Orthologs Set ID: EOG4003J5


Orthology Database
OrthoDB4
Gene Symbol(s)
RNASE2,RP11-84C10.2

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 29723
Gorilla gorilla 3015
Homo sapiens 25496
Homo sapiens 25497
Microcebus murinus 3544 495
Mus musculus 12397
Mus musculus 12402
Mus musculus 12545
Mus musculus 12547
Mus musculus 12548
Mus musculus 12560
Otolemur garnettii 13870
Pan troglodytes 11139
Rattus norvegicus 12629
Rattus norvegicus 12631
Rattus norvegicus 12632
Rattus norvegicus 12633
Rattus norvegicus 12634
Tarsius syrichta 5553

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 29723 ENSCJAT00000018667 100391488 ENSCJAG00000009638 RNASE3 calJac3
Gorilla gorilla 3015 ENSGGOT00000005117 101147304 ENSGGOG00000022071 gorGor3
Homo sapiens 25496 ENST00000258817 643332 ENSG00000136315 RP11-84C10.2 hg19,GRCh37
Homo sapiens 25497 ENST00000304625, NM_002934 6036 ENSG00000169385 RNASE2 hg19,GRCh37
Microcebus murinus 3544 ENSMICT00000003300 ENSMICG00000003306 micMur1
Mus musculus 12397 ENSMUST00000100691 13586 ENSMUSG00000072601 Ear1 mm9
Mus musculus 12402 ENSMUST00000074839 13587 ENSMUSG00000072596 Ear2 mm9
Mus musculus 12545 ENSMUST00000075648, NM_019398 54159 ENSMUSG00000059606 Rnase2b mm9
Mus musculus 12547 ENSMUST00000049559 503847 ENSMUSG00000050766 Ear14 mm9
Mus musculus 12548 ENSMUST00000061936 93726 ENSMUSG00000047222 Rnase2a mm9
Mus musculus 12560 ENSMUST00000074477 93719 ENSMUSG00000062148 Ear6 mm9
Otolemur garnettii 13870 ENSOGAT00000013322 100950392 ENSOGAG00000013322 LOC100950392 otoGar1
Pan troglodytes 11139 ENSPTRT00000059611, NM_002934 473325 ENSPTRG00000006106 RNASE2 panTro2
Rattus norvegicus 12629 ENSRNOT00000050820, NM_001007015 474169 ENSRNOG00000032133 Rnase2 rn4
Rattus norvegicus 12631 ENSRNOT00000060596 100361814 ENSRNOG00000039531 LOC100361814 rn4
Rattus norvegicus 12632 ENSRNOT00000048941, NM_001012232 497195 ENSRNOG00000050295 Rnase17 rn4
Rattus norvegicus 12633 ENSRNOT00000040857, NM_138902 192264 ENSRNOG00000031445 Ear11 rn4
Rattus norvegicus 12634 ENSRNOT00000021645 100361909 ENSRNOG00000025515 Ear1 rn4
Tarsius syrichta 5553 ENSTSYT00000001661 103258822 ENSTSYG00000001686 tarSyr1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 21705 ENSCJAP00000017651 100391488 ENSCJAG00000009638 RNASE3 calJac3
Gorilla gorilla 2854 ENSGGOP00000004990 101147304 ENSGGOG00000022071 gorGor3
Homo sapiens 21198 ENSP00000384761 643332 ENSG00000136315 RP11-84C10.2 hg19,GRCh37
Homo sapiens 21201 ENSP00000303276 6036 ENSG00000169385 RNASE2 hg19,GRCh37
Microcebus murinus 3002 ENSMICP00000002997 ENSMICG00000003306 micMur1
Mus musculus 10856 ENSMUSP00000074075 93719 ENSMUSG00000062148 Ear6 mm9
Mus musculus 10861 ENSMUSP00000056418 93726 ENSMUSG00000047222 Rnase2a mm9
Mus musculus 18373 ENSMUSP00000075074 54159 ENSMUSG00000059606 Rnase2b mm9
Mus musculus 34127 ENSMUSP00000056293 503847 ENSMUSG00000050766 Ear14 mm9
Mus musculus 39459 ENSMUSP00000074386 13587 ENSMUSG00000072596 Ear2 mm9
Mus musculus 31496 ENSMUSP00000098256 13586 ENSMUSG00000072601 Ear1 mm9
Otolemur garnettii 11938 ENSOGAP00000011936 100950392 ENSOGAG00000013322 LOC100950392 otoGar1
Pan troglodytes 1807 ENSPTRP00000052810 473325 ENSPTRG00000006106 RNASE2 panTro2
Rattus norvegicus 7016 ENSRNOP00000039262 474169 ENSRNOG00000032133 Rnase2 rn4
Rattus norvegicus 7018 ENSRNOP00000044390 192264 ENSRNOG00000031445 Ear11 rn4
Rattus norvegicus 31847 ENSRNOP00000057332 100361814 ENSRNOG00000039531 LOC100361814 rn4
Rattus norvegicus 31848 ENSRNOP00000050225 497195 ENSRNOG00000050295 Rnase17 rn4
Rattus norvegicus 31849 ENSRNOP00000021645 100361909 ENSRNOG00000025515 Ear1 rn4
Tarsius syrichta 5086 ENSTSYP00000001545 103258822 ENSTSYG00000001686 tarSyr1

multiple sequence alignment in CLUSTALW format


Mus_musculus|12547       ---------------GTGGGTATGAAGCTGCCTGAGTCCAGTCTTTGTCTCCTGCTGCTG
Mus_musculus|12560       ---------------ATGGGTCCGAAGCTGCTTGAGTCCCAACTTTGTCTCCTGCTGATG
Mus_musculus|12397       ---------------ATGGGTCCGAAGCTGCTTGAGTCCCGACTTTGTCTCCTGCTGCTG
Mus_musculus|12402       ---------------ATGGGTCCGAAGCTGCTTGAGTCTCGACTTTGTCTCCTGCTGCTG
Mus_musculus|12545       ---------------ATGGGTCTGAAGCTGCTTGAATCCAGACTTTGTCTCCTGCTGCTG
Mus_musculus|12548       ---------------ATGGGTCTGGAGCAACTTGAGTCTCGACTTTGTCTCCTGCTGCTG
Rattus_norvegicus|12631  ---------------ATGGGTCTGAAGCTGCTGGAGTCCAGACTTTGTCTCCTTCTGCCG
Rattus_norvegicus|12632  ---------------ATGGGTCTGAAGCTGCTCGAGTCCAGACTTTGTCTCCTTCTGCTG
Rattus_norvegicus|12633  ---------------ATGGGTCTGAAGCTGCTCGAGTCCAGACTTTGTCTCCTTCTGTCG
Rattus_norvegicus|12629  ---------------ATGGGTGTGAAGCCGCTTGAGTCCAGACTTTGTCTCCTTCTGCTG
Rattus_norvegicus|12634  ---------------ATGGGTCTGAAGCTGCTCGAGTCCAGACTTTGTCTCCTTCTGCTT
Tarsius_syrichta|5553    ---------------ATGGTTCCAAAACTGCTCGATTCTCGACTTTGTCTGCTTCTGCTT
Otolemur_garnettii|13870 ---------------ATGGTTCCAAAGCTGCTCAATTCCCGATTCTGTCTGCTTCTGCCG
Microcebus_murinus|3544  ---------------ATGGTTCCAAAGCTGCTCGATTCCCGACATTGTCTGCTTCTGCTG
Homo_sapiens|25496       TGGTTCCAAAACTGTTCACTTCCCAAA---TTTGTCTGCTTCTTCTGTTGGGGCTTCTGG
Callithrix_jacchus|29723 ---------------ATGGTTCCAAAACTGTTCACCTCTCAAATTTGTCTGCTTCTTCTG
Gorilla_gorilla|3015     ---------------ATGGTTCCAAAACTGTTCACTTCCCAAATTTGTCTGCTTCTTCTG
Pan_troglodytes|11139    ---------------ATGGTTCCAAAACTGTTCACTTCCCAAATTTGTCTGCTTCTTCTG
Homo_sapiens|25497       ---------------ATGGTTCCAAAACTGTTCACTTCCCAAATTTGTCTGCTTCTTCTG
                                          .  *   .*.      .  *      : ***       *    

Mus_musculus|12547       TTGGGACTTGTCCTAATGCTTGCCTCATGCCAGGCACAAATCCTT------------TCC
Mus_musculus|12560       CTGGGACTTGTCCTAATGCTTGCCTCATGCCAGAAACCAACCGCA------------TCC
Mus_musculus|12397       CTAGGACTTGTCCTAATGCTTGCCTCATGCCTGGGTCAAACCCCT------------TCC
Mus_musculus|12402       CTAGGACTTGTCCTAATGCTTGCCTCATGCCTGGGACAAACCCCT------------TCC
Mus_musculus|12545       CTGGGACTTGTCCTAACGCTTGTCTCATGCCAGCGACCAACCCCT------------TCC
Mus_musculus|12548       CTGGGACATGTCCTAATGCTTGCCTCATGCCAGCCATTGACCCCC------------TCC
Rattus_norvegicus|12631  CTGGGACTTGTCCTGATGCTTGCCTCATGCCAGCGACCAACCCCT------------TCC
Rattus_norvegicus|12632  CTGGGACTTGTCCTGATGCTTGCCTCATGCCAGCCACCAACCCCT------------TCC
Rattus_norvegicus|12633  CTGGGACTTGTCTTGATGCTTGCCTCATGCCAGCCACCAACCCCT------------TCC
Rattus_norvegicus|12629  CTGGGACTTGTCTCAATGCTTGCCTCATGCCAGCGACCAACCCCT------------TCC
Rattus_norvegicus|12634  CTGGGACTTGTC------------ACATGCCAGCGACCAACCCCT------------TCC
Tarsius_syrichta|5553    CTGGGACTCATGGGAATGGAGGGCTCATTCCATGTCAAACCCAGCCAGTTTACCTGGGCT
Otolemur_garnettii|13870 CTGGTGCTCATGGCGATGGTGGGCTCCTTCCATGCCAAACCTCCTCAGTTTACCTGGGCT
Microcebus_murinus|3544  CTGGGGCTCATGGGAATGGTGGGCTACTGCCACGCCCCACCTCCTGGTTTAACCCGGGCT
Homo_sapiens|25496       CTGTGGAGGGCTCACTCCATGTCAAACCTCCACAGTTTACCT------------------
Callithrix_jacchus|29723 TTGGGGCTTTTGAGTGCAGAGGGCTCACCCCATGCCAGACCCCAGCAGTATTCCAGGGCT
Gorilla_gorilla|3015     TTGGGGCTTCTGGCAGTGGAGGGCTCACTCCATGTCAAACCTCCACAGTTTACCTGGGCT
Pan_troglodytes|11139    TTGGGGCTTCTGGCTGTGGAGGGCTCACTCCATGTCAAACCTCCACAGTTTACCTGGGCT
Homo_sapiens|25497       TTGGGGCTTCTGGCTGTGGAGGGCTCACTCCATGTCAAACCTCCACAGTTTACCTGGGCT
                          *.  ..                 :..  **:      ..                    

Mus_musculus|12547       CAGAAGTTTTACACCGAGTATATCTATAATAGCACCTACCCCCGATGTGATGCTGTAATG
Mus_musculus|12560       CAGTGGTTTGCTACCCAGCATATCACTTATAAAGCCAACCTCCAATGTAATGTTGAAATG
Mus_musculus|12397       CAGAAGTTTGCCATCCAGCATATCAATAATAATACCAACCTCCAATGTAATGTTGAAATG
Mus_musculus|12402       CAGTGGTTTGCCATCCAGCATATCAATAATAATGCCAACCTCCAATGTAATGTTGAAATG
Mus_musculus|12545       CAGAAGTTTGACATCCAGCATATCTATAAGAAATCCTCTCCCAAATGTGATGATGCAATG
Mus_musculus|12548       CGGTGGTTTGACATCCAGCATATCTATAACAGAGCCTATCCCCGATGTGATGATGCAATG
Rattus_norvegicus|12631  CAGAGGTTTGCCATCCAGCACATCTATAATAGCGCCTACCCCCAATGTAATGCTGCTATG
Rattus_norvegicus|12632  CAGTGGTTTGAAATCCAGCACATCTATAATAGGGCTTATCCACGATGTAATGATGCAATG
Rattus_norvegicus|12633  CAGTGGTTTGAAATCCAGCACATCTATAATAGGGCTTATCCCCGATGTAATGATGCAATG
Rattus_norvegicus|12629  CAGTGGTTTGCCATCCAGCACATCTATAATAGCTCCTACCCCCAATGTAATGCTGCCATG
Rattus_norvegicus|12634  CAGTGGTTTGCCATCCAGCACATCTATAATAGCTCCTACCCCCAATGTAATGCTGCCATG
Tarsius_syrichta|5553    CAGTGGTTTACCATCCAGCATATA---AATATGACCCACACCCGATGCGACGACGCAATG
Otolemur_garnettii|13870 CAGTGGTTTGAGATCCAGCACATA---AATATGACCAACCCCCAATGCACTATTGCAATG
Microcebus_murinus|3544  CAGTGGTTTGAAATCCAGCACATA---AATATGACCCACCCCCAATGCAATAATGCAATG
Homo_sapiens|25496       GGGCTCAGGGGTTTGACGTCCATC---AGTAGGAACCAGCTCCAATGCACCAATGCAATG
Callithrix_jacchus|29723 CAGTGGTTTAGCATCCAGCACATC---CAAACGGCTCCCCTCCACTGCACCTCTGCAATG
Gorilla_gorilla|3015     CAATGGTTTGAAACCCAGCACATC---AATATGACCTCCCAGCAATGCACCAATGCAATG
Pan_troglodytes|11139    CAATGGTTTGAAACCCAGCACATC---AATATGACATCCCAGCAATGCACCAATGCAATG
Homo_sapiens|25497       CAATGGTTTGAAACCCAGCACATC---AATATGACCTCCCAGCAATGCACCAATGCAATG
                          ..   :     :   .* . **.    . *   .  . .  ...** ..    *  ***

Mus_musculus|12547       AGGGTTGTTAACAGGTATAGACCAAGATGTAAGGACATAAATACTTTTCTTCACACAAGT
Mus_musculus|12560       CAGGCTATTAACATGCATAGACCAAGATGTAAGGGCTTAAATACTTTTCTTCATACAAGT
Mus_musculus|12397       ATGCGTATTAACAGGGCTAGAAGAACATGTAAGGGCTTAAATACTTTTCTTCATACAAGT
Mus_musculus|12402       CAGCGTATTAACAGGTTTAGAAGAACATGTAAGGGCTTAAATACTTTTCTTCATACAAGT
Mus_musculus|12545       CGGGTCGTTAACAAGTATACAGGAAAATGTAAGGACTTGAATACTTTTCTTCATACAACT
Mus_musculus|12548       CGGGCCGTTAACAGTTACACAGGAGTGTGTAAAGACATAAATACTTTTCTTCATACAACT
Rattus_norvegicus|12631  CAGCGTGTTAACAATTATACAGGAAGATGTAAGGACATAAATACCTTTCTTCATACAAGT
Rattus_norvegicus|12632  CGACACAGAAACAGATTCACCAGACATTGTAAGGACAAAAATACTTTCCTTCATACAAGT
Rattus_norvegicus|12633  CGACACAGAAACAGATTCACAGGACATTGTAAGGACATAAATACTTTTCTTCATACAAGT
Rattus_norvegicus|12629  CTGCGTGTCAACAGTTATACAGGAAGATGTAAGGGCATAAATACTTTTCTTCACACAAGT
Rattus_norvegicus|12634  CTGCGTGTCAACAGTTATACAGGAAGATGTAAGGGCATAAATACTTTCCTTCATGCAAGT
Tarsius_syrichta|5553    CGAGTAGTTAACGGTTATTTAAGGCGATGCAAAAATCGCAATACGTTTCTTAGAACAACT
Otolemur_garnettii|13870 CGGGTAATTAACCGTTACTATCCACAATGTAAAAGGAGGAATACTTTTCTTCATACAACC
Microcebus_murinus|3544  CGGGTAGTTAACAGTTACACAGGACGATGCAAAGGCCAGAATACTTTTCTTCATACAACT
Homo_sapiens|25496       CGGGTAATTAACAATTATCAACGGCGATGGAAAAACCAAAATACTTTTCTTCTTGCAACT
Callithrix_jacchus|29723 CGGGCAATTAACAAGTATCAATCTCGATGCAAAAACAAAAATACTTTTCTTCATACAACT
Gorilla_gorilla|3015     CGGGTCATTAACAATTATCAACGGCGATGCAAAAACCAAAATACTTTCCTTCTTACAACT
Pan_troglodytes|11139    CAGGTCATTAACAATTATCAACGGCGATGCAAAAACCAAAATACTTTCCTTCTTACAACT
Homo_sapiens|25497       CAGGTCATTAACAATTATCAACGGCGATGCAAAAACCAAAATACTTTCCTTCTTACAACT
                         . .   .  ***               ** **...    ***** ** ***.  .***  

Mus_musculus|12547       TTTGCTGATGTTGTTGCTGTGTGTGGCCATCCAAATATCACCTGCAAC---AACTTGACA
Mus_musculus|12560       TTTATTAATGTTGTTGGTGTGTGTAGCAATCCAAGTGGCTTGTGCAGC---GACAAAATA
Mus_musculus|12397       TTTGCTAATGCTGTTGGTGTGTGTGGAAATCCAAGTGGCTTGTGCAGT---GACAAGAGA
Mus_musculus|12402       TTTGCTAATGCTGTTGGTGTGTGTGGAAATCCAAGTGGCTTGTGCAGT---GACAATATA
Mus_musculus|12545       TTTGCTGATGTTGTCCGTGTGTGTCACAATCCACCCAAGACTTGCAAA---GACGGGACA
Mus_musculus|12548       TTTGCTAATGTTGTCCGTGTGTGTCATAATCCACGTAAGATCTGCAAA---AATGGGATA
Rattus_norvegicus|12631  TTTGCTAGTGTTGTTGGTGTGTGTGGCAATAGAAACACCACCTGTAATAGTAACAGGACA
Rattus_norvegicus|12632  TTTGCTAGTGTTGTTGGTGTGTGTGGCAATAGAAACATCCCCTGTAGA---AACAGGAGA
Rattus_norvegicus|12633  TTTGCTAGTGTTGTTGGTGTGTGTGGCAATAGAAACATCCCCTGTGGA---AACAGGACA
Rattus_norvegicus|12629  TTTGCTAGTGTTGTTGATGTGTGTGGCAATCCACATATAACCTGTAAA---GACGGGAGA
Rattus_norvegicus|12634  TTTGCTAATGTTGTTGGTGTGTGTGGCAATCCACATACAACCTGTAAA---GACAGAATC
Tarsius_syrichta|5553    TTTGACGATACAGCTGGTGTCTGTGGTACCCCAAATATAACCTGTCCTAGTAACAATACT
Otolemur_garnettii|13870 TTTGCTGCTGTAGCTGGTGTTTGTGGTACCCCAAATACACCCTGCGTTTCAAACAGCAGT
Microcebus_murinus|3544  TTCGCTAATGTAGTTAATGTTTGTGGCAACCCAAATATACGCTGTCTT---ACAAGCCAA
Homo_sapiens|25496       TTTGCTAATGTAGTTAATGTTTGTGGTAACCCAACTATAACCTGCCCTCATAACAGAACT
Callithrix_jacchus|29723 TTTGCTGATGTAGTTAATGTTTGCGGTAACACAAATATGACCTGCCCTCATAATGCATCT
Gorilla_gorilla|3015     TTTGCTAACGTAGTTAATGTTTGTGGTAACCCAAATATGACCTGTCCTAGTAACAAAACT
Pan_troglodytes|11139    TTTGCTAACGTAGTTAATGTTTGTGGTAACCCAAATATGACCTGTCCTAGTAACAAAACT
Homo_sapiens|25497       TTTGCTAACGTAGTTAATGTTTGTGGTAACCCAAATATGACCTGTCCTAGTAACAAAACT
                         ** .  .  . :*    *** **  . .. . *.  .     **       ..       

Mus_musculus|12547       AGAAAAAATTGTCATGCTAGTTCATTTCAGGTATTTATAACTTTTTGTAACCTCACTACG
Mus_musculus|12560       AGTCAAAACTGTCATAATAGTTCGTCTCGGGTACCTATAACTGTCTGTAACCTCACAACT
Mus_musculus|12397       AGTCAAAACTGTCATAATAGTTCATCTCGGGTACATATAACTGTCTGTAACATCACCAGT
Mus_musculus|12402       AGTAGAAACTGTCATAATAGTTCATCTCGGGTACGTATAACTGTCTGTAACATCACCAGT
Mus_musculus|12545       AGTCCAAATTGTCATGATAGTTCATCTAAGGTATCTGTAACTATCTGTAAACTCACAAAA
Mus_musculus|12548       AGTAGAAATTGTCATGATAGTTCAAATCGGGTACAAGTAACTATCTGTATACTCACAACT
Rattus_norvegicus|12631  AGAACAAATTGTCATGACAGTACATATCAGGTAAAAGTAACTATCTGCAACCTCACAAAT
Rattus_norvegicus|12632  TATAGAAATTGTCATAACAGTCCATATCGGGTATCTATAACTTTCTGTAACCTCACAACT
Rattus_norvegicus|12633  TATAGAAATTGTCATAACAGTCGATATCGGGTATCTATAACTTTCTGTAACCTCACAACT
Rattus_norvegicus|12629  AGTACAAATTGTCATAACAGTTCCTCTCAGGTATCTGTAACTTTCTGTAACCTCACAACT
Rattus_norvegicus|12634  AGTACGAATTGTCATAACAGTTCATCTCAGGTATCTATAACTTTCTGTAACCTCACAACT
Tarsius_syrichta|5553    ATGAAAAATTGTCATCAAAGCCCAGATCAGGTGAATATAGTTGACTGTAACCTCACAAAA
Otolemur_garnettii|13870 AGAACAAATTGTCATAACAGTTCAGTCCCGGTGGCTATAACCTATTGTAACCTCACAAGT
Microcebus_murinus|3544  AATACAAATTGTCATAATAGTTCAGTCCAGGTGTCTTTAACCTATTGTAACCTCACAAGT
Homo_sapiens|25496       CTCAACAATTGTCATCATAGTGGAGTCCAGGTGCCTTTAATGTACTGTAACCTCACAACT
Callithrix_jacchus|29723 CTCAACAATTGTCATCACAGTGGAGTCCAGGTGCCTTTAACCTACTGTAACCTCACAGGT
Gorilla_gorilla|3015     CGCAAAAATTGTCATCACAGTGGAAGCCAGGTGCCTTTAATCCACTGTAACCTCACAACT
Pan_troglodytes|11139    CGCAAAAATTGTCATCAAAGTGGAAGCCAGGTGCCTTTAATCCACTGTAACCTCACAACT
Homo_sapiens|25497       CGCAAAAATTGTCACCACAGTGGAAGCCAGGTGCCTTTAATCCACTGTAACCTCACAACT
                            .  ** *****  . **       . ***.  : **.   : ** *:..**** .  

Mus_musculus|12547       CCG---ACAAGAATATGCACACAATGCAGATACCAAACGACAGGTTCAGTGAAGTACTAC
Mus_musculus|12560       CCG---AGAAGAAATTATACCCAATGCAGATACCAAACAAAGGGATCAGTGGAGTACTAC
Mus_musculus|12397       CGG---GCAACAAATTATACCCAATGCAGATACCAATCAAGAAGATCATTGGAGTACTAC
Mus_musculus|12402       CGGAGGAGAACACCTTATACCCAATGCAGATACCAACCAAGAAGATCATTGGAGTACTAC
Mus_musculus|12545       CGG---GCAAGGAATTATACCCACTGCAGATACAAAACAACAGGAGCAAAGAAGTCCTAC
Mus_musculus|12548       CCG---GCCAGTCATTATTCCAACTGCAGATACCGAACAACAAGATCAATGAAGTACTAC
Rattus_norvegicus|12631  CGG---GCAGCCGTTTATCCTCAATGCCCATACCAAACTATAAATTCATCGAAGTTCTAC
Rattus_norvegicus|12632  CCG---GCAAGGATTTATACCCAATGTAGATACCAAACTACAAGATCCAGGAAGTTCTAC
Rattus_norvegicus|12633  CCG---GCAAGGATTTATACCCAATGTAGATACCAAACTACAAGATCCAGGAAGTTCTAC
Rattus_norvegicus|12629  CCG---GCAAGGATTTATACCCAATGCAGATACCAAACTACAGGATCGGTGAAGTTCTAC
Rattus_norvegicus|12634  CCG---GCAAGGATTTATACCCAATGCAGATACCAAACTACAGGATCGTTGAAGTTCTAC
Tarsius_syrichta|5553    AGT---TCCAAAAATATTACAAACTGCCTATATGCACAGTCATCAGCACAGAAGTACTAC
Otolemur_garnettii|13870 CGA---CCAACTCCTGTTGCAAACTGCAGATATACAAACACAGCGGCACAGAGTCTCTAT
Microcebus_murinus|3544  CCA---CCGACTCCTGTTGCAAACTGCCGATATGCACAGACACCAGCACGGATGTTCTAC
Homo_sapiens|25496       CCAAGTCCACAGAATATTTCAAACTGCAGGTATGCGCAGACACCAGCAAACATGTTCTAT
Callithrix_jacchus|29723 CCA------CAGACTATTTCAAACTGCGTGTATTCCTCGACTCAAGCAAACAAGTTCTAT
Gorilla_gorilla|3015     CCAAGTCCACAGAATATTTCAAACTGCAGGTATGCGCAGACACCAGCAAACATGTTCTAT
Pan_troglodytes|11139    CCAAGTCCACAGAATATTTCAAACTGCAGGTATGCGCAGACACCAGCAAACATGTTCTAT
Homo_sapiens|25497       CCAAGTCCACAGAATATTTCAAACTGCAGGTATGCGCAGACACCAGCAAACATGTTCTAT
                         .             :    * .*.**   .**     . :      *    .    *** 

Mus_musculus|12547       AGAGTAGCCTGTGAGAACAGAACTCCA---CAAGACACTCCCATCTATCCAGTGGTTCCA
Mus_musculus|12560       ACAGTTGCCTGTGAGCCCAGAGTTGCA---TGGGATTGTCCCATCTATCCAGTGGTTCCA
Mus_musculus|12397       ACAGTTGCCTGTGACCCCAGAACTCCA---CAGGACAGTCCCATGTATCCAGTGGTTCCA
Mus_musculus|12402       ACAGTTGCCTGTAACCCCAGAACTCCA---CAGGACAGTCCCATGTATCCAGTGGTTCCA
Mus_musculus|12545       ACAGTTGCCTGTAACCCCAGAACTCCA---AAGGACCGTCCCACCTATCCAGTAGTTCCG
Mus_musculus|12548       ACAGTTGCCTGTGACCCCAGAACTCCT---CAGGACAGTCCCATGTATCCAGTGGTTCCA
Rattus_norvegicus|12631  AGAGTTGCCTGTGACCCCAGAACTCCA---CGGGACAATCGCACATATCCAGTGGTTCCA
Rattus_norvegicus|12632  ACAGTTGGCTGTGACCCGAGGACTCCA---CGGGACAGTCCCATGTATCCAGTGGTTCCG
Rattus_norvegicus|12633  ACAGTTGGCTGTGACCCGAGGACTCCA---CGGGACAGTCCCATGTATCCAGTGGTTCCG
Rattus_norvegicus|12629  AGAGTTGCCTGTAACAATAGAACTTCA---CAGGAGAGTCCCATGTATCCAGTGGTTCCT
Rattus_norvegicus|12634  ACAGTTGCCTGTAACCCCAGAACTCCA---CGGGACAGTCCCATGTATCCAGTGGTTCCG
Tarsius_syrichta|5553    GTGATTGCTTGTGCCAACAGAACTAAC---CAGGAGCCTAGCAAGTATCCACTGATTCCA
Otolemur_garnettii|13870 GTAGTTGCTTGTAACAACAGGGATCCACAGCGGGACTCTCTGCTGTATCCAGTGGTTCCA
Microcebus_murinus|3544  ATTGTTGCTTGTGATAAAAGATCTCGA---CAGGACCCTCCCATTTATCCAGTGGTTCCA
Homo_sapiens|25496       ATAGTTGCATGTGACAACAGGGATCAACGACGGGACCCTCCACAGTATCCAGTGGTTCCA
Callithrix_jacchus|29723 GTAGTTGCATGTGAAAACAGAGATCCA---CGGGACCCTCCACAGTATCCAGTGGTCCCG
Gorilla_gorilla|3015     ATAGTTGCATGTGACAACAGAGATCAACGACGGGACCCTCCACAGTATCCAGTGGTTCCA
Pan_troglodytes|11139    ATAGTTGCATGTGACAACAGAGATCAACGACGGGACCCTCCACAGTATCCGGTGGTTCCA
Homo_sapiens|25497       ATAGTTGCATGTGACAACAGAGATCAACGACGAGACCCTCCACAGTATCCGGTGGTTCCA
                         .  .*:*  ***.. .. **.  *       ..**   *.  .  *****. *..* ** 

Mus_musculus|12547       GTTCACTTGGATGGGACATTTTAG
Mus_musculus|12560       GTTCACTTGGATGGGACATTTTAG
Mus_musculus|12397       GTTCACTTGGATGGGACATTTTAG
Mus_musculus|12402       GTTCACTTGGATGGGACATTTTAG
Mus_musculus|12545       GTTCACTTGGATCGGCTATTTTAG
Mus_musculus|12548       GTTCACTTGGATGGGATATTTTAG
Rattus_norvegicus|12631  GTTCACTTGGATTTCATATTTTAG
Rattus_norvegicus|12632  GTTCACTTGGATAGGATATTTTAG
Rattus_norvegicus|12633  GTTCACTTGGATAGGATATTTTAG
Rattus_norvegicus|12629  GTTCACCTGGATGAGATATTTTAG
Rattus_norvegicus|12634  GTTCACTTGGATAGGATATTTTAG
Tarsius_syrichta|5553    GTTCACTTGGATAGAATCTTCTAA
Otolemur_garnettii|13870 GTTCACTTGGATGCAATC---TAA
Microcebus_murinus|3544  GTTCACCTGGATGGGATTGCA---
Homo_sapiens|25496       GTTCACCTGGATACCATCATCTAA
Callithrix_jacchus|29723 GTTCACCTGGATACCATCATCTAA
Gorilla_gorilla|3015     GTTCACCTGGATAGAATCATCTAA
Pan_troglodytes|11139    GTTCACCTGGATAGAATCATCTAA
Homo_sapiens|25497       GTTCACCTGGATAGAATCATCTAA
                         ****** *****   .        

multiple sequence alignment in CLUSTALW format


Mus_musculus|34127       -----VGMKLPESSLCLLLLLGLVLMLASCQAQIL----SQKFYTEYIYNSTYPRCDAVM
Mus_musculus|10856       -----MGPKLLESQLCLLLMLGLVLMLASCQKPTA----SQWFATQHITYKANLQCNVEM
Mus_musculus|31496       -----MGPKLLESRLCLLLLLGLVLMLASCLGQTP----SQKFAIQHINNNTNLQCNVEM
Mus_musculus|39459       -----MGPKLLESRLCLLLLLGLVLMLASCLGQTP----SQWFAIQHINNNANLQCNVEM
Mus_musculus|18373       -----MGLKLLESRLCLLLLLGLVLTLVSCQRPTP----SQKFDIQHIYKKSSPKCDDAM
Mus_musculus|10861       -----MGLEQLESRLCLLLLLGHVLMLASCQPLTP----SRWFDIQHIYNRAYPRCDDAM
Rattus_norvegicus|31847  -----MGLKLLESRLCLLLPLGLVLMLASCQRPTP----SQRFAIQHIYNSAYPQCNAAM
Rattus_norvegicus|31848  -----MGLKLLESRLCLLLLLGLVLMLASCQPPTP----SQWFEIQHIYNRAYPRCNDAM
Rattus_norvegicus|7018   -----MGLKLLESRLCLLLSLGLVLMLASCQPPTP----SQWFEIQHIYNRAYPRCNDAM
Rattus_norvegicus|7016   -----MGVKPLESRLCLLLLLGLVSMLASCQRPTP----SQWFAIQHIYNSSYPQCNAAM
Rattus_norvegicus|31849  -----MGLKLLESRLCLLLLLGLV----TCQRPTP----SQWFAIQHIYNSSYPQCNAAM
Tarsius_syrichta|5086    -----MVPKLLDSRLCLLLLLGLMGMEGSFHVKPSQFTWAQWFTIQHI-NMTHTRCDDAM
Otolemur_garnettii|11938 -----MVPKLLNSRFCLLLPLVLMAMVGSFHAKPPQFTWAQWFEIQHI-NMTNPQCTIAM
Microcebus_murinus|3002  -----MVPKLLDSRHCLLLLLGLMGMVGYCHAPPPGLTRAQWFEIQHI-NMTHPQCNNAM
Homo_sapiens|21198       WFQNCSLPK-FVCFFCWGFWLWRAHSMSNLHSLP------GLRGLTSI-SRNQLQCTNAM
Callithrix_jacchus|21705 -----MVPKLFTSQICLLLLLGLLSAEGSPHARPQQYSRAQWFSIQHI-QTAPLHCTSAM
Gorilla_gorilla|2854     -----MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHI-NMTSQQCTNAM
Pan_troglodytes|1807     -----MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHI-NMTSQQCTNAM
Homo_sapiens|21201       -----MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHI-NMTSQQCTNAM
                                 :   .  *  : *                          *      :*   *

Mus_musculus|34127       RVVNRYRPRCKDINTFLHTSFADVVAVCGHPNITCN-NLTRKNCHASSFQVFITFCNLTT
Mus_musculus|10856       QAINMHRPRCKGLNTFLHTSFINVVGVCSNPSGLCS-DKISQNCHNSSSRVPITVCNLTT
Mus_musculus|31496       MRINRARRTCKGLNTFLHTSFANAVGVCGNPSGLCS-DKRSQNCHNSSSRVHITVCNITS
Mus_musculus|39459       QRINRFRRTCKGLNTFLHTSFANAVGVCGNPSGLCS-DNISRNCHNSSSRVRITVCNITS
Mus_musculus|18373       RVVNKYTGKCKDLNTFLHTTFADVVRVCHNPPKTCK-DGTSPNCHDSSSKVSVTICKLTK
Mus_musculus|10861       RAVNSYTGVCKDINTFLHTTFANVVRVCHNPRKICK-NGISRNCHDSSNRVQVTICILTT
Rattus_norvegicus|31847  QRVNNYTGRCKDINTFLHTSFASVVGVCGNRNTTCNSNRTRTNCHDSTYQVKVTICNLTN
Rattus_norvegicus|31848  RHRNRFTRHCKDKNTFLHTSFASVVGVCGNRNIPCR-NRRYRNCHNSPYRVSITFCNLTT
Rattus_norvegicus|7018   RHRNRFTGHCKDINTFLHTSFASVVGVCGNRNIPCG-NRTYRNCHNSRYRVSITFCNLTT
Rattus_norvegicus|7016   LRVNSYTGRCKGINTFLHTSFASVVDVCGNPHITCK-DGRSTNCHNSSSQVSVTFCNLTT
Rattus_norvegicus|31849  LRVNSYTGRCKGINTFLHASFANVVGVCGNPHTTCK-DRISTNCHNSSSQVSITFCNLTT
Tarsius_syrichta|5086    RVVNGYLRRCKNRNTFLRTTFDDTAGVCGTPNITCPSNNTMKNCHQSPDQVNIVDCNLTK
Otolemur_garnettii|11938 RVINRYYPQCKRRNTFLHTTFAAVAGVCGTPNTPCVSNSSRTNCHNSSVPVAITYCNLTS
Microcebus_murinus|3002  RVVNSYTGRCKGQNTFLHTTFANVVNVCGNPNIRCL-TSQNTNCHNSSVQVSLTYCNLTS
Homo_sapiens|21198       RVINNYQRRWKNQNTFLLATFANVVNVCGNPTITCPHNRTLNNCHHSGVQVPLMYCNLTT
Callithrix_jacchus|21705 RAINKYQSRCKNKNTFLHTTFADVVNVCGNTNMTCPHNASLNNCHHSGVQVPLTYCNLTG
Gorilla_gorilla|2854     RVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTT
Pan_troglodytes|1807     QVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHQSGSQVPLIHCNLTT
Homo_sapiens|21201       QVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTT
                            *      *  **** ::*  .. **      *       *** *   * :  * :* 

Mus_musculus|34127       P-TRICTQCRYQTTGSVKYYRVACENRTP-QDTPIYPVVPVHLDGTF
Mus_musculus|10856       P-RRNYTQCRYQTKGSVEYYTVACEPRVA-WDCPIYPVVPVHLDGTF
Mus_musculus|31496       R-ATNYTQCRYQSRRSLEYYTVACDPRTP-QDSPMYPVVPVHLDGTF
Mus_musculus|39459       RRRTPYTQCRYQPRRSLEYYTVACNPRTP-QDSPMYPVVPVHLDGTF
Mus_musculus|18373       R-ARNYTHCRYKTTGAKKSYTVACNPRTP-KDRPTYPVVPVHLDRLF
Mus_musculus|10861       P-ASHYSNCRYRTTRSMKYYTVACDPRTP-QDSPMYPVVPVHLDGIF
Rattus_norvegicus|31847  R-AAVYPQCPYQTINSSKFYRVACDPRTP-RDNRTYPVVPVHLDFIF
Rattus_norvegicus|31848  P-ARIYTQCRYQTTRSRKFYTVGCDPRTP-RDSPMYPVVPVHLDRIF
Rattus_norvegicus|7018   P-ARIYTQCRYQTTRSRKFYTVGCDPRTP-RDSPMYPVVPVHLDRIF
Rattus_norvegicus|7016   P-ARIYTQCRYQTTGSVKFYRVACNNRTS-QESPMYPVVPVHLDEIF
Rattus_norvegicus|31849  P-ARIYTQCRYQTTGSLKFYTVACNPRTP-RDSPMYPVVPVHLDRIF
Tarsius_syrichta|5086    S-SKNITNCLYAQSSAQKYYVIACANRTN-QEPSKYPLIPVHLDRIF
Otolemur_garnettii|11938 R-PTPVANCRYTNTAAQSLYVVACNNRDPQRDSLLYPVVPVHLDAI-
Microcebus_murinus|3002  P-PTPVANCRYAQTPARMFYIVACDKRSR-QDPPIYPVVPVHLDGIA
Homo_sapiens|21198       PSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDTII
Callithrix_jacchus|21705 P--QTISNCVYSSTQANKFYVVACENRDP-RDPPQYPVVPVHLDTII
Gorilla_gorilla|2854     PSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
Pan_troglodytes|1807     PSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
Homo_sapiens|21201       PSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
                               .:* *    :   * :.*  *    :   **::*****