jacchus|46016            AAGAATAGTGCAACTTTCTTGAAT------------GGGGACAAATGTTCTGCCATTTGG
Cavia_porcellus|7681                AAGAATACCACAGCTCCCTCAAAACAGTGGAAAGTGGGTGACAGGTGTTCTGCTGTTTGG
Mus_musculus|11625                  AAGAATGCCACAACTCCCTTGAAACAGTGGAAAGTTGGTGACAAGTGTTCTGCTGTTTGG
Rattus_norvegicus|17826             AAGAATGCCACAGCTCCATTGAAACAGTGGAAAGCTGGTGACAAATGCTCTGCCGTTTGG
Ochotona_princeps|15656             AAGAACACCGCGGTGCCCTTGAAGCAGTGGAGAGTTGGCGACAGATGTTCCGCAGTTTGG
Spermophilus_tridecemlineatus|12288 AAGAATACTACAGCTCCCGTGAAACAGTGGAAAGTTGGTGATAAGTGTTCTGCCATTTGG
Tarsius_syrichta|2731               AGGAATACTGCAACTCCCCTGAAACAGTGGAAAGTTGGTGACCGATGTTCTGCCATTTGG
Oryctolagus_cuniculus|21316         AAGAAGACCACAACTGCCTTAAAACAGTGGAAGGTTGGTGACAAATGTTGTGCCATTTGG
Oryctolagus_cuniculus|19299         AAGAAGACCACAACTGCCTTAAAACAGTGGAAGGTTGGTGACAAATGTTGTGCCATTTGG
Oryctolagus_cuniculus|21004         AAGAAGACCACAACTGCCTTAAAACAGTGGAAGGTTGGTGACAAATGTTGTGCCATTTGG
Tupaia_belangeri|2381               AAGAATACCACAACTCCCTTGAAAAAGTGGAAAGTTGGTGACAAATGTTCTGCTGTTTGG
Gorilla_gorilla|1944                AAGAATACTGCAGCTTCCTTACAACAGTGGAAAGTTGGGGACAAATGTTCTGCCATTTGG
Gorilla_gorilla|11041               AAGAATACTGCAGCTTCCTTACAACAGTGGAAAGTTGGGGACAAATGTTCTGCCATTTGG
Homo_sapiens|69220                  AAGAATACTGCAGCTTCCTTACAACAGTGGAAAGTTGGGGACAAATGTTCTGCCATTTGG
Homo_sapiens|69197                  AAGAATACTGCAGCTTCCTTACAACAGTGGAAAGTTGGGGACAAATGTTCTGCCATTTGG
Pan_troglodytes|29425               AAGAATACTGCAGCTTCCTTACAACAGTGGAAAGTTGGGGACAAATGTTCTGCCATTTGG
                                      .                                 ** ** ...** *  ** .*****

Dipodomys_ordii|7239                TCAGAAGATGGCTGCATTTACCCAGCTACCATTGCTTCAGTTGATTTAAAGAGAGGAACC
Callithrix_jacchus|46016            TCAGAAGACAGTGGTATTTACCCAGCTACCATTGCTTCTGTTGATCTGAAGAGAGGAAGC
Cavia_porcellus|7681                TCAGAAGATGGCTGCATTTATCCAGCTACAATCGCTTCTGTGGATTTGAAGAGAGAAACC
Mus_musculus|11625                  TCAGAAGACGGCTGCATTTACCCAGCTACTATTACGTCCATTGACTTTAAGAGAGAAACC
Rattus_norvegicus|17826             TCGGAAGATGGCTGCGTTTACCCAGCTACCATCACGTCAGTTGACCTTAAGAGAGAAACC
Ochotona_princeps|15656             TCTGAAGATGGCTGCGTGTACCCAGCTACCATTGCTTCAATTGACTTCAAGCGAGAGACC
Spermophilus_tridecemlineatus|12288 TCAGAAGATGGCTGTATTTATCCAGCTACCATTGCTTCAGTTGATTTTAAGAGAGAAACC
Tarsius_syrichta|2731               TCAGAAGACGGCTGCATTTACCCAGCTACCATTGTTTCCATTGATTTCAAGAGAGAAACC
Oryctolagus_cuniculus|21316         TCAGAGGATGGCTGCATCTACCCAGCTACAATTGCTTCAGTTGATTTTAAGAGAGAAACC
Oryctolagus_cuniculus|19299         TCGGAGGACGGCTGCGTCTACCCAGCTACAATTGCTTCAGTTGATTTTAAGAGAGAAACC
Oryctolagus_cuniculus|21004         TCGGAGGACGGCTGCGTCTACCCAGCTACAATTGCTTCAGTTGATTTTAAGAGAGAAACC
Tupaia_belangeri|2381               TCAGAAGATGGCTGCATTTACCCAGCTACCATTGCTTCAATTGATTTTAAAAGAGAAACC
Gorilla_gorilla|1944                TCAGAAGACGGTTGCATTTACCCAGCTACCATTGCTTCAATTGATTTCAAGAGAGAAACC
Gorilla_gorilla|11041               TCAGAAGACGGTTGCATTTACCCAGCTACCATTGCTTCAATTGATTTCAAGAGAGAAACC
Homo_sapiens|69220                  TCAGAAGACGGTTGCATTTACCCAGCTACCATTGCTTCAATTGATTTTAAGAGAGAAACC
Homo_sapiens|69197                  TCAGAAGACGGTTGCATTTACCCAGCTACCATTGCTTCAATTGATTTTAAGAGAGAAACC
Pan_troglodytes|29425               TCAGAAGACGGTTGCATTTACCCAGCTACCATTGCTTCAATTGATTTCAAGAGAGAAACC
                                    ** **.** .*  * .* ** ******** ** .  ** .* **  * **..***..* *

Dipodomys_ordii|7239                TGTGTGGTGGTATACACTGGATATGGAAATAGAGAGGAACAAAGCCTATCTGATTTACTT
Callithrix_jacchus|46016            TGTGTTGTGGTTTACACTGGATATGGAAATAGG------AGCAATCTGTCTGATCTAGTT
Cavia_porcellus|7681                TGTGTTGTGGTCTATACTGGATATGGAAACAGGGAGGAACAAAATCTGTCTGATCTACTT
Mus_musculus|11625                  TGTGTCGTGGTTTATACTGGATATGGAAACAGAGAGGAGCAAAACTTATCTGACCTACTT
Rattus_norvegicus|17826             TGTGTCGTGGTTTATACTGGATATGGAAACAAAGAGGAGCAAAACCTATCTGATCTGCTT
Ochotona_princeps|15656             TGTGTCGTGGTTTACACTGGATACGGGAACAGAGAAGAGCAGAATCTGTCCGACCTACTT
Spermophilus_tridecemlineatus|12288 TGTATTGTGATTTACACTGGATATGGAAATAGAGAGGAGCAAAATCTGTCTGATCTGCTT
Tarsius_syrichta|2731               TGTGTGGTGGTTTACACTGGATACGGAAATAGGGAGGAGCAAAATCTGTCTGATATACTT
Oryctolagus_cuniculus|21316         TGTGTTGTGGTTTACACTGGATATGGAAACAGAGAAGAGCAAAATCTGTCTGATCTACTT
Oryctolagus_cuniculus|19299         TGTGTTGTGGTTTACACTGGATATGGAAACAGAGAAGAGCAAAATCTGTCTGATCTACTT
Oryctolagus_cuniculus|21004         TGTGTTGTGGTTTACACTGGATATGGAAACAGAGAAGAGCAAAATCTGTCTGATCTACTT
Tupaia_belangeri|2381               TGTGTTGTAGTTTATACCGGATATGGAAATAAAGAGGAACAAAATCTGTCTGATCTACTC
Gorilla_gorilla|1944                TGTGTTGTGGTTTACACTGGATATGGAAATAGAGAGGAGCAAAATCTGTCCGATCTACTT
Gorilla_gorilla|11041               TGTGTTGTGGTTTACACTGGATATGGAAATAGAGAGGAGCAAAATCTGTCCGATCTACTT
Homo_sapiens|69220                  TGTGTTGTGGTTTACACTGGATATGGAAATAGAGAGGAGCAAAATCTGTCCGATCTACTT
Homo_sapiens|69197                  TGTGTTGTGGTTTACACTGGATATGGAAATAGAGAGGAGCAAAATCTGTCCGATCTACTT
Pan_troglodytes|29425               TGTGTTGTGGTTTACACTGGATATGGAAATAGAGAGGAGCAAAATCTGTCCGATCTACTT
                                    ***.* **..* ** ** ***** **.** *..      .. *.  *.** **  *. * 

Dipodomys_ordii|7239                TCCCCAACCTCTGAAGTAGCAAATAATACAGAACAGGATGCTCAGGAG------------
Callithrix_jacchus|46016            TCTTCAACCTCT------GTAGCTAATATAGGACAAAATGCTCAAGAGAATGAAAACGAA
Cavia_porcellus|7681                TCCCCAAGCTCTGAAGCAGCCAACAACATGGAACAGAACACACAGGAGAATGAAAATGGA
Mus_musculus|11625                  TCCCCGACCTGTGAAGTAGCTAATAGTACAGAACAGAACACTCAGGAG------AATGAA
Rattus_norvegicus|17826             TCCCCGACCTGTGAAGTAGCTAACAATACAGAACAGAACACTCAGGAG------AATGAA
Ochotona_princeps|15656             TCCCCAACGTCCAAAGCGGCTGATGGCGTGGACCGCAGCGCTCAGGAGAATGAAAATGAA
Spermophilus_tridecemlineatus|12288 TCCCCAACCTCTGAAGTAGCTAATAATATAGAACAGAATACTCAGGAGAATGAAAATGAA
Tarsius_syrichta|2731               TCCCCAACCTCTGAAGCAACTAATAACGTTGAACAGAATGCTCAAGAGAATGAAAATGAA
Oryctolagus_cuniculus|21316         TCCCCAACATCTGAAGTGGCTAATAACATAGAACACAATGCTCAGGAGAATGAAAATGAA
Oryctolagus_cuniculus|19299         TCCCCAACATCTGAAGTGGCTAATAACATAGAACACAATGCTCAGGAGAATGAAAATGAA
Oryctolagus_cuniculus|21004         TCCCCAACATCTGAAGTGGCTAATAACATAGAACACAATGCTCAGGAGAATGAAAATGAA
Tupaia_belangeri|2381               TCACCAGTCTCTGAAGTAGTTAATAATATACAGCAGAATGCTCAAGAGAATGAAAATGAA
Gorilla_gorilla|1944                TCCCCAATCTGTGAAGTAGCTAATAATATAGAACAGAATGCTCAAGAGAATGAAAATGAA
Gorilla_gorilla|11041               TCCCCAATCTGTGAAGTAGCTAATAATATAGAACAGAATGCTCAAGAGAATGAAAATGAA
Homo_sapiens|69220                  TCCCCAATCTGTGAAGTAGCTAATAATATAGAACAAAATGCTCAAGAGAATGAAAATGAA
Homo_sapiens|69197                  TCCCCAATCTGTGAAGTAGCTAATAATATAGAACAAAATGCTCAAGAGAATGAAAATGAA
Pan_troglodytes|29425               TCCCCAATCTGTGAAGTAGCTAATAATATAGAACAGAATGCTCAAGAGAATGAAAATGAA
                                    **  *..  *        .  .. .. .   . *. .. .*:**.***            

Dipodomys_ordii|7239                ------------------------------------------------------------
Callithrix_jacchus|46016            AGTCAAGATTCAGTGGAGGAAAGTGAGAACTCCAGA------CCTGGAAACAAATCATGT
Cavia_porcellus|7681                AGTCAAGTTTCAACGGATGAAAGTGAGAACTCTTCCAAGTCTCCAGGAAGCAAACCAAGT
Mus_musculus|11625                  AGTCAAGTTTCCACAGACGACAGTGAACACTCCTCCAGATCGCTCAGAAGTAAAGCACAC
Rattus_norvegicus|17826             AGCCAAGTTTCCACAGACGACAGTGAACACTCCTCCAGATCGCTCAGAAGTAAAGCACAC
Ochotona_princeps|15656             AGCCAAGTTTCTACCGATGAAAGTGAGAATTCCTCCCGGTCACCTGGATGGAAACCCAGT
Spermophilus_tridecemlineatus|12288 AGTCAAGTTTCAACAGATGAAAGTGAAAACTCCTCTAGGTCTCCTGGAAATAAACCAAAT
Tarsius_syrichta|2731               AGTCAGATTTCAACAGATGAAAGTGAGAACTCCAAG---TCTCCTGGAAATAAGCCAAAT
Oryctolagus_cuniculus|21316         AGTCAAGTTTCTACAGATGAAAGTGAGAACAACTCCAGGTCTCCTGGAAGTAAACCAAAT
Oryctolagus_cuniculus|19299         AGTCAAGTTTCTACAGAAGAAAGTGAGAACTCCTCCAGGTCTCCTGGAAGTAAACCAAAT
Oryctolagus_cuniculus|21004         AGTCAAGTTTCTACAGATGAAAGTGAGAACTCCTCCAGGTCTCCTGGAAGTAAACCAAAT
Tupaia_belangeri|2381               AGTCAAGTTTCAACAGATGAAAGTGAGAACTCCTCCACATCTCCTGGAAACAAACCAAGT
Gorilla_gorilla|1944                AGCCAAGTTTCAACAGATGAAAGTGAGAACTCCAGG---TCTCCTGGAAATAAATCAGAT
Gorilla_gorilla|11041               AGCCAAGTTTCAACAGATGAAAGTGAGAACTCCAGG---TCTCCTGGAAATAAATCAGAT
Homo_sapiens|69220                  AGCCAAGTTTCAACAGATGAAAGTGAGAACTCCAGG---TCTCCTGGAAATAAATCAGAT
Homo_sapiens|69197                  AGCCAAGTTTCAACAGATGAAAGTGAGAACTCCAGG---TCTCCTGGAAATAAATCAGAT
Pan_troglodytes|29425               AGCCAAGTTTCAACAGATGAAAGTGAGAACTCCAGG---TCTCCTGGAAATAAATCAGAT
                                                                                                

Dipodomys_ordii|7239                ------------------------------------------------------------
Callithrix_jacchus|46016            AGTATCAGGTCAAAAGCTACTCCATGGAATTCTTTTCTC---CCTCCACCAAACCCCATG
Cavia_porcellus|7681                ACGGTCAGGTCGAAAGCCACACCCTGGAACTCCTTTTTCCCTCCGCCACCACCCCCCGTT
Mus_musculus|11625                  AGC---AAGTCCAAAGCTGCTCCGTGGACCTCATTTCTT---CCTCCACCACCCCCAATG
Rattus_norvegicus|17826             AGC---AAGTCCAAAGCTGCTCCATGGACCTCGTTTCTC---CCTCCACCTCCCCCGGTG
Ochotona_princeps|15656             AACATCAAGTCGAAATCTAATGCCTGGAACTCTTTCTTC---CCCCCACCACCCCCGGTG
Spermophilus_tridecemlineatus|12288 AACATCAAGTCAAAAGCAACTCCATGGGACTGTTTTCTC---CCTCCACCACCCCCAATG
Tarsius_syrichta|2731               AACATCAAGTCCAAAGCTGTCCCATGGAACTCTTTTCTC---CCTCCACCGCCCCCCATG
Oryctolagus_cuniculus|21316         AATATCAAGTCAAAAGCTCATCCTTGGAACTCCTTCCTC---CCTCCGCCTCCCCCCATG
Oryctolagus_cuniculus|19299         AATATCAAGTCAAAAGCTCATCCTTGGAACTCCTTTCTC---CCTCCGCCTCCCCCCATG
Oryctolagus_cuniculus|21004         AATATCAAGTCAAAAGCTCATCCTTGGAACTCCTTCCTC---CCTCCGCCTCCCCCCATG
Tupaia_belangeri|2381               AACACCAAGTCAAAAGCTACTCCATGGAATTCTTTTCTC---CCTCCACCACCCCCTATG
Gorilla_gorilla|1944                AACATCAAGCCCAAATCTGCTCCATGGAACTCTTTTCTC---CCTCCACCACCCCCCATG
Gorilla_gorilla|11041               AACATCAAGCCCAAATCTGCTCCATGGAACTCTTTTCTC---CCTCCACCACCCCCCATG
Homo_sapiens|69220                  AACATCAAGCCCAAATCTGCTCCATGGAACTCTTTTCTC---CCTCCACCACCCCCCATG
Homo_sapiens|69197                  AACATCAAGCCCAAATCTGCTCCATGGAACTCTTTTCTC---CCTCCACCACCCCCCATG
Pan_troglodytes|29425               AACATCAAGCCCAAATCTGCTCCATGGAACTCTTTTCTC---CCTCCACCACCCCCCATG
                                                                                                

Dipodomys_ordii|7239                ------------------------------------------------------------
Callithrix_jacchus|46016            CCAGCATCAGGA---CTGGGACCAGAT---------CTAAAATTCAATAGCCCACCA---
Cavia_porcellus|7681                CCTAGCTCAGGA---TCTGGACCTGGAAAGCCAGGTCTAAAATTCAGTGGCCTACCC---
Mus_musculus|11625                  CCAGGGTCAGGA---TTAGGACCAGGAAAGCCAGGTCTAAAATTCAACGGCCCGCCG---
Rattus_norvegicus|17826             CCCGGGGCGGGA---TTAGGACCAGGAAAGCCAGGTCTAAGGTTCAATGGCCCACCG---
Ochotona_princeps|15656             CCAGGGCCAGGAGTCGTCGGCTCAGGCAAGCCAGGCCTAAAATTCAGTGGTCCGCCG---
Spermophilus_tridecemlineatus|12288 CCAGGGTCAGGA---TTGGGACCAGGAAAGNNNNNNNNNNNNNNNNNNNNNNNNNNN---
Tarsius_syrichta|2731               CCTGGGTCAGGA---CTGGGACCAGGAAAGNNNNNNNNNNNNNNNNNNNNNNNNNNN---
Oryctolagus_cuniculus|21316         CCAGGATCAGGA---ATGGGACCTGGAAAGCCAGGTCTAAAATTCAGTGCC---------
Oryctolagus_cuniculus|19299         CCAGGATCAGGA---ATGGGACCTGGAAAGCCAGGTCTAAAATTCAGTGcC---------
Oryctolagus_cuniculus|21004         CCAGGATCAGGA---ATGGGACCTGGAAAGCCAGGTCTAAAATTCAGTGCC---------
Tupaia_belangeri|2381               CCAGGGTCAGGA---CTGGGACCAGGAAAG------------------------------
Gorilla_gorilla|1944                CCAGGGCCAAGA---CTGGGACCAGGAAAGCCAGGTCTAAAATTCAATGGCCCATCT---
Gorilla_gorilla|11041               CCAGGGCCAAGA---CTGGGACCAGGAAAG------------------------------
Homo_sapiens|69220                  CCAGGGCCAAGA---CTGGGACCAGGAAAGCCAGGTCTAAAATTCAATGGCccacca---
Homo_sapiens|69197                  CCAGGGCCAAGA---CTGGGACCAGGAAAGCCAGGTCTAAAATTCAATGGCccacca---
Pan_troglodytes|29425               CCAGGGCCAAGA---CTGGGACCAGGAAAGCCAGGTCTAAAATTCAATGGCccaccaccg
                                                                                                

Dipodomys_ordii|7239                ------------------------------------------------------------
Callithrix_jacchus|46016            ------------------CCCATACCACTCTACTTCCTATCATGCTGGCTGCCTCCATTT
Cavia_porcellus|7681                ------------CCACCCCCACCACCTCCACACTTCCTGTCATGCTGGCTGCCTCCATTT
Mus_musculus|11625                  ------CCGCCGCCTCCACTACCCCCTCCCCCCTTCCTGCCGTGCTGGATGCCCCCGTTC
Rattus_norvegicus|17826             ---------CCGCCGCCACCTCCCCCTCCCCCGTTCTTGCCGTGTTGGATGCCTCCGTTC
Ochotona_princeps|15656             ------CCACCACCGCCGCCCCTGCCACCCCATTTCATGTCATGCTGGCTACCCCCGTTT
Spermophilus_tridecemlineatus|12288 ------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|2731               ------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Oryctolagus_cuniculus|21316         ------------------------------CACTTCCTGTCATGCTGGCTGCCCCCATTT
Oryctolagus_cuniculus|19299         ------------------------------CACTTCCTGTCATGCTGGCTGCCCCCATTT
Oryctolagus_cuniculus|21004         ------------------------------CACTTCCTGTCATGCTGGCTGCCCCCATTT
Tupaia_belangeri|2381               ------------------------------------------------------------
Gorilla_gorilla|1944                ------------------------CCTACGGACATGTTCTATTGTATTTTAGTCAGAACA
Gorilla_gorilla|11041               ------------------------------------------------------------
Homo_sapiens|69220                  ------ccgccaccgccaccaccaccaccCCACTTACTATCATGCTGGCTGCCTCCATTT
Homo_sapiens|69197                  ------ccgccaccgccaccaccaccaccCCACTTACTATCATGCTGGCTGCCTCCATTT
Pan_troglodytes|29425               ccactgccaccaccaccaccaccaccaccccacTTACTATCATGCTGGCTGCCTCCATTT
                                                                                                

Dipodomys_ordii|7239                ------------------------------------------------------------
Callithrix_jacchus|46016            CCTTCTGGACCACGAATAATCCCCCCACCACCTCTCACATGTCTAGATTTTCTTGATGAT
Cavia_porcellus|7681                CCGGCTGGACCTCCAATGATCCCCCCGCCGCCTCCCATCTGTCCAGACTCGTTTGATGAT
Mus_musculus|11625                  CCTTCAGGACCACCAATAATCCCGCCACCCCCTCCCATCTCTCCCGACTGTCTGGATGAC
Rattus_norvegicus|17826             CCTTCAGGACCACCAATAATTCCTCCACCCCCTCCCATATCTCCCGACTGTCTGGATGAC
Ochotona_princeps|15656             CCTTCTGGACCACCGGTAATTCCCCCGCCCCCTCCCATGTTCCCCGATTCCCTGGATGAT
Spermophilus_tridecemlineatus|12288 NNNNNNNNNCCCCCAATAATTCCCCCACCACCTCCTATATGTCCAGATTCT---GATGAT
Tarsius_syrichta|2731               NNNNNNNNNNNNNNNATAATTCCCCCACCACCTCCCATATGTCCAGATTCTCTTGATGAT
Oryctolagus_cuniculus|21316         CCTTCTGGGCCACCAGTAATTCCCCCACCACCTCCCATATGTCCAGATTCTCTTGATGAT
Oryctolagus_cuniculus|19299         CCTTCTGGGCCACCAGTAATTCCTCCACCACCTCCCATATGTCCAGATTCTCTTGATGAT
Oryctolagus_cuniculus|21004         CCTTCTGGGCCACCAGTAATTCCCCCACCACCTCCCATATGTCCAGATTCTCTTGATGAT
Tupaia_belangeri|2381               ------------------------------------------------------------
Gorilla_gorilla|1944                TTTAAA---------ATTATTTTTAAAAGTAAGCTCTTGTGCCCTGATCAGTTATCTGAC
Gorilla_gorilla|11041               ---------------ATAATTCCCCCACCACCTCCCATATGTCCAGATTCTCTTGATGAT
Homo_sapiens|69220                  CCTTCTGGACCACCAATAATTCCCCCACCACCTCCCATATGTCCAGATTCTCTTGATGAT
Homo_sapiens|69197                  CCTTCTGGACCACCAATAATTCCCCCACCACCTCCCATATGTCCAGATTCTCTTGATGAT
Pan_troglodytes|29425               CCTTCTGGACCACCAATAATTCCCCCACCACCTCCCATATGTCCAGATTCTCTTGATGAT
                                                                                                

Dipodomys_ordii|7239                ------------------------------------------------------------
Callithrix_jacchus|46016            GATAATGCTTTAGGAAGTATGTTAATCTCTTGGTACATGAGTGGCTATCATACTGGCTAC
Cavia_porcellus|7681                GCAGACGCACTGGGCAGCATGCTGATGTCGTGGTACATGAGTGGCTATCACACTGGCTAC
Mus_musculus|11625                  ACTGATGCCCTGGGCAGTATGCTAATCTCTTGGTACATGAGTGGCTACCACACTGGCTAC
Rattus_norvegicus|17826             ACGGATGCTCTGGGCAGTATGCTAATCTCTTGGTACATGAGTGGTTACCACACTGGTTAC
Ochotona_princeps|15656             ACAGATGCCTTGGGAAGCATGTTAATCTCTTGGTACATGAGTGGCTATCATACTGGCTAC
Spermophilus_tridecemlineatus|12288 GCTGATGCTTTGGGAAGCATGTTAATCTCTTGGTATATGAGTGGCTATCATACTGGCTAT
Tarsius_syrichta|2731               GCCGATGCTTTGGGAAGTATGTTAATCTCTTGGTACATGAGTGGCTATCATACTGGCTAT
Oryctolagus_cuniculus|21316         GCTGATGCCTTGGGAAGTATGTTAATCTCTTGGTACATGAGTGGCTATCATACTGGCTAC
Oryctolagus_cuniculus|19299         GCTGATGCCTTGGGAAGTATGTTAATCTCTTGGTACATGAGTGGCTATCATACTGGCTAC
Oryctolagus_cuniculus|21004         GCTGATGCCTTGGGAAGTATGTTAATCTCTTGGTACATGAGTGGCTATCATACTGGCTAC
Tupaia_belangeri|2381               ------------------------------------------------------------
Gorilla_gorilla|1944                TGTAACACTGTAGGCTTTTATATTATGTCATGGAACCTTAAGGGACTTCCTTTATTTTCC
Gorilla_gorilla|11041               GCTGATGCTTTGGGAAGTATGTTAATTTCATGGTACATGAGTGGCTATCATACTGGCTAT
Homo_sapiens|69220                  GCTGATGCTTTGGGAAGTATGTTAATTTCATGGTACATGAGTGGCTATCATACTGGCTAT
Homo_sapiens|69197                  GCTGATGCTTTGGGAAGTATGTTAATTTCATGGTACATGAGTGGCTATCATACTGGCTAT
Pan_troglodytes|29425               GCTGATGCTTTGGGAAGTATGTTAATTTCATGGTACATGAGTGGCTATCATACTGGCTAT
                                                                                                

Dipodomys_ordii|7239                ------------------------------------------------------------
Callithrix_jacchus|46016            TATACAGGGTTT---GAAAATCAAAAAGAAGGA---AGGTGCTCACATTCTGAT---TAA
Cavia_porcellus|7681                TACATGGGTTTCAGACAAAATCAAAAAGAAGGG---AGGAGCTCACATTTTAAT---TGA
Mus_musculus|11625                  TATATGGGTTTCAGACAAAATAAAAAAGAAGGA---AAGTGCTCACATACAAAT---TAA
Rattus_norvegicus|17826             TATATGGGTTTCAGACAAAATAAAAAAGAAGGAAAGAAGTGCTCACATACAAAT---TAA
Ochotona_princeps|15656             TACATG------------------------------------------------------
Spermophilus_tridecemlineatus|12288 TATATGGGTTTCAGACAAAATCAAAAAGAAGGG---AGATGCTCACATTTCAAT---TAA
Tarsius_syrichta|2731               TATATG------------------------------------------------------
Oryctolagus_cuniculus|21316         TACATGGGCTTCAAGCAAAGTCAGAAAGAAGGA---AGATGCTCACATTTCAGGAAC---
Oryctolagus_cuniculus|19299         TACATGGGCTTCAAGCAAAGTCAGAAAGAAGGA---AGATGCTCACATTTCAAGAAC---
Oryctolagus_cuniculus|21004         TACATGGGCTTCAAGCAAAGTCAGAAAGAAGGA---AGATGCTCACATTTCAAT---TAA
Tupaia_belangeri|2381               ------------------------------------------------------------
Gorilla_gorilla|1944                TTACAGGGTTTCAGACAAAATCAAAAAGAAGGA---AGGTGCTCACATTCCTTAAATTAA
Gorilla_gorilla|11041               TATATG------------------------------------------------------
Homo_sapiens|69220                  TATATGGGTTTCAGACAAAATCAAAAAGAAGGA---AGGTGCTCACATTCCTTAAATTAA
Homo_sapiens|69197                  TATATGGGTTTTAGACAAAATCAAAAAGAAGGA---AGGTGCTCACATTCCTTAAATTAA
Pan_troglodytes|29425               TATATGGGTTTCAGACAAAATCAAAAAGAAGGA---AGGTGCTCACATTCCTTAAATTAA
                                                                                                

multiple sequence alignment in CLUSTALW format


Dipodomys_ordii|6802                --------MAMSSGGGGGGVSEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKX
Callithrix_jacchus|37231            --------LAMGSASSGHGILEQEDLVCFWCGTGQSDDSDIWDATALLKVDDKAVASFNH
Cavia_porcellus|5981                RQPRRRLAMAMSSSGDGGCVPEQENSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKY
Mus_musculus|53927                  --------MAMGSGGAG---SEQEDTVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKH
Rattus_norvegicus|24409             --------MAMGSGGAG---SEQEDTVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKH
Ochotona_princeps|13645             -----------------------------------SDDSDIWDDTALIKAYDKAVASFKH
Spermophilus_tridecemlineatus|11013 --------MAMGPGGGSSGVPEQEDSVLFRRGTGQXXXXXXXXXXXXXXXXXXXXXXXXH
Tarsius_syrichta|2501               -----------------------------------------------------------H
Oryctolagus_cuniculus|8003          --------MAMSSGGGG--VSEPEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKH
Oryctolagus_cuniculus|10723         --------MAMSSGGGG--ISEPEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKH
Oryctolagus_cuniculus|11677         --------LTMAMGSGGGGVSEPEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKH
Tupaia_belangeri|2078               --------MAM---GGGGGVQEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKH
Gorilla_gorilla|1847                --------MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKH
Gorilla_gorilla|9223                --------MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKH
Homo_sapiens|18813                  --------MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKH
Homo_sapiens|17394                  --------MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKH
Pan_troglodytes|9055                --------MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKH
                                                                                                

Dipodomys_ordii|6802                XXXXXXXX-----XXXXXXXXXX-----XXXXXXXXXXXXXXXXXXXXXWKVGDKCSAIW
Callithrix_jacchus|37231            VLKNGDIC-----ETSDKPKSMP-----NRQSSKNNKSQEKNSATFLN----GDKCSAIW
Cavia_porcellus|5981                ALKNGDISDKPQGEMSGKPKGTP-----RRKPVKKSKSQKKNTTAPSKQWKVGDRCSAVW
Mus_musculus|53927                  ALKNGDIC-----ETPDKPKGTA-----RRKPAKKNKSQKKNATTPLKQWKVGDKCSAVW
Rattus_norvegicus|24409             ALKNGDMC-----ETSDKPKGTA-----RRKPAKKNKNQKKNATAPLKQWKAGDKCSAVW
Ochotona_princeps|13645             ALKNGDIG-----ETSEKPKITP-----RRKPVKKNKSQKKNTAVPLKQWRVGDRCSAVW
Spermophilus_tridecemlineatus|11013 ALKNGDIC-----ETSDKPKGTP-----RRKPVKKNKSQKKNTTAPVKQWKVGDKCSAIW
Tarsius_syrichta|2501               ALKNGDIC-----ETSDKPKTTP-----KRKPAKKNKSQKRNTATPLKQWKVGDRCSAIW
Oryctolagus_cuniculus|8003          ALKNGDIC-----ATSDKPKVTP-----KRKPVKKNKCQKKKTTTALKQWKVGDKCCAIW
Oryctolagus_cuniculus|10723         ALKNGDIC-----ATSDKPKVTPKRKQKKRKPVKKNKCQKKKTTTALKQWKVGDKCCAIW
Oryctolagus_cuniculus|11677         ALKNGDIC-----ATSDKPKVTP-----KRKPVKKNKCQKKKTTTALKQWKVGDKCCAIW
Tupaia_belangeri|2078               ALKNGDIC-----ETSDKPKGMP-----KRKPAKKNKCQKKNTTTPLKKWKVGDKCSAVW
Gorilla_gorilla|1847                ALKNGDIC-----ETSGKPKTTP-----KRKPAKKNKSQKKNTAASLQQWKVGDKCSAIW
Gorilla_gorilla|9223                ALKNGDIC-----ETSGKPKTTP-----KRKPAKKNKSQKKNTAASLQQWKVGDKCSAIW
Homo_sapiens|18813                  ALKNGDIC-----ETSGKPKTTP-----KRKPAKKNKSQKKNTAASLQQWKVGDKCSAIW
Homo_sapiens|17394                  ALKNGDIC-----ETSGKPKTTP-----KRKPAKKNKSQKKNTAASLQQWKVGDKCSAIW
Pan_troglodytes|9055                ALKNGDIC-----ETSGKPKTTP-----KRKPAKKNKSQKKNTAASLQQWKVGDKCSAIW
                                                                                        **:*.*:*

Dipodomys_ordii|6802                SEDGCIYPATIASVDLKRGTCVVVYTGYGNREEQSLSDLLSPTSEVANNTEQDAQE----
Callithrix_jacchus|37231            SEDSGIYPATIASVDLKRGSCVVVYTGYGNR--SNLSDLVSSTS--VANIGQNAQENENE
Cavia_porcellus|5981                SEDGCIYPATIASVDLKRETCVVVYTGYGNREEQNLSDLLSPSSEAANNMEQNTQENENG
Mus_musculus|53927                  SEDGCIYPATITSIDFKRETCVVVYTGYGNREEQNLSDLLSPTCEVANSTEQNTQE--NE
Rattus_norvegicus|24409             SEDGCVYPATITSVDLKRETCVVVYTGYGNKEEQNLSDLLSPTCEVANNTEQNTQE--NE
Ochotona_princeps|13645             SEDGCVYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPTSKAADGVDRSAQENENE
Spermophilus_tridecemlineatus|11013 SEDGCIYPATIASVDFKRETCIVIYTGYGNREEQNLSDLLSPTSEVANNIEQNTQENENE
Tarsius_syrichta|2501               SEDGCIYPATIVSIDFKRETCVVVYTGYGNREEQNLSDILSPTSEATNNVEQNAQENENE
Oryctolagus_cuniculus|8003          SEDGCIYPATIASVDFKRETCVVVYTGYGNREEQNLSDLLSPTSEVANNIEHNAQENENE
Oryctolagus_cuniculus|10723         SEDGCVYPATIASVDFKRETCVVVYTGYGNREEQNLSDLLSPTSEVANNIEHNAQENENE
Oryctolagus_cuniculus|11677         SEDGCVYPATIASVDFKRETCVVVYTGYGNREEQNLSDLLSPTSEVANNIEHNAQENENE
Tupaia_belangeri|2078               SEDGCIYPATIASIDFKRETCVVVYTGYGNKEEQNLSDLLSPVSEVVNNIQQNAQENENE
Gorilla_gorilla|1847                SEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENE
Gorilla_gorilla|9223                SEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENE
Homo_sapiens|18813                  SEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENE
Homo_sapiens|17394                  SEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENE
Pan_troglodytes|9055                SEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENE
                                    ***. :*****.*:*:** :*:*:******:  ..***::*. .  . .  :.:**    

Dipodomys_ordii|6802                ------------------------------------------------------------
Callithrix_jacchus|37231            SQDSVEESENSR--PGNKSCSIRSKATPWNSFL-PPPNPMPASG-LGPD---LKFNSPP-
Cavia_porcellus|5981                SQVSTDESENSSKSPGSKPSTVRSKATPWNSFFPPPPPPVPSSG-SGPGKPGLKFSGLP-
Mus_musculus|53927                  SQVSTDDSEHSSRSLRSKAHS-KSKAAPWTSFL-PPPPPMPGSG-LGPGKPGLKFNGPP-
Rattus_norvegicus|24409             SQVSTDDSEHSSRSLRSKAHS-KSKAAPWTSFL-PPPPPVPGAG-LGPGKPGLRFNGPP-
Ochotona_princeps|13645             SQVSTDESENSSRSPGWKPSNIKSKSNAWNSFF-PPPPPVPGPGVVGSGKPGLKFSGPP-
Spermophilus_tridecemlineatus|11013 SQVSTDESENSSRSPGNKPNNIKSKATPWDCFL-PPPPPMPGSG-LGPGKXXXXXXXXX-
Tarsius_syrichta|2501               SQISTDESENSK-SPGNKPNNIKSKAVPWNSFL-PPPPPMPGSG-LGPGKXXXXXXXXX-
Oryctolagus_cuniculus|8003          SQVSTDESENNSRSPGSKPNNIKSKAHPWNSFL-PPPPPMPGSG-MGPGKPGLKFSA---
Oryctolagus_cuniculus|10723         SQVSTEESENSSRSPGSKPNNIKSKAHPWNSFL-PPPPPMPGSG-MGPGKPGLKFSA---
Oryctolagus_cuniculus|11677         SQVSTDESENSSRSPGSKPNNIKSKAHPWNSFL-PPPPPMPGSG-MGPGKPGLKFSA---
Tupaia_belangeri|2078               SQVSTDESENSSTSPGNKPSNTKSKATPWNSFL-PPPPPMPGSG-LGPGK----------
Gorilla_gorilla|1847                SQVSTDESENSR-SPGNKSDNIKPKSAPWNSFL-PPPPPMPGPR-LGPGKPGLKFNGPS-
Gorilla_gorilla|9223                SQVSTDESENSR-SPGNKSDNIKPKSAPWNSFL-PPPPPMPGPR-LGPGK----------
Homo_sapiens|18813                  SQVSTDESENSR-SPGNKSDNIKPKSAPWNSFL-PPPPPMPGPR-LGPGKPGLKFNGPP-
Homo_sapiens|17394                  SQVSTDESENSR-SPGNKSDNIKPKSAPWNSFL-PPPPPMPGPR-LGPGKPGLKFNGPP-
Pan_troglodytes|9055                SQVSTDESENSR-SPGNKSDNIKPKSAPWNSFL-PPPPPMPGPR-LGPGKPGLKFNGPPP
                                                                                                

Dipodomys_ordii|6802                ------------------------------------------------------------
Callithrix_jacchus|37231            ------PIPLYFLSCWLPPFPSGPRIIPPPPLTCLDFLDDDNALGSMLISWYMSGYHTGY
Cavia_porcellus|5981                ----PPPPPPHFLSCWLPPFPAGPPMIPPPPPICPDSFDDADALGSMLMSWYMSGYHTGY
Mus_musculus|53927                  --PPPPLPPPPFLPCWMPPFPSGPPIIPPPPPISPDCLDDTDALGSMLISWYMSGYHTGY
Rattus_norvegicus|24409             ---PPPPPPPPFLPCWMPPFPSGPPIIPPPPPISPDCLDDTDALGSMLISWYMSGYHTGY
Ochotona_princeps|13645             --PPPPPLPPHFMSCWLPPFPSGPPVIPPPPPMFPDSLDDTDALGSMLISWYMSGYHTGY
Spermophilus_tridecemlineatus|11013 --XXXXXXXXXXXXXXXXXXXXXPPIIPPPPPICPDS-DDADALGSMLISWYMSGYHTGY
Tarsius_syrichta|2501               --XXXXXXXXXXXXXXXXXXXXXXXIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGY
Oryctolagus_cuniculus|8003          ----------HFLSCWLPPFPSGPPVIPPPPPICPDSLDDADALGSMLISWYMSGYHTGY
Oryctolagus_cuniculus|10723         ----------HFLSCWLPPFPSGPPVIPPPPPICPDSLDDADALGSMLISWYMSGYHTGY
Oryctolagus_cuniculus|11677         ----------HFLSCWLPPFPSGPPVIPPPPPICPDSLDDADALGSMLISWYMSGYHTGY
Tupaia_belangeri|2078               ------------------------------------------------------------
Gorilla_gorilla|1847                --------PTDMFYCILVRTFK---IIFKSKLLCPDQLSDCNTVGFYIMSWNLKGLPLFS
Gorilla_gorilla|9223                -------------------------IIPPPPPICPDSLDDADALGSMLISWYMSGYHTGY
Homo_sapiens|18813                  --PPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGY
Homo_sapiens|17394                  --PPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGY
Pan_troglodytes|9055                PLPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGY
                                                                                                

Dipodomys_ordii|6802                -------------------
Callithrix_jacchus|37231            YTGF-ENQKEG-RCSHSD-
Cavia_porcellus|5981                YMGFRQNQKEG-RSSHFN-
Mus_musculus|53927                  YMGFRQNKKEG-KCSHTN-
Rattus_norvegicus|24409             YMGFRQNKKEGKKCSHTN-
Ochotona_princeps|13645             YM-----------------
Spermophilus_tridecemlineatus|11013 YMGFRQNQKEG-RCSHFN-
Tarsius_syrichta|2501               YM-----------------
Oryctolagus_cuniculus|8003          YMGFKQSQKEG-RCSHFRN
Oryctolagus_cuniculus|10723         YMGFKQSQKEG-RCSHFKN
Oryctolagus_cuniculus|11677         YMGFKQSQKEG-RCSHFN-
Tupaia_belangeri|2078               -------------------
Gorilla_gorilla|1847                LQGFRQNQKEG-RCSHSLN
Gorilla_gorilla|9223                YM-----------------
Homo_sapiens|18813                  YMGFRQNQKEG-RCSHSLN
Homo_sapiens|17394                  YMGFRQNQKEG-RCSHSLN
Pan_troglodytes|9055                YMGFRQNQKEG-RCSHSLN