Orthologs Set ID: EOG4003J8


Orthology Database
OrthoDB4
Gene Symbol(s)
TNFAIP8L1

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 53411
Dipodomys ordii 13783
Homo sapiens 38046
Microcebus murinus 16400
Mus musculus 17880
Pan troglodytes 18054
Spermophilus tridecemlineatus 9856 578

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 53411 ENSCJAT00000043497 100404017 ENSCJAG00000022512 TNFAIP8L1 calJac3
Dipodomys ordii 13783 ENSDORT00000015946 ENSDORG00000015947 Tnfaip8l1 dipOrd1
Homo sapiens 38046 ENST00000327473 126282 ENSG00000185361 TNFAIP8L1 hg19,GRCh37
Microcebus murinus 16400 ENSMICT00000015259 ENSMICG00000015270 TNFAIP8L1 micMur1
Mus musculus 17880 ENSMUST00000077788 66443 ENSMUSG00000044469 Tnfaip8l1 mm9
Pan troglodytes 18054 ENSPTRT00000056374 ENSPTRG00000029168 TNFAIP8L1 panTro2
Spermophilus tridecemlineatus 9856 ENSSTOT00000009857 101975139 ENSSTOG00000009863 TNFAIP8L1 speTri1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 44362 ENSCJAP00000041119 100404017 ENSCJAG00000022512 TNFAIP8L1 calJac3
Dipodomys ordii 12979 ENSDORP00000015002 ENSDORG00000015947 Tnfaip8l1 dipOrd1
Homo sapiens 46504 ENSP00000331827 126282 ENSG00000185361 TNFAIP8L1 hg19,GRCh37
Microcebus murinus 13928 ENSMICP00000013919 ENSMICG00000015270 TNFAIP8L1 micMur1
Mus musculus 11805 ENSMUSP00000076961 66443 ENSMUSG00000044469 Tnfaip8l1 mm9
Pan troglodytes 33916 ENSPTRP00000049097 ENSPTRG00000029168 TNFAIP8L1 panTro2
Spermophilus tridecemlineatus 8846 ENSSTOP00000008839 101975139 ENSSTOG00000009863 TNFAIP8L1 speTri1

multiple sequence alignment in CLUSTALW format


Dipodomys_ordii|13783              ------------------------------------ATGGACACGTTCAGCACGCAGAGC
Microcebus_murinus|16400           ------------------------------------------------------------
Mus_musculus|17880                 ------------------------------------ATGGACACCTTCAGCACGAAGAGC
Spermophilus_tridecemlineatus|9856 ------------------------------------ATGGACACCTTCAGCACCAAGAGT
Callithrix_jacchus|53411           GTGAAACTGATGGCCAGTCTGTGTCCCCTGCAGGCCATGGACAGCTTCAGCACCAAGAGC
Homo_sapiens|38046                 ------------------------------------ATGGACACCTTCAGCACCAAGAGC
Pan_troglodytes|18054              ------------------------------------ATGGACACCTTCAGCACCAAGAGC
                                                                                               

Dipodomys_ordii|13783              CTGGCCCTGAAGGCGCAGAAGAAGGTCCTGAGCAAGATGTCCTCCAAGGCCATGGTGGCC
Microcebus_murinus|16400           ------------------------------------------------------------
Mus_musculus|17880                 CTGGCCCTGCAGGCCCAGAAGAAAGTCCTCAGCAAGATGGCTTCCAAGGCCATGGTGGCT
Spermophilus_tridecemlineatus|9856 CTGGCCCTGCAGGCCCAAAAGAAGGTCCTGAGCAAGATGGCGTCCAAGGCCACGGTGGCC
Callithrix_jacchus|53411           CTGGCGCTGCAGGCGCAGAAGAAGCTCCTGAGTAAGATGACCTCTAAGGCAGTGGTGGCT
Homo_sapiens|38046                 CTGGCTCTGCAGGCGCAGAAGAAGCTCCTGAGTAAGATGGCGTCCAAGGCAGTGGTGGCC
Pan_troglodytes|18054              CTGGCTCTGCAGGCGCAGAAGAAGCTCCTGAGTAAGATGGCGTCCAAGGCAGTGGTGGCC
                                                                                               

Dipodomys_ordii|13783              GTGTTTGCGGACGACACGAGCACGCAGGTGCTGGATGAGCTGTACCGGGCCAGCAAGGAG
Microcebus_murinus|16400           ------------------------------------------------------------
Mus_musculus|17880                 GTGTTTGTGGACAATACCAGCAGTGAGGTCTTGGATGAACTGTACCAGGCCACGAAGGAG
Spermophilus_tridecemlineatus|9856 GTGCTCCTGGACGACACCAGCAGCCAGGTGCTGGATGAGCTGTACCGGGCCACCAAGGAG
Callithrix_jacchus|53411           GTGCTGGTGGATGACACCAGCAGCGAGGTTCTGGATGAGCTGTACCGAGCCACCAAGGAG
Homo_sapiens|38046                 GTGCTGGTGGATGACACCAGCAGTGAGGTGCTGGATGAGCTGTACCGCGCCACCAGGGAG
Pan_troglodytes|18054              GTGCTGGTGGATGACACCAGCAGTGAGGTGCTGGATGAGCTGTACCGCGCCACCAGGGAG
                                                                                               

Dipodomys_ordii|13783              TTCACGCGCAGCCGCAAGGAGGCGCAGCGGGTGCTGAAGGACCTGGTCAAGGTGGCGGTG
Microcebus_murinus|16400           ------------------------------------------------------------
Mus_musculus|17880                 TTCACGCGCAGCCGGAAGGAGGCACAGAGGGTAGTGAAGAACCTGGTGAAGGTGGCTGTG
Spermophilus_tridecemlineatus|9856 TTCACGCGCAGCCGCAAGGAGGCGCAGAAGGTGGTGAAGAACCTGGTCAAGGTGGTCGTG
Callithrix_jacchus|53411           TTCACGCGCAGCCGCAAGGAGGCCCAGAAGATGCTCAAGAACCTGGTGAAGGTGGCCCTG
Homo_sapiens|38046                 TTCACGCGCAGCCGCAAGGAGGCCCAGAAGATGCTCAAGAACCTGGTCAAGGTGGCCCTG
Pan_troglodytes|18054              TTCACGCGCAGCCGCAAGGAGGCCCAGAAGATGCTCAAGAACCTGGTCAAGGTGGCCCTG
                                                                                               

Dipodomys_ordii|13783              AAGGTGGCGGTGGTGCTGCGGGCCGGGCGGCTGGGCGCGGACCAGTTGGCCCAGCTGGGC
Microcebus_murinus|16400           ------GGCCTGCTGCTGCGCGGCGGCCGGCTGGGCGCGGACGAGCTGGCGCTGCTGCAG
Mus_musculus|17880                 AAGCTGGCTGTGTTGCTGAGGGCGGACCAGCTGGACAGCAATGAGCTGGCCCAGCTGCAG
Spermophilus_tridecemlineatus|9856 AAGCTGGGCGTGCTGCTGCGCGCCGGGCAGCTGGGCAGCCGCGAGCTGGAGCTGCTGGGG
Callithrix_jacchus|53411           AAGCTGGGGCTGCTACTGCGCGGGGACCAGCTGGGCGGGGAGGAACTGGCGCTGCTGCGG
Homo_sapiens|38046                 AAGCTGGGACTGCTGCTGCGTGGGGACCAGCTGGGCGGTGAGGAGCTGGCGCTGCTGCGG
Pan_troglodytes|18054              AAGCTGGGACTGCTGCTGCGTGGGGACCAGCTGGGCGGTGAGGAGCTGGCGCTGCTGCGG
                                         *   ** *.***.* *  *. *.*****.*.   .  *. ***. *:**** . 

Dipodomys_ordii|13783              CACTTCCGGCGGCGCGCGCGCAGCCTGGCCATGACGGCCGTGAGCTTCCAGCAGGTGGCC
Microcebus_murinus|16400           CGCCTCCGCGAGCGCGCGCGCCGCCTGGCCATGACCGCCCTCAGCTTCCGCCAGGTGGAC
Mus_musculus|17880                 CGGTTCCGGGGCCGCGTCCGCAGCCTGGCCATGACAGCCCTCAGCTTCCACCAGGTAGAC
Spermophilus_tridecemlineatus|9856 CGCTTCCGCCAGAGGGCCCGCGGCCTGGCCCTGACCGCGCTCAGCTTCCACCAGGTGGCC
Callithrix_jacchus|53411           CGCTTCCGCCACCGGGCACGCTGCCTGGCCATGACGGCCGTCAGCTTCCACCAGGTGGAC
Homo_sapiens|38046                 CGCTTCCGCCACCGGGCGCGCTGCCTGGCCATGACGGCCGTCAGCTTCCACCAGGTGGAC
Pan_troglodytes|18054              CGCTTCCGCCACCGGGCGCGCTGCCTGGCCATGACGGCCGTCAGCTTCCACCAGGTGGAC
                                   *.  ****  . .* *  *** ********.**** **  * *******. *****.*.*

Dipodomys_ordii|13783              TTCACCTTCGACCGCCGCGTGCTGGCCGCCGGGCTGCTGGAGTGCCGAGACCTCTTGCAC
Microcebus_murinus|16400           TTCACCTTCGACCGGCGCGTGCTGGCCGCCGGCCTGCTGGAGTGCCGCGACCTGCTGCAG
Mus_musculus|17880                 TTCACCTTTGACCGGCGTGTGCTGGCCACTGGGCTGCTGGAGTGCAGGGACCTGTTGCAC
Spermophilus_tridecemlineatus|9856 TTCACCTTCGACCGGCGCGTGCTGGTGGCCGGGCTGCAGGAGTGCCGTGACCTGCTGCAC
Callithrix_jacchus|53411           TTCACCTTCGACCGGCGCGTGCTGGCCGCCGGGCTGCTTGAGTGCCGCGACCTGCTGCAC
Homo_sapiens|38046                 TTCACCTTCGACCGGCGCGTGCTGGCCGCCGGGCTGCTCGAGTGCCGCGACCTGCTGCAC
Pan_troglodytes|18054              TTCACCTTCGACCGGCGCGTGCTGGCCGCCGGGCTGCTCGAGTGCCGCGACCTGCTGCAC
                                   ******** ***** ** *******  .* ** ****: ******.* *****  **** 

Dipodomys_ordii|13783              CAGGCCACCGGGCCCCACCTCACCGCCAAGTCCCACGGCCGCATCAACCACGTGTTCGGC
Microcebus_murinus|16400           CAGGCCCTGGGCCCGCGCCTGTCCGCCAAGTCCCACGGCCGCATCAGCCACGTCTTCGGC
Mus_musculus|17880                 CAGGCTATTGGCCCGCACCTCACTGCCAAGTCCCACGGCCGCATCAATCACATCTTCAGT
Spermophilus_tridecemlineatus|9856 CAGGCCGCCGGCCCGCACCTGACCGCCAAGTCCCACGGCCGCATCAACCACGTCTTCAGC
Callithrix_jacchus|53411           CAGGCCGTGGGCCCACACCTCACTGCCAAGTCCCACAGCCGCATCAACCACGTCTTCGGC
Homo_sapiens|38046                 CAGGCCGTGGGTCCCCACCTGACCGCCAAGTCCCACGGCCGCATCAACCACGTGTTCGGC
Pan_troglodytes|18054              CAGGCCGTGGGTCCCCACCTGACCGCCAAGTCCCACGGCCGCATCAACCACGTGTTCGGC
                                   *****    ** ** *.*** :* ************.*********. ***.* ***.* 

Dipodomys_ordii|13783              CACTTTGCCAACGGGGACTTCCTGGCGGCGCTGTACGGGCCGGCCGAGCCTTACTGCTCC
Microcebus_murinus|16400           CGCCTGGCCGACGGCGACTTCCTGGCCGCGCTCTACGGGCCGGCCGAGCCCTACCGCTCC
Mus_musculus|17880                 CACTTTGCCAATGGTGACTTCCTGGCCGCGCTGTACAGCCCAGCAGAGCCCTACCGGAGC
Spermophilus_tridecemlineatus|9856 CACGTGGCCAACTGCGACTTCCTGGCCGCGCTCTACGGCCCGGCCGAGCCCTACCGCTCC
Callithrix_jacchus|53411           CACCTGGCCGACTGCGACTTCCTGGCCGCGCTCTACGGACCCACGGAGCCCTACCGCTCC
Homo_sapiens|38046                 CACCTAGCCGACTGCGACTTCCTGGCTGCGCTCTACGGCCCCGCCGAGCCCTACCGCTCC
Pan_troglodytes|18054              CACCTAGCCGACTGCGACTTCCTGGCTGCGCTCTACGGCCCCGCCGAGCCCTACCGCTCC
                                   *.* * ***.*  * *********** ***** ***.* ** .* ***** *** * : *

Dipodomys_ordii|13783              CACCTGCAGCGCATCTGCGATGGGCTGGGCCGCATGCTGGACACCGACAGCATCTGA
Microcebus_murinus|16400           CACCTGCGCGGCATCTGCGAGGGCCTGGAGAGGCTGCTGGAGGACGGCAGCCTGTGA
Mus_musculus|17880                 CATCTGTGCCGCATCTGTGATGGCCTCGGGAGGATGTTGGACGAGGGTGGCATCTGA
Spermophilus_tridecemlineatus|9856 CACCTCCGCGGGATCTGCGAGGGCCTCGGCAGGCTGCTGGACGAGGACAGCATCTGA
Callithrix_jacchus|53411           CACCTGCACAGGATCTGCGAGGGCCTGGGCCGGATGCTGGACGACGGCAGCCTCTGA
Homo_sapiens|38046                 CACCTGCGCAGGATCTGCGAGGGCCTGGGCCGGATGCTGGACGAGGGCAGCCTCTGA
Pan_troglodytes|18054              CACCTGCGCAGGATCTGCGAGGGCCTGGGCCGGATGCTGGACGAGGGCAGCCTCTGA
                                   ** **  .  * ***** ** ** ** *. .* .** **** .. *. .**.* ***

multiple sequence alignment in CLUSTALW format


Dipodomys_ordii|12979              ------------MDTFSTQSLALKAQKKVLSKMSSKAMVAVFADDTSTQVLDELYRASKE
Microcebus_murinus|13928           ------------------------------------------------------------
Mus_musculus|11805                 ------------MDTFSTKSLALQAQKKVLSKMASKAMVAVFVDNTSSEVLDELYQATKE
Spermophilus_tridecemlineatus|8846 ------------MDTFSTKSLALQAQKKVLSKMASKATVAVLLDDTSSQVLDELYRATKE
Callithrix_jacchus|44362           VKLMASLCPLQAMDSFSTKSLALQAQKKLLSKMTSKAVVAVLVDDTSSEVLDELYRATKE
Homo_sapiens|46504                 ------------MDTFSTKSLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATRE
Pan_troglodytes|33916              ------------MDTFSTKSLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATRE
                                                                                               

Dipodomys_ordii|12979              FTRSRKEAQRVLKDLVKVAVKVAVVLRAGRLGADQLAQLGHFRRRARSLAMTAVSFQQVA
Microcebus_murinus|13928           ----------------------GLLLRGGRLGADELALLQRLRERARRLAMTALSFRQVD
Mus_musculus|11805                 FTRSRKEAQRVVKNLVKVAVKLAVLLRADQLDSNELAQLQRFRGRVRSLAMTALSFHQVD
Spermophilus_tridecemlineatus|8846 FTRSRKEAQKVVKNLVKVVVKLGVLLRAGQLGSRELELLGRFRQRARGLALTALSFHQVA
Callithrix_jacchus|44362           FTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVD
Homo_sapiens|46504                 FTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVD
Pan_troglodytes|33916              FTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVD
                                                         .::**..:*.. :*  * ::* *.* **:**:**:** 

Dipodomys_ordii|12979              FTFDRRVLAAGLLECRDLLHQATGPHLTAKSHGRINHVFGHFANGDFLAALYGPAEPYCS
Microcebus_murinus|13928           FTFDRRVLAAGLLECRDLLQQALGPRLSAKSHGRISHVFGRLADGDFLAALYGPAEPYRS
Mus_musculus|11805                 FTFDRRVLATGLLECRDLLHQAIGPHLTAKSHGRINHIFSHFANGDFLAALYSPAEPYRS
Spermophilus_tridecemlineatus|8846 FTFDRRVLVAGLQECRDLLHQAAGPHLTAKSHGRINHVFSHVANCDFLAALYGPAEPYRS
Callithrix_jacchus|44362           FTFDRRVLAAGLLECRDLLHQAVGPHLTAKSHSRINHVFGHLADCDFLAALYGPTEPYRS
Homo_sapiens|46504                 FTFDRRVLAAGLLECRDLLHQAVGPHLTAKSHGRINHVFGHLADCDFLAALYGPAEPYRS
Pan_troglodytes|33916              FTFDRRVLAAGLLECRDLLHQAVGPHLTAKSHGRINHVFGHLADCDFLAALYGPAEPYRS
                                   ********.:** ******:** **:*:****.**.*:*.:.*: *******.*:*** *

Dipodomys_ordii|12979              HLQRICDGLGRMLDTDSI
Microcebus_murinus|13928           HLRGICEGLERLLEDGSL
Mus_musculus|11805                 HLCRICDGLGRMLDEGGI
Spermophilus_tridecemlineatus|8846 HLRGICEGLGRLLDEDSI
Callithrix_jacchus|44362           HLHRICEGLGRMLDDGSL
Homo_sapiens|46504                 HLRRICEGLGRMLDEGSL
Pan_troglodytes|33916              HLRRICEGLGRMLDEGSL
                                   **  **:** *:*: ..: