Orthologs Set ID: EOG4003J4


Orthology Database
OrthoDB4
Gene Symbol(s)
GM2A

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 35681 99, 102, 108, 261, 444
Cavia porcellus 23059 261, 444
Dipodomys ordii 3295 99, 261, 444
Gorilla gorilla 22577 99, 261, 444
Homo sapiens 70641 99, 261, 444
Microcebus murinus 745 99, 261, 444
Mus musculus 5542 99, 261, 444
Ochotona princeps 14028 99, 261, 444
Otolemur garnettii 405 261, 342, 435, 444
Pan troglodytes 30432 99, 261, 444
Rattus norvegicus 5589 99, 261, 444
Spermophilus tridecemlineatus 12230 99, 261, 296, 444
Tarsius syrichta 3464 261
Tupaia belangeri 5261 261

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 35681 ENSCJAT00000059657 100411846 ENSCJAG00000015524 GM2A calJac3
Cavia porcellus 23059 ENSCPOT00000000317 100731438 ENSCPOG00000000314 GM2A cavPor3
Dipodomys ordii 3295 ENSDORT00000012628 ENSDORG00000012628 Gm2a dipOrd1
Gorilla gorilla 22577 ENSGGOT00000015354 101134809 ENSGGOG00000015302 GM2A gorGor3
Homo sapiens 70641 ENST00000357164 2760 ENSG00000196743 GM2A hg19,GRCh37
Microcebus murinus 745 ENSMICT00000000688 ENSMICG00000000690 GM2A micMur1
Mus musculus 5542 ENSMUST00000000608 14667 ENSMUSG00000000594 Gm2a mm9
Ochotona princeps 14028 ENSOPRT00000006162 101532776 ENSOPRG00000006171 GM2A OchPri2.0
Otolemur garnettii 405 ENSOGAT00000000391 ENSOGAG00000000390 GM2A otoGar1
Pan troglodytes 30432 ENSPTRT00000032239 471705 ENSPTRG00000017431 LOC471705 panTro2
Rattus norvegicus 5589 ENSRNOT00000015803, NM_172335 282838 ENSRNOG00000052219 Gm2a rn4
Spermophilus tridecemlineatus 12230 ENSSTOT00000012231 speTri1
Tarsius syrichta 3464 ENSTSYT00000005129 103270286 ENSTSYG00000005131 GM2A tarSyr1
Tupaia belangeri 5261 ENSTBET00000005262 ENSTBEG00000005276 GM2A tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 27405 ENSCJAP00000046677 100411846 ENSCJAG00000015524 GM2A calJac3
Cavia porcellus 18232 ENSCPOP00000000273 100731438 ENSCPOG00000000314 GM2A cavPor3
Dipodomys ordii 3085 ENSDORP00000011874 ENSDORG00000012628 Gm2a dipOrd1
Gorilla gorilla 17736 ENSGGOP00000014927 101134809 ENSGGOG00000015302 GM2A gorGor3
Homo sapiens 17981 ENSP00000349687 2760 ENSG00000196743 GM2A hg19,GRCh37
Microcebus murinus 619 ENSMICP00000000618 ENSMICG00000000690 GM2A micMur1
Mus musculus 11578 ENSMUSP00000000608 14667 ENSMUSG00000000594 Gm2a mm9
Ochotona princeps 12237 ENSOPRP00000005651 101532776 ENSOPRG00000006171 GM2A OchPri2.0
Otolemur garnettii 347 ENSOGAP00000000348 ENSOGAG00000000390 GM2A otoGar1
Pan troglodytes 23641 ENSPTRP00000029783 471705 ENSPTRG00000017431 LOC471705 panTro2
Rattus norvegicus 15296 ENSRNOP00000015804 rn4
Spermophilus tridecemlineatus 10966 ENSSTOP00000010965 speTri1
Tarsius syrichta 3180 ENSTSYP00000004687 103270286 ENSTSYG00000005131 GM2A tarSyr1
Tupaia belangeri 4550 ENSTBEP00000004537 ENSTBEG00000005276 GM2A tupBel1

multiple sequence alignment in CLUSTALW format


Tupaia_belangeri|5261               ------------------------------------------------------------
Callithrix_jacchus|35681            ------ATGCAATTCCTGATGCAGGCT---CCGCTCCTGATCGCCCTGGGCTTGTTTCTC
Homo_sapiens|70641                  ------ATGCAGTCCCTGATGCAGGCT---CCCCTCCTGATCGCCCTGGGCTTGCTTCTC
Gorilla_gorilla|22577               ------ATGCAGTCCCTGATGCAGTCT---CCCCTCCTGATCGCCCTGGGCTTGCTTCTC
Pan_troglodytes|30432               ------ATGCAGTCCCTGATGCAGGCT---CCCCTCCTGATCGCCCTGGGCTTGCTTCTC
Spermophilus_tridecemlineatus|12230 ------ATGCATCCCTTGATGCGTACT---CTGCTCCTGATCTTTCTGGGCTTGCTTCTT
Otolemur_garnettii|405              ------------------------------------------------------------
Dipodomys_ordii|3295                ---ATGCGCCCCCCGATGCCGCCCACCCTGCTCCTGGTGGCCGTCCTGGGCTTGCTCCTC
Cavia_porcellus|23059               ------------------------------------------------------------
Mus_musculus|5542                   ------ATGCACCGTCTA------------CCGCTGCTGCTCCTGCTGGGCTTGCTGCTC
Rattus_norvegicus|5589              ATGCGTCGTGTACCGCTGCTGCTCGTGCTGGGCTTGCTGTTCGTGCTGGGCTTGCTGTTC
Ochotona_princeps|14028             ------ATGCACTCTCAGATGCAGGCT---GCGCTCCTGATCGCCCTGGGCTTGCTTCTC
Microcebus_murinus|745              ------ATGCAGCCCCTGTTGCAGGCTCCTTCGCTGCTGCTGGCCCTAGGCTTGCTTCTC
Tarsius_syrichta|3464               ------------------------------------------------------------
                                                                                                

Tupaia_belangeri|5261               ---------------------------------------CCCTCCCAGGCCAGTAAATTT
Callithrix_jacchus|35681            GCG---------GCCCCTGCACAAGCCCACCCGAAAAAGCCCTTCCAGCTAGGTAAGTTT
Homo_sapiens|70641                  GCG---------GCCCCTGCGCAAGCCCACCTGAAAAAGCCATCCCAGCTCAGTAGCTTT
Gorilla_gorilla|22577               GCG---------GCCCCTGCGCAAGCCCACCTGAAAAAGCCATCCCAGCTCAGTAGCTTT
Pan_troglodytes|30432               GCG---------GCCCCTGCGCAAGCCCACCTGAAAAAGCCATCCCAGCTCAGTAGCTTT
Spermophilus_tridecemlineatus|12230 GCCGGCCCTTCGGCCTGGGCGCGCACAGTCCTAAACCGCCCCCCCCAGCTTGGTAGCTTT
Otolemur_garnettii|405              ---------------------------------------CCATCCCAGCTTGGTAGCTTC
Dipodomys_ordii|3295                GCCGGCCCCGCCACCCCGGCGCGCCTCGGCTCCAACCAGCTCTCCAAGCTAGGCAGCTTT
Cavia_porcellus|23059               ------------------------------------CAGCCTTCCCGGCTTGGCAGTTTT
Mus_musculus|5542                   GCAGGCTCCGTCGCCCCTGCGCGCCTCGTCCCGAAGCGCCTTTCCCAACTTGGTGGCTTC
Rattus_norvegicus|5589              GCTGGCCCTGTCGCCCCTTCGCGCCTCATCTCGAAGCGCCCTTCCCAACTTGGTGGCTTC
Ochotona_princeps|14028             ATCGACCCCGCTGTCTCCGTGCTCCATCACCAGAACCACATGACCCAGCCCAGCCGCTTT
Microcebus_murinus|745              GCCGGCCCTGCGGCCCCTGCGAGCGTCCACCTGAAGCAGCCACCCCAGCTTGGCAGCTTC
Tarsius_syrichta|3464               ---------------------------------------TCATCCCTGCTAAGCAACTTT
                                                                                *. .   .*  . ** 

Tupaia_belangeri|5261               AGCTGGGCTAACTGTGATGAAGCAAAGGATCCTGCTGTGATCAAATGCCTGTCACTGGAG
Callithrix_jacchus|35681            TCCTGGGACAACTGTGATGAAGGGAAGGACCCTGCAGTGATCAGAAGCCTGACTGTGGAT
Homo_sapiens|70641                  TCCTGGGATAACTGTGATGAAGGGAAGGACCCTGCGGTGATCAGAAGCCTGACTCTGGAG
Gorilla_gorilla|22577               TCCTGGGATAACTGTGATGAAGGGAAGGACCCTGCGGTGATCAGAAGCCTGACTCTGGAG
Pan_troglodytes|30432               TCCTGGGATAACTGTGATGAAGGGAAGGACCCTGCAGTGATCAGAAGCCTGACTCTGGAG
Spermophilus_tridecemlineatus|12230 TCCTGGGATAACTGTGATGAAGGGAAGGACCCTGCTGTGATCAGAAGCCTGATGTTGGAA
Otolemur_garnettii|405              TCCTGGGATAATTGTGATGAAGGAAAGGACCCTGCAGTGATCAAAAGCCTGACTCTGGAG
Dipodomys_ordii|3295                TCGTGGGACAATTGTGACGAAGGAAAGGACCCTGCAGTGATTCAGAGCCTCACGCTGGAA
Cavia_porcellus|23059               TCCTGGGATAACTGTGACGAAGGGAAGGACCCGGCGGTGCTTAAATCGCTGGCTGTGGAA
Mus_musculus|5542                   TCCTGGGATAACTGTGATGAAGGAAAGGACCCTGCAGTGATCAAAAGCCTCACGATCCAA
Rattus_norvegicus|5589              TCCTGGGATAACTGTGATGAAGGAAAGGACCCTGCAGTGATCAAAAGCCTCACGCTCCAA
Ochotona_princeps|14028             TCCTGGGATAACTGTGATGAAGGCAAGGACCCCGCGGTGATCAAAAGTCTGACGCTGGAG
Microcebus_murinus|745              TCCTGGGATAACTGTGACGAGGGGAAGGACCCTGCGGTGATCAAAAGCCTGACTCTGGAG
Tarsius_syrichta|3464               TCTTGGGATAACTGTGATGAGGAGAAGGACCCTGCGGTGATCAAAAGCCTGACTCTGGAA
                                    :  ****. ** ***** **.*  ***** ** ** ***.* ...:  **     *  * 

Tupaia_belangeri|5261               CCTGACCCCGTCGTTGTTCCTGGGAATGTGAACATCAGCATCACGGGCAGTACCAGCGTC
Callithrix_jacchus|35681            CCTGACCCCATCATCATTCCTGGGAATGTAACCCTCAGTGTCGTGGGCAGCACCAGTGTC
Homo_sapiens|70641                  CCTGACCCCATCATCGTTCCTGGAAATGTGACCCTCAGTGTCATGGGCAGCACCAGTGTC
Gorilla_gorilla|22577               CCTGACCCCATCATCGTTCCTGGGAATGTGACCCTTAGTGTCGTGGGCAGCACCAGTGTC
Pan_troglodytes|30432               CCTGACCCCATCATCGTTCCTGGGAATGTGACCCTCAGTGTCGTGGGCAGCACCAGTGTC
Spermophilus_tridecemlineatus|12230 CCTGACCCCATTGTCGTTCCTGGGAATGTGACTGTCAGTGTTGAGGGCAAGACCAGTGTT
Otolemur_garnettii|405              CCGGACCCCATCGTCATTCCTGGGAATGTGACCGTCAGTGTTGAGGGCAAGACCGATGTG
Dipodomys_ordii|3295                CCGGACCCCATCGTAGTTCCTGGAAACGTGACCGTGAGCGTCCAGGGGAAGACCCAGGTC
Cavia_porcellus|23059               CCCGACCCCATTGTCATCCCTGGGAATGTGACCATCAGCGCAGAGGGCAGGACCAGCGTG
Mus_musculus|5542                   CCTGACCCCATTGTGGTTCCTGGAGATGTAGTCGTCAGCCTTGAGGGCAAGACCAGCGTT
Rattus_norvegicus|5589              CCTGACCCCATTGTCGTTCCTGGAGATGTGATCGTCAGTGCTGAGGGCAAGACCAGCATT
Ochotona_princeps|14028             CCTGACCCCATCGTCATTCCTGGGAATGTGACCGTCAGTATTGAAGGCAGGACCAGCGTA
Microcebus_murinus|745              CCTGACCCCATAGTCGTGCCTGGGAACGTGACCATCAGTGCCAAGGGCCAGACCAGTGTC
Tarsius_syrichta|3464               CCTGACCCCATTGTCATTCCTGGGAACGTAACTGTCAGTGCTGAGGGCAAGACCAGCGTG
                                    ** ******.* .* .* *****..* **..   * **      .** .. *** . .* 

Tupaia_belangeri|5261               CGCCTCGAGTCTCCTCTGAAGGTGGATTTAGTTGTGGAGAAGGAGGTGGGGGGCATTTGG
Callithrix_jacchus|35681            TCCCTGAGTTCTCCTTTGAAGGTGGATTTACTTTTGGAGAAGGAAGTGGCCGGCCTCTGG
Homo_sapiens|70641                  CCCCTGAGTTCTCCTCTGAAGGTGGATTTAGTTTTGGAGAAGGAGGTGGCTGGCCTCTGG
Gorilla_gorilla|22577               CCCCTGAGTTCTCCTCTGAAGGTGGATTTAGTTTTGGAGAAGGAGGTGGCTGGCCTCTGG
Pan_troglodytes|30432               CCCCTGAGTTCTCCTCTGAAGGTGGATTTAGTTTTGGAGAAGGAGGTGGCTGGCCTCTGG
Spermophilus_tridecemlineatus|12230 CCCCTCACTTCGCCTCAGAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTGG
Otolemur_garnettii|405              CTCCTCTCTTCTCCTCAGAAGGTGGCATTAACTGTGGAGAAGGAAATGGCTGGCTTTTGG
Dipodomys_ordii|3295                CCCCTCAGCTCCCCTCAAAAGGTGGAATTGACCGTGGAGAAGGAAGTGGCGGGTTTCTGG
Cavia_porcellus|23059               TCCCTCAGCTCTCCTCTGAAGGTGGAAGTAACTCTGGAGCGTGAAGTGGCAGGGTTGTGG
Mus_musculus|5542                   CCCCTCACTGCTCCTCAGAAGGTGGAGCTCACCGTGGAGAAGGAAGTGGCTGGCTTCTGG
Rattus_norvegicus|5589              CCCCTCACTTCTCCTCAGAAGGTGGAGCTCACCGTGGAGAAGGAAGTGGCTGGCTTCTGG
Ochotona_princeps|14028             CCACTTAAGTCTCCTCAGAAGGTGACATTGACTGTGGAGAAGGAAGTGGCAGGCTTCTGG
Microcebus_murinus|745              GCCCTCAGTTCTCCTCTGAAGGTGGAATTAACTGTGGAAAAGGAAGTGGCTGGCTTCTGG
Tarsius_syrichta|3464               CCCCTCACAACTCCTCAGAAGGTGGAACTAACTGTGGAGAAGGAGGTGGCAGGCTTCTGG
                                      .**     * *** :.***...    .     ...     .   ...  ..  . ***

Tupaia_belangeri|5261               CTTAAGATCCCGTGTGTGGACCACGTGGGCAGCTGCACCTACGAAGACTTCTGTAATGTT
Callithrix_jacchus|35681            ATCAAGATTCCATGCACAGACCAGATTGGCAGCTGTACCTTCGAAGACTTCTGTGATGTG
Homo_sapiens|70641                  ATCAAGATCCCATGCACAGACTACATTGGCAGCTGTACCTTTGAACACTTCTGTGATGTG
Gorilla_gorilla|22577               ATCAAGATCCCATGCACAGACTACATTGGCAGCTGTACCTTTGAACACTTCTGTGATGTG
Pan_troglodytes|30432               ATCAAGATCCCATGCACAGACTACATTGGCAGCTGTACCTTTGAACACTTCTGTGATGTG
Spermophilus_tridecemlineatus|12230 GTCAAGATTCCATGTGTGGAGCAGCTTGGCAGCTGTACCTATGAAGACTTCTGTGATGTG
Otolemur_garnettii|405              GTCAAAATCCCATGCGTGGAAGAGATTGGCAGCTGTGTATAC---GACATCTGTGACATG
Dipodomys_ordii|3295                GTGAAGATTCCCTGTGTGGAGCAGCTGGGCAGCTGTACCTATGAGAATGTCTGCGAAATG
Cavia_porcellus|23059               ATCAAGATCCCATGTGTAGAACAGATCGGCAGCTGTGTCTATGAAGACTTCTGTAATGTG
Mus_musculus|5542                   GTCAAGATTCCTTGTGTAGAACAGCTAGGCAGCTGTAGCTACGAGAACATCTGTGACCTG
Rattus_norvegicus|5589              GTCAAGATCCCTTGCGTAGAACAGCTAGGAAGCTGTACCTATGAGAATGTCTGTGACCTG
Ochotona_princeps|14028             ATCAAGGTCCCCTGTGTGGAGCAGCTGGGCAGCTGTACCTATGATGACATCTGCAATATG
Microcebus_murinus|745              GTCAAAATCCCGTGCGTGGAACAGATTGGCAGCTGTACATATGACGACTTCTGTAATGTG
Tarsius_syrichta|3464               GTCAAGATCCCATGCGTGGAGCAGATTGGCAGCTGTACCTACAAAGACTTCTGTGACGTG
                                     * **..* ** ** . .**  *  * **.***** . .*:     *  **** .*  * 

Tupaia_belangeri|5261               CTGGACATAGCCATTCCTCCTGGACAGTCCTGCCCAGAGCCCCTACATACCTATGGGCTT
Callithrix_jacchus|35681            CTTGATATGTTATTTCCTACTGGGGAGCCCTGCCCAGAGCCCCTACATACCTATGGGCTT
Homo_sapiens|70641                  CTTGACATGTTAATTCCTACTGGGGAGCCCTGCCCAGAGCCCCTGCGTACCTATGGGCTT
Gorilla_gorilla|22577               CTTGACATGTTAATTCCTACTGGGGAGCCCTGCCCAGAGCCCCTGCGTACCTATGGGCTT
Pan_troglodytes|30432               CTTGACATGTTAATTCCTACTGGGGAGCCCTGCCCAGAGCCCCTGCGTACCTATGGGCTT
Spermophilus_tridecemlineatus|12230 CTTAACACCGTACTTCCCCCTGGGGAGCCCTGCCCAGAGCCCTTGCACACCTATGGACTT
Otolemur_garnettii|405              CTTAATAATATAATCTCCCCTGGTGTGCCCTGCTCAGAGCTCTTGCACACCTATGGGCTT
Dipodomys_ordii|3295                CTTGATAATTACATCCCCCCAGGACAAACCTGCCCAGAGCCCCTGTACACCTACGGCCTT
Cavia_porcellus|23059               CTGGACAATTTCGTTCCCCCTGGGGAGCCCTGCCCAGAGCCCCTGCATACCTTAGGACTT
Mus_musculus|5542                   ATAGACGAATACATTCCTCCTGGAGAGAGCTGCCCAGAGCCCCTGCACACCTACGGGCTG
Rattus_norvegicus|5589              ATAGACCAATACATCCCCCCTGGAGAGACCTGCCCAGAGCCGCTGCACACCTACGGGCTG
Ochotona_princeps|14028             CTGGATACACTCATTCCCCCTGGGCAGTTATGCCCAGAGCCCCTGCACACCTATGGGCTT
Microcebus_murinus|745              CTTGATACTTTTATTCCCCCTGGGAACCCCTGCCCAGAGCCCTTGCACACCTATGGGCTT
Tarsius_syrichta|3464               CTTGACACTCTCGTTCCCCCTGGGGAGCCCTGCCCAGAGCCCCTGCACACCTATGGGCTT
                                    .* .*        *  * .*:**  :   .*** ******   *. . ****: ** ** 

Tupaia_belangeri|5261               CCCTGTCACTGTCCTTTCAAAGAA------------------------------------
Callithrix_jacchus|35681            CCTTGCCACTGTCCTTTCAAAGAAGGAACCTACTCACTGCCCAAGAGCGGATTCATTGTG
Homo_sapiens|70641                  CCTTGCCACTGTCCCTTCAAAGAAGGAACCTACTCACTGCCCAAGAGCGAATTCGTTGTG
Gorilla_gorilla|22577               CCTTGCCACTGTCCCTTCAAAGAAGGAACCTACTCACTGCCCAAGAGCGAATTCGTTGTG
Pan_troglodytes|30432               CCTTGCCACTGTCCCTTCAAAGAAGGAACCTACTCACTGCCCAAGAGCGAATTCGTTGTG
Spermophilus_tridecemlineatus|12230 CCCTGTCACTGTCCCTTCAAGGAAGGCACCTACTTGCTGCCCAAGAGTGATTTCACAGTG
Otolemur_garnettii|405              CCCTGCCACTGTCCCTTCAAAGAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|3295                CCCTGCCACTGTCCCTTTAAAGAAGGTACCTACTCGCTGCCTTCCTCTGATTTCACGCTG
Cavia_porcellus|23059               CCCTGCCACTGTCCCTTCAAAGAAGGTACCTACTCCCTGCCCAGCAGTAATTTCACCCTG
Mus_musculus|5542                   CCCTGCCACTGTCCCTTCAAGGAAGGTACCTACTCACTACCCACGAGCAACTTCACAGTG
Rattus_norvegicus|5589              CCCTGCCATTGTCCCTTCAAGGAAGGCACCTACTCACTGCCTTCGAGCAACTTCACAGTG
Ochotona_princeps|14028             CCCTGCCACTGCCCCTTCAAAGAAGGCACCTACTCCCTGCCAGTGAGTGAGTTCACTGTG
Microcebus_murinus|745              CCCTGCCACTGTCCCTTCAAAGACGGCACCTACTCACTACCCAAGAGTGATTTCACCATG
Tarsius_syrichta|3464               CCCTGCCACTGCCCCTTCAAAGAA------------------------------------
                                    ** ** ** ** ** ** **.**.                                    

Tupaia_belangeri|5261               ------------------------------------------------------------
Callithrix_jacchus|35681            CCTTCCCTGGAGTTGCCCAGTTGGCTCACCACCGGGAACTACCGCATACAGGGCGTCCTG
Homo_sapiens|70641                  CCTGACCTGGAGCTGCCCAGTTGGCTCACCACCGGGAACTACCGCATAGAGAGCGTCCTG
Gorilla_gorilla|22577               CCTGACCTGGAGCTGCCCAGTTGGCTCACCACCGGGAACTACCGCATAGAGAGCGTCCTG
Pan_troglodytes|30432               CCTGACCTGGAGCTGCCCAGTTGGCTCACCACCGGGAACTACCGCATAGAGAGCGTCCTG
Spermophilus_tridecemlineatus|12230 CCTGACCTGGAGCTTCCAAGCTGGCTCAGCACCGGGAACTACCGCATCGAGAGCGTCCTG
Otolemur_garnettii|405              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|3295                CCCGACCTGGAGCTGCCCAGCTGGCTCAGTACGGGGAACTACCGGGTACAGAGCATCCTG
Cavia_porcellus|23059               CCTGACCTGGAGCTGCCCAGCTGGCTCAGCAGCGGGAACTACCGTGTCCAGGGCGTCGCA
Mus_musculus|5542                   CCTGACCTAGAGCTACCGAGCTGGCTGAGCACAGGCAACTACCGCATCCAGAGTATCTTG
Rattus_norvegicus|5589              CCTGATCTGGAGCTTCCAAGCTGGCTAAGCACGGGCAACTACCGCATCCAGAGCATCTTG
Ochotona_princeps|14028             CCCGACCTGGAGATGCCCAGCTGGCTCAGCAGTGGCAACTACCGCATCCAAGGCATCCTG
Microcebus_murinus|745              CCCGACCTGGAGCTGCCGGGCTGGCTCAGCACCGGGAACTACCGCATCCAGAGCATCCTG
Tarsius_syrichta|3464               ------------------------------------------------------------
                                                                                                

Tupaia_belangeri|5261               ------------------------------------------------------------
Callithrix_jacchus|35681            AGCAGCCGTGAGAAGCGTCTGGGCTGCATCAAGATCGCTGCCTCTCTAAAGGGCATGTAA
Homo_sapiens|70641                  AGCAGCAGTGGGAAGCGTCTGGGCTGCATCAAGATCGCTGCCTCTCTAAAGGGCATATAA
Gorilla_gorilla|22577               AGCAGCGGTGGGAAGCGTCTGGGCTGCATCAAGATCGCTGCCTCTCTAAAGGGCATATAA
Pan_troglodytes|30432               AGCAGCGGTGGGAAGCGTCTGGGCTGCATCAAGATCGCTGCCTCTCTAAAGGGCATATAA
Spermophilus_tridecemlineatus|12230 AGCAGTGGCGGGAAGCGTCTGGGCTGTGTCAAGATCTCTGCATCTCTAAAGGGCAAATAA
Otolemur_garnettii|405              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCTGCCTCTCTACAGAGCAAATAA
Dipodomys_ordii|3295                AGCAGCGGAGGGGAGCGTCTGGCCTGCATCAAGATCGCCGTGTCCCTAAGGGGCAAATAA
Cavia_porcellus|23059               AGCAGCACCGAGAAGCGGCTGGCCTGTGTCAAGATCTCTGCCTCTCTGAAGGGCAAATAA
Mus_musculus|5542                   AGCAGTGGTGGGAAGCGCCTGGGCTGCATCAAGATTGCTGCCTCTCTCAAGGGCAGATAA
Rattus_norvegicus|5589              AGCAGCGGTGGAAAGCGCCTGGCCTGCATCAAGATTGCCGCCTCTCTCAAGGGCAAATAA
Ochotona_princeps|14028             AGCAGCGGTGGGGAGCATCTGGCCTGCGTCAAGGTCTCTGCCTCCGTTAAGGGCAAATAG
Microcebus_murinus|745              AGCAGCAGCGGGGCACGTCTGGCCTGCGTCAAGATCTCTGCCTCTCTCAAGGGCAAATAG
Tarsius_syrichta|3464               ------------------------------------------------------------
                                                                                                

multiple sequence alignment in CLUSTALW format


Tupaia_belangeri|4550               ---------------------------------PSQASKFSWANCDEAKDPAVIKCLSLE
Callithrix_jacchus|27405            --MQFLMQA-PLLIALGLFLA---APAQAHPKKPFQLGKFSWDNCDEGKDPAVIRSLTVD
Homo_sapiens|17981                  --MQSLMQA-PLLIALGLLLA---APAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLE
Gorilla_gorilla|17736               --MQSLMQS-PLLIALGLLLA---APAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLE
Pan_troglodytes|23641               --MQSLMQA-PLLIALGLLLA---APAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLE
Spermophilus_tridecemlineatus|10966 --MHPLMRT-LLLIFLGLLLAGPSAWARTVLNRPPQLGSFSWDNCDEGKDPAVIRSLMLE
Otolemur_garnettii|347              ---------------------------------PSQLGSFSWDNCDEGKDPAVIKSLTLE
Dipodomys_ordii|3085                -MRPPMPPTLLLVAVLGLLLAGPATPARLGSNQLSKLGSFSWDNCDEGKDPAVIQSLTLE
Cavia_porcellus|18232               --------------------------------QPSRLGSFSWDNCDEGKDPAVLKSLAVE
Mus_musculus|11578                  --MHRL----PLLLLLGLLLAGSVAPARLVPKRLSQLGGFSWDNCDEGKDPAVIKSLTIQ
Rattus_norvegicus|15296             MRRVPLLLVLGLLFVLGLLFAGPVAPSRLISKRPSQLGGFSWDNCDEGKDPAVIKSLTLQ
Ochotona_princeps|12237             --MHSQMQA-ALLIALGLLLIDPAVSVLHHQNHMTQPSRFSWDNCDEGKDPAVIKSLTLE
Microcebus_murinus|619              --MQPLLQAPSLLLALGLLLAGPAAPASVHLKQPPQLGSFSWDNCDEGKDPAVIKSLTLE
Tarsius_syrichta|3180               ---------------------------------SSLLSNFSWDNCDEEKDPAVIKSLTLE
                                                                         . *** **** *****::.* ::

Tupaia_belangeri|4550               PDPVVVPGNVNISITGSTSVRLESPLKVDLVVEKEVGGIWLKIPCVDHVGSCTYEDFCNV
Callithrix_jacchus|27405            PDPIIIPGNVTLSVVGSTSVSLSSPLKVDLLLEKEVAGLWIKIPCTDQIGSCTFEDFCDV
Homo_sapiens|17981                  PDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDV
Gorilla_gorilla|17736               PDPIIVPGNVTLSVVGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDV
Pan_troglodytes|23641               PDPIIVPGNVTLSVVGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDV
Spermophilus_tridecemlineatus|10966 PDPIVVPGNVTVSVEGKTSVPLTSPQKXXXXXXXXXXXXWVKIPCVEQLGSCTYEDFCDV
Otolemur_garnettii|347              PDPIVIPGNVTVSVEGKTDVLLSSPQKVALTVEKEMAGFWVKIPCVEEIGSCVY-DICDM
Dipodomys_ordii|3085                PDPIVVPGNVTVSVQGKTQVPLSSPQKVELTVEKEVAGFWVKIPCVEQLGSCTYENVCEM
Cavia_porcellus|18232               PDPIVIPGNVTISAEGRTSVSLSSPLKVEVTLEREVAGLWIKIPCVEQIGSCVYEDFCNV
Mus_musculus|11578                  PDPIVVPGDVVVSLEGKTSVPLTAPQKVELTVEKEVAGFWVKIPCVEQLGSCSYENICDL
Rattus_norvegicus|15296             PDPIVVPGDVIVSAEGKTSIPLTSPQKVELTVEKEVAGFWVKIPCVEQLGSCTYENVCDL
Ochotona_princeps|12237             PDPIVIPGNVTVSIEGRTSVPLKSPQKVTLTVEKEVAGFWIKVPCVEQLGSCTYDDICNM
Microcebus_murinus|619              PDPIVVPGNVTISAKGQTSVALSSPLKVELTVEKEVAGFWVKIPCVEQIGSCTYDDFCNV
Tarsius_syrichta|3180               PDPIVIPGNVTVSAEGKTSVPLTTPQKVELTVEKEVAGFWVKIPCVEQIGSCTYKDFCDV
                                    ***:::**:* :*  * *.: * :* *            *:*:**.: :*** : ..*::

Tupaia_belangeri|4550               LDIAIPPGQSCPEPLHTYGLPCHCPFKE--------------------------------
Callithrix_jacchus|27405            LDMLFPTGEPCPEPLHTYGLPCHCPFKEGTYSLPKSGFIVPSLELPSWLTTGNYRIQGVL
Homo_sapiens|17981                  LDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVL
Gorilla_gorilla|17736               LDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVL
Pan_troglodytes|23641               LDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVL
Spermophilus_tridecemlineatus|10966 LNTVLPPGEPCPEPLHTYGLPCHCPFKEGTYLLPKSDFTVPDLELPSWLSTGNYRIESVL
Otolemur_garnettii|347              LNNIISPGVPCSELLHTYGLPCHCPFKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Dipodomys_ordii|3085                LDNYIPPGQTCPEPLYTYGLPCHCPFKEGTYSLPSSDFTLPDLELPSWLSTGNYRVQSIL
Cavia_porcellus|18232               LDNFVPPGEPCPEPLHTLGLPCHCPFKEGTYSLPSSNFTLPDLELPSWLSSGNYRVQGVA
Mus_musculus|11578                  IDEYIPPGESCPEPLHTYGLPCHCPFKEGTYSLPTSNFTVPDLELPSWLSTGNYRIQSIL
Rattus_norvegicus|15296             IDQYIPPGETCPEPLHTYGLPCHCPFKEGTYSLPSSNFTVPDLELPSWLSTGNYRIQSIL
Ochotona_princeps|12237             LDTLIPPGQLCPEPLHTYGLPCHCPFKEGTYSLPVSEFTVPDLEMPSWLSSGNYRIQGIL
Microcebus_murinus|619              LDTFIPPGNPCPEPLHTYGLPCHCPFKDGTYSLPKSDFTMPDLELPGWLSTGNYRIQSIL
Tarsius_syrichta|3180               LDTLVPPGEPCPEPLHTYGLPCHCPFKE--------------------------------
                                    ::  ...*  *.* * * *********:                                

Tupaia_belangeri|4550               -------------------
Callithrix_jacchus|27405            SSREKRLGCIKIAASLKGM
Homo_sapiens|17981                  SSSGKRLGCIKIAASLKGI
Gorilla_gorilla|17736               SSGGKRLGCIKIAASLKGI
Pan_troglodytes|23641               SSGGKRLGCIKIAASLKGI
Spermophilus_tridecemlineatus|10966 SSGGKRLGCVKISASLKGK
Otolemur_garnettii|347              XXXXXXXXXXXXAASLQSK
Dipodomys_ordii|3085                SSGGERLACIKIAVSLRGK
Cavia_porcellus|18232               SSTEKRLACVKISASLKGK
Mus_musculus|11578                  SSGGKRLGCIKIAASLKGR
Rattus_norvegicus|15296             SSGGKRLACIKIAASLKGK
Ochotona_princeps|12237             SSGGEHLACVKVSASVKGK
Microcebus_murinus|619              SSSGARLACVKISASLKGK
Tarsius_syrichta|3180               -------------------