Orthologs Set ID: EOG4003J9


Orthology Database
OrthoDB4
Gene Symbol(s)
RPL32

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 16147 105, 356
Callithrix jacchus 51434 292
Callithrix jacchus 53142
Callithrix jacchus 53205
Callithrix jacchus 53483
Callithrix jacchus 53661
Callithrix jacchus 54074
Callithrix jacchus 54095
Callithrix jacchus 54160
Callithrix jacchus 61
Cavia porcellus 20874 344, 465
Cavia porcellus 2420 105, 356
Dipodomys ordii 15216 105, 356
Gorilla gorilla 22535 105, 356
Gorilla gorilla 34180
Homo sapiens 60828 105, 356
Mus musculus 26318
Mus musculus 36395 105, 356
Mus musculus 46156
Oryctolagus cuniculus 12109
Oryctolagus cuniculus 13503
Oryctolagus cuniculus 16684
Oryctolagus cuniculus 1743
Oryctolagus cuniculus 18886
Oryctolagus cuniculus 19025 131, 356
Oryctolagus cuniculus 19675
Oryctolagus cuniculus 23321
Oryctolagus cuniculus 23725
Oryctolagus cuniculus 2911
Oryctolagus cuniculus 4898 163
Oryctolagus cuniculus 8085
Pan troglodytes 25696 105, 356
Pan troglodytes 33711
Rattus norvegicus 1568 42, 166, 444
Rattus norvegicus 20058 80, 276
Rattus norvegicus 23051 377
Rattus norvegicus 25888 105, 356
Rattus norvegicus 27675
Rattus norvegicus 30773
Rattus norvegicus 33429
Rattus norvegicus 34427 262, 450
Rattus norvegicus 37258
Rattus norvegicus 5326 237, 309, 324, 354
Spermophilus tridecemlineatus 6627 18, 87, 174, 201, 324, 354, 370
Tupaia belangeri 10941
Tupaia belangeri 12728 18, 166, 417, 429
Tupaia belangeri 12862 105, 356
Tupaia belangeri 2078 42, 164, 219, 261, 289, 462
Tupaia belangeri 8914

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 61 ENSCJAT00000042719 100407799 ENSCJAG00000021734 LOC100407799 calJac3
Callithrix jacchus 16147 ENSCJAT00000032611 100385527 ENSCJAG00000016774 RPL32 calJac3
Callithrix jacchus 51434 ENSCJAT00000014683 ENSCJAG00000007502 calJac3
Callithrix jacchus 53142 ENSCJAT00000043224 100407417 ENSCJAG00000022239 LOC100407417 calJac3
Callithrix jacchus 53205 ENSCJAT00000043530 100415625 ENSCJAG00000022545 calJac3
Callithrix jacchus 53483 ENSCJAT00000043263 100404840 ENSCJAG00000022278 LOC100404840 calJac3
Callithrix jacchus 53661 ENSCJAT00000042917 100397992 ENSCJAG00000021932 LOC100397992 calJac3
Callithrix jacchus 54074 ENSCJAT00000043201 ENSCJAG00000022216 calJac3
Callithrix jacchus 54095 ENSCJAT00000040854 ENSCJAG00000020791 calJac3
Callithrix jacchus 54160 ENSCJAT00000044263 100415625 ENSCJAG00000023278 calJac3
Cavia porcellus 2420 ENSCPOT00000025547 100721117 ENSCPOG00000019967 RPL32 cavPor3
Cavia porcellus 20874 ENSCPOT00000024173 ENSCPOG00000021585 cavPor3
Dipodomys ordii 15216 ENSDORT00000008426 ENSDORG00000008426 Rpl32 dipOrd1
Gorilla gorilla 22535 ENSGGOT00000022798 101138904 ENSGGOG00000026097 RPL32 gorGor3
Gorilla gorilla 34180 ENSGGOT00000027383 101138904 ENSGGOG00000025093 gorGor3
Homo sapiens 60828 ENST00000429711, NM_000994 6161 ENSG00000144713 RPL32 hg19,GRCh37
Mus musculus 46156 ENSMUST00000078326, NM_001085510 ENSMUSG00000063816 mm9
Mus musculus 36395 ENSMUST00000081840 19951 ENSMUSG00000057841 Rpl32 mm9
Mus musculus 26318 ENSMUST00000091052 ENSMUSG00000068969 mm9
Oryctolagus cuniculus 13503 ENSOCUT00000022267 100352536 ENSOCUG00000026727 LOC100352536 oryCun2.0
Oryctolagus cuniculus 23321 ENSOCUT00000029672 ENSOCUG00000022376 oryCun2.0
Oryctolagus cuniculus 23725 ENSOCUT00000022838 ENSOCUG00000027910 oryCun2.0
Oryctolagus cuniculus 2911 ENSOCUT00000008822 ENSOCUG00000025862 oryCun2.0
Oryctolagus cuniculus 4898 ENSOCUT00000003549 ENSOCUG00000003552 oryCun2.0
Oryctolagus cuniculus 1743 ENSOCUT00000022972 100345217 ENSOCUG00000021849 LOC100345217 oryCun2.0
Oryctolagus cuniculus 16684 ENSOCUT00000026569 100328901 ENSOCUG00000023030 oryCun2.0
Oryctolagus cuniculus 18886 ENSOCUT00000021540 100359042 ENSOCUG00000022043 LOC100359042 oryCun2.0
Oryctolagus cuniculus 19025 ENSOCUT00000002579 ENSOCUG00000023407 oryCun2.0
Oryctolagus cuniculus 19675 ENSOCUT00000025174 ENSOCUG00000022319 oryCun2.0
Oryctolagus cuniculus 8085 ENSOCUT00000028829 ENSOCUG00000022796 oryCun2.0
Oryctolagus cuniculus 12109 ENSOCUT00000025521 ENSOCUG00000022085 oryCun2.0
Pan troglodytes 25696 ENSPTRT00000027391, NM_000994 750791 ENSPTRG00000014638 XR_022611.1 panTro2
Pan troglodytes 33711 ENSPTRT00000048516 742239 ENSPTRG00000023474 XR_021876.1 panTro2
Rattus norvegicus 25888 ENSRNOT00000014493 28298 ENSRNOG00000010746 Rpl32 rn4
Rattus norvegicus 23051 ENSRNOT00000036031 ENSRNOG00000026921 Rpl32-ps1 rn4
Rattus norvegicus 27675 ENSRNOT00000011244 ENSRNOG00000008516 LOC688684 rn4
Rattus norvegicus 30773 ENSRNOT00000046799 ENSRNOG00000032605 Rpl32 rn4
Rattus norvegicus 33429 ENSRNOT00000048460 ENSRNOG00000028869 RGD1563958 rn4
Rattus norvegicus 37258 ENSRNOT00000045382 680959 ENSRNOG00000030346 LOC680959 rn4
Rattus norvegicus 34427 ENSRNOT00000002159 ENSRNOG00000001591 D4ACC7_RAT rn4
Rattus norvegicus 20058 ENSRNOT00000012869 ENSRNOG00000009701 D3ZAC3_RAT rn4
Rattus norvegicus 1568 ENSRNOT00000065311 ENSRNOG00000042147 AC123018.1 rn4
Rattus norvegicus 5326 ENSRNOT00000004399 ENSRNOG00000003299 D3ZRY2_RAT rn4
Spermophilus tridecemlineatus 6627 ENSSTOT00000006628 speTri1
Tupaia belangeri 2078 ENSTBET00000002079 ENSTBEG00000002087 tupBel1
Tupaia belangeri 12728 ENSTBET00000012729 ENSTBEG00000012742 tupBel1
Tupaia belangeri 12862 ENSTBET00000012863 ENSTBEG00000012875 RPL32 tupBel1
Tupaia belangeri 8914 ENSTBET00000008915 ENSTBEG00000008926 tupBel1
Tupaia belangeri 10941 ENSTBET00000010942 ENSTBEG00000010963 tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 8756 ENSCJAP00000030858 100385527 ENSCJAG00000016774 RPL32 calJac3
Callithrix jacchus 43590 ENSCJAP00000040446 calJac3
Callithrix jacchus 44098 ENSCJAP00000040891 calJac3
Callithrix jacchus 44161 ENSCJAP00000041152 100415625 ENSCJAG00000022545 calJac3
Callithrix jacchus 44434 ENSCJAP00000040925 calJac3
Callithrix jacchus 44612 ENSCJAP00000040616 calJac3
Callithrix jacchus 45025 ENSCJAP00000040868 ENSCJAG00000022216 calJac3
Callithrix jacchus 45046 ENSCJAP00000038674 ENSCJAG00000020791 calJac3
Callithrix jacchus 45111 ENSCJAP00000041790 100415625 ENSCJAG00000023278 calJac3
Callithrix jacchus 42432 ENSCJAP00000013938 ENSCJAG00000007502 calJac3
Cavia porcellus 1893 ENSCPOP00000019025 100721117 ENSCPOG00000019967 RPL32 cavPor3
Cavia porcellus 16438 ENSCPOP00000015722 ENSCPOG00000021585 cavPor3
Dipodomys ordii 14302 ENSDORP00000007909 ENSDORG00000008426 Rpl32 dipOrd1
Gorilla gorilla 17706 ENSGGOP00000023056 101138904 ENSGGOG00000026097 RPL32 gorGor3
Gorilla gorilla 26310 ENSGGOP00000025126 101138904 ENSGGOG00000025093 gorGor3
Homo sapiens 70645 ENSP00000416429 6161 ENSG00000144713 RPL32 hg19,GRCh37
Mus musculus 43387 ENSMUSP00000080523 19951 ENSMUSG00000057841 Rpl32 mm9
Mus musculus 54291 ENSMUSP00000077440 mm9
Mus musculus 28037 ENSMUSP00000088577 mm9
Oryctolagus cuniculus 18709 ENSOCUP00000021333 ENSOCUG00000003552 oryCun2.0
Oryctolagus cuniculus 17276 ENSOCUP00000019466 100359042 ENSOCUG00000022043 LOC100359042 oryCun2.0
Oryctolagus cuniculus 14961 ENSOCUP00000025043 ENSOCUG00000022319 oryCun2.0
Oryctolagus cuniculus 15065 ENSOCUP00000018906 100328901 ENSOCUG00000023030 oryCun2.0
Oryctolagus cuniculus 15271 ENSOCUP00000020116 ENSOCUG00000022376 oryCun2.0
Oryctolagus cuniculus 16026 ENSOCUP00000024668 ENSOCUG00000027910 oryCun2.0
Oryctolagus cuniculus 12138 ENSOCUP00000025117 ENSOCUG00000022085 oryCun2.0
Oryctolagus cuniculus 12560 ENSOCUP00000024305 ENSOCUG00000022796 oryCun2.0
Oryctolagus cuniculus 12580 ENSOCUP00000024154 100352536 ENSOCUG00000026727 LOC100352536 oryCun2.0
Oryctolagus cuniculus 13028 ENSOCUP00000022033 ENSOCUG00000025862 oryCun2.0
Oryctolagus cuniculus 13506 ENSOCUP00000019296 100345217 ENSOCUG00000021849 LOC100345217 oryCun2.0
Oryctolagus cuniculus 10834 ENSOCUP00000002227 ENSOCUG00000023407 oryCun2.0
Pan troglodytes 11071 ENSPTRP00000025256 750791 ENSPTRG00000014638 XR_022611.1 panTro2
Pan troglodytes 33592 ENSPTRP00000056430 742239 ENSPTRG00000023474 XR_021876.1 panTro2
Rattus norvegicus 26916 ENSRNOP00000061874 ENSRNOG00000042147 AC123018.1 rn4
Rattus norvegicus 27939 ENSRNOP00000012870 ENSRNOG00000009701 D3ZAC3_RAT rn4
Rattus norvegicus 30811 ENSRNOP00000051427 ENSRNOG00000028869 RGD1563958 rn4
Rattus norvegicus 31759 ENSRNOP00000041638 ENSRNOG00000032605 Rpl32 rn4
Rattus norvegicus 32462 ENSRNOP00000011244 ENSRNOG00000008516 LOC688684 rn4
Rattus norvegicus 32478 ENSRNOP00000042210 rn4
Rattus norvegicus 16042 ENSRNOP00000030273 ENSRNOG00000026921 Rpl32-ps1 rn4
Rattus norvegicus 23015 ENSRNOP00000002159 ENSRNOG00000001591 D4ACC7_RAT rn4
Rattus norvegicus 14430 ENSRNOP00000051066 ENSRNOG00000003299 D3ZRY2_RAT rn4
Rattus norvegicus 7460 ENSRNOP00000014493 28298 ENSRNOG00000010746 Rpl32 rn4
Spermophilus tridecemlineatus 5937 ENSSTOP00000005928 speTri1
Tupaia belangeri 7739 ENSTBEP00000007728 ENSTBEG00000008926 tupBel1
Tupaia belangeri 11040 ENSTBEP00000011026 ENSTBEG00000012742 tupBel1
Tupaia belangeri 9484 ENSTBEP00000009461 ENSTBEG00000010963 tupBel1
Tupaia belangeri 11160 ENSTBEP00000011146 ENSTBEG00000012875 RPL32 tupBel1
Tupaia belangeri 1813 ENSTBEP00000001804 ENSTBEG00000002087 tupBel1

multiple sequence alignment in CLUSTALW format


Spermophilus_tridecemlineatus|6627 ------------AAACCT---GTGAAGCCCCAAATTACCAAAAAT---------------
Tupaia_belangeri|12728             ATGGCTGCTCTCACACCCGTGGTG---CCCAAGATCCTCAAAAAGAGGACT---------
Rattus_norvegicus|1568             ATGGCTGCCCTTTGGTCTCTGGTGAAGCCCAAGATCGTCAAA---AGGACC---------
Tupaia_belangeri|2078              ATGGCTGCCTTCAGACCCCTTGTGAAACCCAAGATCATCCAA---AGGACC---------
Tupaia_belangeri|10941             ATGGCTGCCTTCAGGTCCCTTGTGAAACCCAAGATCATCAAAAAGAGGACC---------
Oryctolagus_cuniculus|2911         ATGGCCTCCCTCAGACCCCTGGTGAAGCCCAAGATCATCAAAAAGTGGACC---------
Cavia_porcellus|20874              ATGGCTGCCTTCAGACCCCTTGTGAAGCCCAAGATAGTCAAAAAGAGGACA---------
Rattus_norvegicus|5326             ATGGCTGCCCTTCGGCCTCGGGTGAAGCCCAAGATTGTCAAAAAGAGGACC---------
Rattus_norvegicus|33429            ATGGCTACCCTTCTGTGTCTAGTGAAGCCCAAGATCGTCAAAAAGAGGACC---------
Rattus_norvegicus|20058            ATGGCTGCCCTTCTGCCTCTGGTGAAGCCAAAGATCATCAAAAAGAGGACC---------
Rattus_norvegicus|34427            ATGGCTGCCCTTCGGCCTCTGGTGAAGCCCAAGATCATCAAAAAGAGGACC---------
Callithrix_jacchus|51434           ------------AAGCCCATGCCACCTCCACATTCTGTGAGCTCCCAAAACTTCGTCAAG
Callithrix_jacchus|54095           ATGGCCGCCCTTAGAGCCCTTGTGAAACCCAAGACCGTCAAAAAGAGAACC---------
Oryctolagus_cuniculus|4898         ATGGCCGCCCTCAGACCCCTGGTGGAGCCCAAGATCGTCAAAAAGAAGACC---------
Rattus_norvegicus|37258            ATGGCTGCCCTTCGGCCTCTAATGAAGCCCAAGATCATCCAAAAGAGGACC---------
Mus_musculus|46156                 ATGGCTGCCCTCCGGCCTCTGGTGAAGCCCAAGATCGTCAAAAAGAGGACC---------
Mus_musculus|26318                 ATGGCTGCCCTCCGGCCTCTGGTGAAGCCCAAGATCGTCAAAAAGAGGACC---------
Callithrix_jacchus|53142           ATGGCCGCCCTTAGACCCCTTGTGAAACCCAAGATCGTCAAAAAGAGAACC---------
Pan_troglodytes|33711              ATGGCCGCCCTCAGACCCCTTGTGAAGCCCAAGATCGTCAAAAAGAGAACC---------
Oryctolagus_cuniculus|23321        ATAGCCGCCCTCAGACCCCTGGTGAAGCCCAAGATCGTCAAAAAGAGGACC---------
Callithrix_jacchus|54074           ACAGCTGCCCTTAGACCCCTTGTGAAATCCAAGATCGTCAAAAAGAGAACC---------
Callithrix_jacchus|53483           ATGGCCGCCCTTAGACCCCTTGTGAAACCCAAGATCGTCAAAAAGAGAACC---------
Gorilla_gorilla|34180              ATGGCCACCCTCAGACCCCTTGTGAAGCCCAAGATCGTGAAAAAGAGAACC---------
Oryctolagus_cuniculus|16684        ATGGCCGCCCTCAGACCCCTGGAGAAGCCCAAGATCGTCAAAAAGAGGACC---------
Oryctolagus_cuniculus|23725        ATGGCCGCCCTCAGACCCCTGGTGAAGCCCAAGATCGTCAAAAAGAGGACC---------
Oryctolagus_cuniculus|12109        ATGGCCGCCCTCAGACCCCTGGTGAAGCCCAAGATCGTCAAAAAGAGGACC---------
Rattus_norvegicus|27675            ATGGCTGCCCTTCGGCCTCTGGTGAAGCCCAAGATCGTCAAAAAGAGGACC---------
Oryctolagus_cuniculus|8085         ATGGCCGCCCTCAGACCCCTGGTGAAGCCCAAGATCGTCAAAAAGAGGACC---------
Callithrix_jacchus|53661           ATGGCTGCCCTTAGACCCCTTGTGAAACCCAAGATCGTCAAAAAGAGAACC---------
Callithrix_jacchus|61              ATGGCCGCCCTTAGACCCCTTGTGAAACCCAAGATCGTCAAAAAGAGAACC---------
Tupaia_belangeri|8914              ATGGCTGCCCTCCGGCCCCTCGTGAAACCCAAGATCGTCAAAAAGAGGACC---------
Oryctolagus_cuniculus|19675        ATGGCCGCCCTCAGACCCCTGGTGAAGCCCAAGATCGTCAAAAAGAGGACC---------
Rattus_norvegicus|23051            ATGGCTGCCCTTCGGCCTCTGGTGAAGCCCAAGATCGTCAAAAAGAGGACC---------
Gorilla_gorilla|22535              ATGGCCGCCCTCAGACCCCTTGTGAAGCCCAAGATCGTCAAAAAGAGAACC---------
Oryctolagus_cuniculus|19025        ATGGCCGCCCTCAGACCCCTGGTGAAGCCCAAGATCGTCAAAAAGAGGACC---------
Callithrix_jacchus|54160           ATGGCCGCCCTTAGACCCCTTGTGAAACCCAAGATCGTCAAAAAGAGAACC---------
Callithrix_jacchus|16147           ATGGCCGCCCTTAGACCCCTTGTGAAACCCAAGATCGTCAAAAAGAGAACC---------
Callithrix_jacchus|53205           ATGGCCGCCCTTAGACCCCTTGTGAAACCCAAGATCGTCAAAAAGAGAACC---------
Cavia_porcellus|2420               ATGGCGGCCCTCAGACCCCTTGTGAAGCCCAAGATCGTCAAAAAGAGGACA---------
Dipodomys_ordii|15216              ATGGCCGCCCTCAGACCTCTGGTGAAGCCCAAGATCGTCAAAAAGAGGACC---------
Homo_sapiens|60828                 ATGGCCGCCCTCAGACCCCTTGTGAAGCCCAAGATCGTCAAAAAGAGAACC---------
Mus_musculus|36395                 ATGGCTGCCCTCCGGCCTCTGGTGAAGCCCAAGATCGTCAAAAAGAGGACC---------
Oryctolagus_cuniculus|18886        ATGGCCGCCCTCAGACCCCTGGTGAAGCCCAAGATCGTCAAAAAGAGGACC---------
Oryctolagus_cuniculus|13503        ATGGCCGCCCTCAGACCCCTGGTGAAGCCCAAGATCGTCAAAAAGAGGACC---------
Oryctolagus_cuniculus|1743         ATGGCCGCCCTCAGACCCCTGGTGAAGCCCAAGATCGTCAAAAAGAGGACC---------
Pan_troglodytes|25696              ATGGCCGCCCTCAGACCCCTTGTGAAGCCCAAGATCGTCAAAAAGAGAACC---------
Rattus_norvegicus|25888            ATGGCTGCCCTTCGGCCTCTGGTGAAGCCCAAGATCGTCAAAAAGAGGACC---------
Rattus_norvegicus|30773            ATGGCTGCCCTTCGGCCTCTGGTGAAGCCCAAGATCGTCAAAAAGAGGACC---------
Tupaia_belangeri|12862             ATGGCTGCCCTCCGGCCCCTCGTGAAACCCAAGATCGTCAAAAAGAGGACC---------
                                                 .        .    *..* :     ...                  

Spermophilus_tridecemlineatus|6627 GAGAATTTCATTCAGCCTGAGTCAGAC---TATGCCAAAATTAGT---------------
Tupaia_belangeri|12728             GAGAAGTTCATCTGGCACTGGTCCTACCGATATGTCAAAATCAAG---------------
Rattus_norvegicus|1568             AAGAAGTTCATCAGGCACCCGTCAGACCAATATGTG------------------------
Tupaia_belangeri|2078              AAGAAGTTCATCCGGCACCAGTCAGACCAATATCTCAAAACAAAG---------------
Tupaia_belangeri|10941             AAGAAGTTCATCCCACACCAGTCAGACCAATATGCCAAAATTAAG---------------
Oryctolagus_cuniculus|2911         AAGAAGTTCATCCGCCACCAGTCGGACCGCTATGTCAAGATTAAG---------------
Cavia_porcellus|20874              AAGAAGTTCATCTGTCACCAGTCAAACCGATATGTCAAAATTAAG---------------
Rattus_norvegicus|5326             AAGAAGTTCATCAGGCACCAGTCGGACCGATATGTGAAAATTAAG---------------
Rattus_norvegicus|33429            AAGAAGTTCATCAGGCACCAGTTGGACCAATATGTGAAAATTAAG---------------
Rattus_norvegicus|20058            AAGAAGTTCATCAGGCACCAG---------------------------------------
Rattus_norvegicus|34427            AAGGAGTTCAACAGGCATCAGTCAGACCAATATGTGAAAATTAAG---------------
Callithrix_jacchus|51434           AAGAAGTTCATCTGGCACCAGTCAGACCGATATGTCAAAATTAAG---------------
Callithrix_jacchus|54095           AAGAAGTTCATTCCGCACCAGTCAGACCGATATGTCAAAATTAAG---------------
Oryctolagus_cuniculus|4898         AAGAAGTTCATCCGCCACCATCGAACA---------------------------------
Rattus_norvegicus|37258            AAGAAGTTCATCAGGCACCAGTCGGACCGATATGTGAAAATTAAG---------------
Mus_musculus|46156                 AAGAAGTTCATCAGACACCAGTCAGACCGATATGTGAAAATTAAG---------------
Mus_musculus|26318                 AAAAAGTTCATCAGACACCAGTCAGACCGATATGTGAAAATTAAG---------------
Callithrix_jacchus|53142           AAGAAGTTCATCCGGCACCAGTCAGACCGATATGTCAAAATCAAG---------------
Pan_troglodytes|33711              AAGAAGTTCATCTGGCACCAGTCAGACCAATATGTCAAAATTAAG---------------
Oryctolagus_cuniculus|23321        AAGAAGTTCATCCGCCACCAGTCGGACCGCTATGTCAAGATTAAG---------------
Callithrix_jacchus|54074           AAGAAGTTCATCCGGCACCAGTCAGACCAATATGTCAAAATTAAG---------------
Callithrix_jacchus|53483           AAGAAGTTCATCCGGCACCAGTCAGACCGACATGTCAAAATTAAG---------------
Gorilla_gorilla|34180              AAGAAGTTCATCCGGCACCAGTCAGACCGATATGTCAAAATTAAG---------------
Oryctolagus_cuniculus|16684        AAGAAGTTCATCCGCCACCAGTCGGACCGCTATGTCAAGATTAAG---------------
Oryctolagus_cuniculus|23725        AAGAAGTTCATCCGCCACCAGTCGGACCGCTATGTCAAGATTAAG---------------
Oryctolagus_cuniculus|12109        AAGAAGTTCATCTGCCACCAGTCGGACCGCTATGTCAAGATTAAG---------------
Rattus_norvegicus|27675            AAGAAGTTCATCAGGCACCAGTCGGACCGATATGTGAAAATTAAG---------------
Oryctolagus_cuniculus|8085         AAGAAGTTCATCCGCCACCAGTCGGACCGCTATGTCAAGATTAAG---------------
Callithrix_jacchus|53661           AAGAAGTTCATCCGGCACCAGTCAGACCGATATGTCAAAATTAAG---------------
Callithrix_jacchus|61              AAGAAGTTCATCCGGCACCAGTCAGACCAATATGTCAAAATTAAG---------------
Tupaia_belangeri|8914              AAGAAGTTCATCCGGCACCAGTCAGACCGATATGTCAAGATTAAG---------------
Oryctolagus_cuniculus|19675        AAGAAGTTCATCCGCCACCAGTCGGACCGCTATGTCAAGATTAAG---------------
Rattus_norvegicus|23051            AAGAAGTTCATCAGGCACCAGTCGGACCGATATGTGAAAATTAAG---------------
Gorilla_gorilla|22535              AAGAAGTTCATCCGGCACCAGTCAGACCGATATGTCAAAATTAAGGAAGAGTTCGCACTC
Oryctolagus_cuniculus|19025        AAGAAGTTCATCCGCCACCAGTCGGACCGCTATGTCAAGATTAAGGTAGGTGCTTCGGGG
Callithrix_jacchus|54160           AAGAAGTTCATCCGGCACCAGTCAGACCGATATGTCAAAATTAAG---------------
Callithrix_jacchus|16147           AAGAAGTTCATCCGGCACCAGTCAGACCGATATGTCAAAATTAAG---------------
Callithrix_jacchus|53205           AAGAAGTTCATCCGGCACCAGTCAGACCGATATGTCAAAATTAAG---------------
Cavia_porcellus|2420               AAGAAGTTCATCCGTCACCAGTCAGACCGATATGTCAAAATTAAG---------------
Dipodomys_ordii|15216              AAGAAGTTCATCCGCCACCAGTCTGACCGATATGTCAAGATTAAG---------------
Homo_sapiens|60828                 AAGAAGTTCATCCGGCACCAGTCAGACCGATATGTCAAAATTAAG---------------
Mus_musculus|36395                 AAGAAGTTCATCAGGCACCAGTCAGACCGATATGTGAAAATTAAG---------------
Oryctolagus_cuniculus|18886        AAGAAGTTCATCCGCCACCAGTCGGACCGCTATGTCAAGATTAAG---------------
Oryctolagus_cuniculus|13503        AAGAAGTTCATCCGCCACCAGTCGGACCGCTATGTCAAGATTAAG---------------
Oryctolagus_cuniculus|1743         AAGAAGTTCATCCGCCACCAGTCGGACCGCTATGTCAAGATTAAG---------------
Pan_troglodytes|25696              AAGAAGTTCATCCGGCACCAGTCAGACCGATATGTCAAAATTAAG---------------
Rattus_norvegicus|25888            AAGAAGTTCATCAGGCACCAGTCGGACCGATATGTGAAAATTAAG---------------
Rattus_norvegicus|30773            AAGAAGTTCATCAGGCACCAGTCGGACCGATATGTGAAAATTAAG---------------
Tupaia_belangeri|12862             AAGAAGTTCATCCGGCACCAGTCAGACCGATATGTCAAGATTAAG---------------
                                   .*..* ****:    *.                                           

Spermophilus_tridecemlineatus|6627 ------------------------------------------CAA------AAGAAACCC
Tupaia_belangeri|12728             ------------------------------------------TGCAACTGGCAGAAATCC
Rattus_norvegicus|1568             ------------------------------------------AGAAGGTGG---AAACCC
Tupaia_belangeri|2078              ------------------------------------------AGCAACTGGCAGAAACCC
Tupaia_belangeri|10941             ------------------------------------------CACAACTGGCAGAAACCT
Oryctolagus_cuniculus|2911         ------------------------------------------CGTAACTGGCGGAAACCC
Cavia_porcellus|20874              ------------------------------------------CGCAACTGGCAGAAACCT
Rattus_norvegicus|5326             ------------------------------------------CGAAACTGGCGGAAACCC
Rattus_norvegicus|33429            ------------------------------------------CGAAAATGGTGGAAACCC
Rattus_norvegicus|20058            ------------------------------------------------------AAACCC
Rattus_norvegicus|34427            ------------------------------------------GGAAACTGGCAGAAACCC
Callithrix_jacchus|51434           ------------------------------------------CGTAACTGGCGGAAACCC
Callithrix_jacchus|54095           ------------------------------------------CATAACTGGCGGAAACCT
Oryctolagus_cuniculus|4898         ------------------------------------------GCTAACTGGTGGAAACCC
Rattus_norvegicus|37258            ------------------------------------------CGAAACTGGCGGAAACCC
Mus_musculus|46156                 ------------------------------------------CAAAACTGGTGGAAACCC
Mus_musculus|26318                 ------------------------------------------TGGAACTGGAGGAAACCC
Callithrix_jacchus|53142           ------------------------------------------TGTAACTGGCGGAAACCT
Pan_troglodytes|33711              ------------------------------------------CGTAACTGCCGGAAACCC
Oryctolagus_cuniculus|23321        ------------------------------------------CGTAACCGGCAGAAACCC
Callithrix_jacchus|54074           ------------------------------------------CGTAACTGGCAGAAACCC
Callithrix_jacchus|53483           ------------------------------------------CGTAACTGGCGGAAACCC
Gorilla_gorilla|34180              ------------------------------------------TGTAACTGGCGGAAACCC
Oryctolagus_cuniculus|16684        ------------------------------------------CGTAACTGGCGGAAACCC
Oryctolagus_cuniculus|23725        ------------------------------------------CGTAACTGGTGGAAACCC
Oryctolagus_cuniculus|12109        ------------------------------------------CGTAACTGGCGGAAACCC
Rattus_norvegicus|27675            ------------------------------------------CGAAACTGGCGGAAACCC
Oryctolagus_cuniculus|8085         ------------------------------------------CGTAACTGGCGGAAACCC
Callithrix_jacchus|53661           ------------------------------------------CGTAACTGGCGGAAACCC
Callithrix_jacchus|61              ------------------------------------------CGTAACTGGCGGAAACCC
Tupaia_belangeri|8914              ------------------------------------------CGCAACTGGCGGAAACCC
Oryctolagus_cuniculus|19675        ------------------------------------------CGTAACTGGCGGAAACCC
Rattus_norvegicus|23051            ------------------------------------------CGAAACTGGCGGAAACCC
Gorilla_gorilla|22535              TGCACAGACGCTAACCCACCTGTGTATTAT---TTCCTTCAGCGTAACTGGCGGAAACCC
Oryctolagus_cuniculus|19025        TGGACGTGGACACACCCGGCTTACCGCTGTGGTTTCTCGCAGCGTAACTGGCGGAAACCC
Callithrix_jacchus|54160           ------------------------------------------CGTAACTGGCGGAAACCC
Callithrix_jacchus|16147           ------------------------------------------CGTAACTGGCGGAAACCC
Callithrix_jacchus|53205           ------------------------------------------CGTAACTGGCGGAAACCC
Cavia_porcellus|2420               ------------------------------------------CGCAACTGGCGGAAACCT
Dipodomys_ordii|15216              ------------------------------------------CGTAACTGGCGGAAACCC
Homo_sapiens|60828                 ------------------------------------------CGTAACTGGCGGAAACCC
Mus_musculus|36395                 ------------------------------------------CGAAACTGGCGGAAACCC
Oryctolagus_cuniculus|18886        ------------------------------------------CGTAACTGGCGGAAACCC
Oryctolagus_cuniculus|13503        ------------------------------------------CGTAACTGGCGGAAACCC
Oryctolagus_cuniculus|1743         ------------------------------------------CGTAACTGGCGGAAACCC
Pan_troglodytes|25696              ------------------------------------------CGTAACTGGCGGAAACCC
Rattus_norvegicus|25888            ------------------------------------------CGAAACTGGCGGAAACCC
Rattus_norvegicus|30773            ------------------------------------------CGAAACTGGCGGAAACCC
Tupaia_belangeri|12862             ------------------------------------------CGCAACTGGCGGAAACCC
                                                                                         *** * 

Spermophilus_tridecemlineatus|6627 AGAGGCATTGACAACAGCATGAGC---AGATTCAAGGGCCCAATCTTGATGCCTGACATT
Tupaia_belangeri|12728             AGAGGTATTGACAACAGGGTGTGGAGAAGATTCAAGGCCCAGATCATGATGCCCAACAGC
Rattus_norvegicus|1568             AGAGACATCGACAACAGGGTGCAGAGAAGATTCAAGGGCCAGATCCTGATGCCCGACATC
Tupaia_belangeri|2078              AGAAGTATTGACAACAGGGTGTGG---AGACTGAGGGGGCAGAACTTTATGTCCAACACT
Tupaia_belangeri|10941             AAAGGTATTGACAACAGGGTGCGGAGGAGATTCAAGGGCCAGATCTTGATGCCCAACATC
Oryctolagus_cuniculus|2911         AGAGGTATTGACAACAGGGTGCGGAGAAGATTCAAGGGCCAGATCTTGATGCCCAACATT
Cavia_porcellus|20874              AGAGGCATCAACAACAGGGTGTGGAGAAGGTTCAAGGGCCAGATCTGGATGCCCAACATA
Rattus_norvegicus|5326             AGAGGCATCGACAACAGGGTGCAGAGAAGATTCAAGGGGCAAATTCTGATGTCCAAC---
Rattus_norvegicus|33429            AGAGGCATTGAGAACAGGGTGCGGAGAAGATTCAAGGGCCAGATCCTGATGCCCAACATT
Rattus_norvegicus|20058            AGAGGCATTGACAACAGTGTGTGGAGAAGATTCAAGGGCCAGATCCTGATTCCCAACATA
Rattus_norvegicus|34427            AGAGGTATCGACAACAGGGTGCAGAGAAGAGTCAAGGGCCAGATCCTGATGCCCAACATT
Callithrix_jacchus|51434           AGAGGTATTGACAACAGGGTTCGTAGAAGGTTCAAGGGCCAGATCTTAATGCCTAACATT
Callithrix_jacchus|54095           AGAGGTATTGACAACAGGGTTCGTAGAAGGTTCAAGGGCCAGATCTTAATGACTAACATT
Oryctolagus_cuniculus|4898         AGAGGTATTGACAACAGGGTGCGGAGAAGATTCAAGGGCCAGATCTTGATGCCCAGCACT
Rattus_norvegicus|37258            AGAGGCATCAACAACAGGGTGCGGAGAAGATTCAAGGGCCAGATCCTGGTGCCCAACATT
Mus_musculus|46156                 AGAGGCATCTACAACAGGGTTCGGAGAAGGTTCAAGGGCGAGATCCTGATGCCCAACATC
Mus_musculus|26318                 AGAGGCATCGACAACAGGGTGCGGAGAAGGTTCAAGGGCCAGATCCTGATGCCCAACATC
Callithrix_jacchus|53142           AGAGGTATTGACAACAGGGTTCGTAGAAGGTTCAAGGGCGAGATCTTAATCCCTAACTTT
Pan_troglodytes|33711              AGAGGCATTGACAACAGGGTTCGTAGAAGATTCAAGGGCCAGATCTTGATGCCCAACATT
Oryctolagus_cuniculus|23321        AGAGGTATTGACAGCAGGGTGCGGAGAAGATTCAAGGGCCAGATCTTGATGCCCAACACT
Callithrix_jacchus|54074           AGAGGTATTGACAACAGGGTTCGTAGAAGGTTCAAGGGCCAGATCTTAATGCCTAACATT
Callithrix_jacchus|53483           AGAGGTATTGACAACAGGGTTCGTAGAAGGTTCAAGGGCCAGATCTTAATGCCTAACACT
Gorilla_gorilla|34180              AGAGGCATTGACAACAGGGTTCGTAGAAGATTCAAGGGCCAGATCTTGATGCCCAACATT
Oryctolagus_cuniculus|16684        AGAGGTATTGACAACAGGGTGCGGAGAAGATTCAAGGGCCAGATCTTGATGCCCAACATT
Oryctolagus_cuniculus|23725        AGAGGTATTGACAACAGGGTGTGGAGAAGATTCAAGGGCCAGATCTTGATGCCCAACATT
Oryctolagus_cuniculus|12109        AGAGGTATTGACAACAGGGTGCGGAGAAGATTCAAGGGCCAGATCTTGATGCCCAACATT
Rattus_norvegicus|27675            AGAGGCATCGACAACAGGGTGCGGAGAAGATTCAAGGGCCAGATCCTGATGCCCAACATT
Oryctolagus_cuniculus|8085         AGAGGCATTGACAACAGGGTGCGGAGAAGATTCAAGGGCCAGATCTTGATGCCCAACATT
Callithrix_jacchus|53661           AGAGGTATTGACAACAGGGTTCGTAGAAGGTTCAAGGGCCAGATCTTAATGCCTAACATT
Callithrix_jacchus|61              AGAGGTATTGACAACAGGGTTCGTAGAAGGTTCAAGGGCCAGATCTTAATGCCTAACATT
Tupaia_belangeri|8914              AGAGGGATTGACAACAGGGTGCGGAGGAGGTTCAAGGGCCAGATCCTGATGCCCAACATC
Oryctolagus_cuniculus|19675        AGAGGTATTGACAACAGGGTGCGGAGAAGATTCAAGGGCCAGATCTTGATGCCCAACACT
Rattus_norvegicus|23051            AGAGGCATCGACAACAGGGTGAGGAGAAGATTCAAGGGCCAGATCCTGATGCCCAACATT
Gorilla_gorilla|22535              AGAGGCATTGACAACAGGGTTCGTAGAAGATTCAAGGGCCAGATCTTGATGCCCAACATT
Oryctolagus_cuniculus|19025        AGAGGTATTGACAACAGGGTGCGGAGAAGATTCAAGGGCCAGATCTTGATGCCCAACATT
Callithrix_jacchus|54160           AGAGGTATTGACAACAGGGTTCGTAGAAGGTTCAAGGGCCAGATCTTAATGCCTAACATT
Callithrix_jacchus|16147           AGAGGTATTGACAACAGGGTTCGTAGAAGGTTCAAGGGCCAGATCTTAATGCCTAACATT
Callithrix_jacchus|53205           AGAGGTATTGACAACAGGGTTCGTAGAAGGTTCAAGGGCCAGATCTTAATGCCTAACATT
Cavia_porcellus|2420               AGAGGCATCGACAACAGGGTGCGGAGAAGGTTCAAGGGCCAGATCTTGATGCCCAACATA
Dipodomys_ordii|15216              AGGGGCATTGACAACAGGGTGCGGAGGAGATTTAAGGGCCAGATCTTGATGCCCAACATT
Homo_sapiens|60828                 AGAGGCATTGACAACAGGGTTCGTAGAAGATTCAAGGGCCAGATCTTGATGCCCAACATT
Mus_musculus|36395                 AGAGGCATTGACAACAGGGTGCGGAGAAGGTTCAAGGGCCAGATCCTGATGCCCAACATC
Oryctolagus_cuniculus|18886        AGAGGCATTGACAACAGGGTGCGGAGAAGATTCAAGGGCCAGATCTTGATGCCCAACATT
Oryctolagus_cuniculus|13503        AGAGGTATTGACAACAGGGTGCGGAGAAGATTCAAGGGCCAGATCTTGATGCCCAACATT
Oryctolagus_cuniculus|1743         AGAGGCATTGACAACAGGGTGCGGAGAAGATTCAAGGGCCAGATCTTGATGCCCAACATT
Pan_troglodytes|25696              AGAGGCATTGACAACAGGGTTCGTAGAAGATTCAAGGGCCAGATCTTGATGCCCAACATT
Rattus_norvegicus|25888            AGAGGCATCGACAACAGGGTGCGGAGAAGATTCAAGGGCCAGATCCTGATGCCCAACATT
Rattus_norvegicus|30773            AGAGGCATCGACAACAGGGTGCGGAGAAGATTCAAGGGCCAGATCCTGATGCCCAACATT
Tupaia_belangeri|12862             AGAGGGATTGACAACAGGGTGCGGAGGAGGTTCAAGGGCCAGATCCTGATGCCCAACATC
                                   *.... **  * *.*** .*  .    **. * *.**   ..*:    .*  * ..*   

Spermophilus_tridecemlineatus|6627 GTTTATGGC---AATAAGAGAATAGTGCACATGTTGCCTGGTAGCTTTCAG------AAT
Tupaia_belangeri|12728             GGTTATGGGAGCAACAAGAAAACAAAGGACATGCTTCCTAGTGGCTTCTGG------AAA
Rattus_norvegicus|1568             AGTTACAAGGGTAATGAGAAAACCAAGCACATGTTGCCTAGTGGCTTCTGG------AAG
Tupaia_belangeri|2078              GGTTATGGGAGCAACAAGAAA---AAGCACATACTGCCCAGCGGCTTCTGG------AAG
Tupaia_belangeri|10941             AGTTATGGGAGCAACAAGAAAACAATACACATGCTGCTCAGCGGCTTCCAG------AAA
Oryctolagus_cuniculus|2911         GGCTACGGGAGCAACAAGAAGACCAAGCACATGCTGCCCAGCGGCTTCCGG------AAG
Cavia_porcellus|20874              GATTATGGAAGCAACAAAAAGATGAAGCACATGATACCCAGTGGCTTCCAG------AAG
Rattus_norvegicus|5326             GGTTATGGGAGTAACAAAAAAACCAAGCACATGTTGCCAGCGGCTTCTGGA------AGT
Rattus_norvegicus|33429            GGTGACGGGAGTAACAAGAAAACCAAGCACGTGCTGCCTAGCGGCTTCCGG------GAG
Rattus_norvegicus|20058            GGTTATGGGAGCAAAAAGAAAACCAAGCCCATGCTGAGCAGC---TTCTGG------AAG
Rattus_norvegicus|34427            GGTGACGGGAGTAAC------ACCAAGCACGTGTTGCCTAGCGGCTTCCGG------AAG
Callithrix_jacchus|51434           GGTTATGGGAGCAATAAGAAAACAAAGCACATGCTGCCCAGTGGCTTCCAAAATGCCAAG
Callithrix_jacchus|54095           GGTTATGGGAGCAATAAGAAAACAAAGTACATGCTGCCCAGTAGCTTCCGG------AAG
Oryctolagus_cuniculus|4898         GGCTACGGTAGCAACAAGAAGACCAAGCACATGCTGCCCAGCGGCTTCCGG------AAG
Rattus_norvegicus|37258            GGTTACGGGAATAACAAGAAAACCAAGCACATGCTGCCTAGCTGCTTCCGA------AAG
Mus_musculus|46156                 AGTTACAGGAGCAACAAGAAAACCAAGCACATGCTGCCCAGCAGCTTCTGC------AAG
Mus_musculus|26318                 GGTTACAGGAGCAACAAGAAAACCAAGCACACGCTGTCTAGTGGCTTCCGC------AAG
Callithrix_jacchus|53142           GGTTATGGGAGCAATAAGAAAACAAAGCACATGCTGCCCAGTGGCTTCCGG------AAG
Pan_troglodytes|33711              GGTTATGGGAGCAACAAAAAAACAAAGCACATGCTGCCCAGTGGCTGCCGG------AAG
Oryctolagus_cuniculus|23321        GGCTACGGGAGCAACAAGAAGACCAAGCACATGCTGCCCAGCGGCTTCCGG------AAG
Callithrix_jacchus|54074           GGTTATGGGAGCAATAAGAAAACAAAACACATGCTGCCCAGTGGCTTCCGG------AAG
Callithrix_jacchus|53483           GGTTATGGGAGCAATAAGAAAACAAAGCACATGCTGCCCAATGGCTTCCGG------AAG
Gorilla_gorilla|34180              GGTTATGGGAGCAACAAAAAAACAAAGCACATGCTGCCCAGTGGCTTCCGG------AAG
Oryctolagus_cuniculus|16684        GGCTATGGGAGCAACAAGAAGACCAGGCACATGCTGCCCAGCGGCTTCCGG------AAG
Oryctolagus_cuniculus|23725        GGCTATGGGAGCAACAAGAAGACCAAGCACATGCTGCCCAGCGGCTTCCGG------AAG
Oryctolagus_cuniculus|12109        GGCTACGGGAGCAACAAGAAGACCAAACACATGCTGCCCAGCGGCTTCCAC------AAG
Rattus_norvegicus|27675            GGTTACGGGAGTAACAAGAAAACCAAGCACATGCTGCCTAGCGGCTTCCGG------AAG
Oryctolagus_cuniculus|8085         GGCTACGGGAGCAACAAGAAGACCAAGCACATGCTGCCCAGCGGCTTCCGG------AAG
Callithrix_jacchus|53661           GGTTATGGGAGCAATAAGAAGACAAAGCACATGCTGCCCAGTGGCTTCCGG------AAG
Callithrix_jacchus|61              GGTTATGGGAGCAATAAGAAGACAAAGCACATGCTGCCCAGTGGCTTCCGG------AAG
Tupaia_belangeri|8914              GGTTATGGCAGCAACAAGAAAACGAAGCACATGCTGCCCAGCGGCTTCTGG------AAG
Oryctolagus_cuniculus|19675        GGCTACGGGAGCAACAAGAAGACCAAGCACATGCTGCCCAGCGGCTTCCGG------AAG
Rattus_norvegicus|23051            GGTTACGGGAGTAACAAGAAAACCAAGCACATGCTGCCTAGCGGCTTCCGG------AAG
Gorilla_gorilla|22535              GGTTATGGAAGCAACAAAAAAACAAAGCACATGCTGCCTAGTGGCTTCCGG------AAG
Oryctolagus_cuniculus|19025        GGCTACGGGAGCAACAAGAAGACCAAGCACATGCTGCCCAGCGGCTTCCGG------AAG
Callithrix_jacchus|54160           GGTTATGGGAGCAATAAGAAGACAAAGCACATGCTGCCCAGTGGCTTCCGG------AAG
Callithrix_jacchus|16147           GGTTATGGGAGCAATAAGAAGACAAAGCACATGCTGCCCAGTGGCTTCCGG------AAG
Callithrix_jacchus|53205           GGTTATGGGAGCAATAAGAAGACAAAGCACATGCTGCCCAGTGGCTTCCGG------AAG
Cavia_porcellus|2420               GGTTATGGAAGCAACAAAAAGACGAAGCACATGCTGCCCAGTGGCTTCCGG------AAG
Dipodomys_ordii|15216              GGTTATGGGAGCAACAAGAAAACAAAGCACATGCTGCCCAGTGGATTCCGG------AAG
Homo_sapiens|60828                 GGTTATGGAAGCAACAAAAAAACAAAGCACATGCTGCCCAGTGGCTTCCGG------AAG
Mus_musculus|36395                 GGTTATGGGAGCAACAAGAAAACCAAGCACATGCTGCCCAGCGGCTTCCGC------AAG
Oryctolagus_cuniculus|18886        GGCTACGGGAGCAACAAGAAGACCAAGCACATGCTGCCCAGCGGCTTCCGG------AAG
Oryctolagus_cuniculus|13503        GGCTACGGGAGCAACAAGAAGACCAAGCACATGCTGCCCAGCGGCTTCCGG------AAG
Oryctolagus_cuniculus|1743         GGCTACGGGAGCAACAAGAAGACCAAGCACATGCTGCCCAGCGGCTTCCGG------AAG
Pan_troglodytes|25696              GGTTATGGAAGCAACAAAAAAACAAAGCACATGCTGCCCAGTGGCTTCCGG------AAG
Rattus_norvegicus|25888            GGTTACGGGAGTAACAAGAAAACCAAGCACATGCTGCCTAGCGGCTTCCGG------AAG
Rattus_norvegicus|30773            GGTTACGGGAGTAACAAGAAAACCAAGCACATGCTGCCTAGCGGCTTCCGG------AAG
Tupaia_belangeri|12862             GGCTACGGCAGCAACAAGAAAACGAAGCACATGCTGCCCAGCGGCTTCCGG------AAG
                                   .   * ..    **          . . .*. . *    .     *   .       .. 

Spermophilus_tridecemlineatus|6627 TTCCTTATCTCTAAT------GTTGAGCTG---AAAGTGCTGCAAGCATGCAAC---TCT
Tupaia_belangeri|12728             TTTCTGGTCCACAAC---GTCAAGGAGATG---GAAGCGTTGCTCATGTGCAGTAAGTCT
Rattus_norvegicus|1568             TTTCTGGTCCACAAT---GTCGAGGAGCTG---GAAGTGCTACTGATATGGAACAAATCC
Tupaia_belangeri|2078              TTCCTGGTCCACAAT---GTCAAGGAACTG---GAAGTGCTGCTGATGTGCAGTAAGTCT
Tupaia_belangeri|10941             TACCTAGTCCACAAT---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAATAAATCT
Oryctolagus_cuniculus|2911         TTCCTGGTCCACAGC---TTCAAAGAGCTC---GAGCTGCATACGCTGTGCAACATATCC
Cavia_porcellus|20874              TTCCAGGTGCACAGG---------------------------AGGATATGCAACAAATCT
Rattus_norvegicus|5326             TTCCGGTCCCACAGC---GTAAGGGAGCTG---GATGTGCAGCTGATGTGCAAC---TCC
Rattus_norvegicus|33429            TTTCTGGCCCACAAT---GTCAAGGAGCTG---GAAGTGCAGCTGATGTGCAACAAATCT
Rattus_norvegicus|20058            TTTCTGGTCCACAAT---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAACAAATCT
Rattus_norvegicus|34427            TTTCTGGCCCACAAT---GTCAAGGAGCTG---GAAGTGCAGCTGATGTGCAACAAATCT
Callithrix_jacchus|51434           TTCCTGGTCCACAAT---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAACAAATCT
Callithrix_jacchus|54095           TTCCTGGTCCACAAC---TTCAAGGAGCTG---GAAGTGCTGCTGGTGTGTAACAAATCT
Oryctolagus_cuniculus|4898         TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAGATGCTGCTGATGTGCAACAAATCC
Rattus_norvegicus|37258            TTTCTGGTCCACAAT---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAGCAAATCT
Mus_musculus|46156                 TTCCTGGTCCACGAT---GTCAAGGAGCTG---GAAGTGCTGCTCATGTGTAACAAATCT
Mus_musculus|26318                 TTCCTGGTCCACAAT---ATCAAGGAGCCG---GAGGTGCTGTTGATGTGCAACAAATCT
Callithrix_jacchus|53142           TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAACAAACCT
Pan_troglodytes|33711              TTCCTGGTCCACAAC---ATCAAGGAGCTG---GAAGTGCTGCTGATGTGCAACAAATCT
Oryctolagus_cuniculus|23321        TTCCTGGTCCACAACGTCGTCAAGGAGCTGGAGGAGGTGCTGCTGATGTGCAACAAATCC
Callithrix_jacchus|54074           TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAACAAATCT
Callithrix_jacchus|53483           TTCCTGGTCCACAAA---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAACAAATCT
Gorilla_gorilla|34180              TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAAGTGCTACTGATGTGCAACAAATCT
Oryctolagus_cuniculus|16684        TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAGGTGCTGCTGATGTGCAACAAATCC
Oryctolagus_cuniculus|23725        TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAGGTGCTGCTGATGTGCAACAAATCC
Oryctolagus_cuniculus|12109        TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAGGTGCTGCTGATGTGCAACAAATCC
Rattus_norvegicus|27675            TTTCTGGTCCACGAT---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAACAAATCT
Oryctolagus_cuniculus|8085         TTCCTG------------GTCCAGGAACTG---GAGGTGCTGCTGATGTGCAACAAATCC
Callithrix_jacchus|53661           TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAAGTGCTGCCGATGTGCAACAAATCT
Callithrix_jacchus|61              TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAACAAATCT
Tupaia_belangeri|8914              TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAATAAGTCC
Oryctolagus_cuniculus|19675        TTCCTGGTCCACAAC---GTCAAGGAGCTGGAGGAGGTGCTGCTGATGTGCAACAAATCC
Rattus_norvegicus|23051            TTTCTGGTCCACAAT---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAACAAATCT
Gorilla_gorilla|22535              TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAACAAATCT
Oryctolagus_cuniculus|19025        TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAGGTGCTGCTGATGTGCAACAAATCC
Callithrix_jacchus|54160           TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAACAAATCT
Callithrix_jacchus|16147           TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAACAAATCT
Callithrix_jacchus|53205           TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAACAAATCT
Cavia_porcellus|2420               TTCCTGGTGCACAAT---GTTAAGGAGCTG---GAGGTGCTGCTGATGTGCAACAAATCT
Dipodomys_ordii|15216              TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAAGTGCTGCTCATGTGCAACAAGTCT
Homo_sapiens|60828                 TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAACAAATCT
Mus_musculus|36395                 TTCCTGGTCCACAAT---GTCAAGGAGCTG---GAGGTGCTGCTGATGTGCAACAAATCT
Oryctolagus_cuniculus|18886        TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAGGTGCTGCTGATGTGCAACAAATCC
Oryctolagus_cuniculus|13503        TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAGGTGCTGCTGATGTGCAACAAATCC
Oryctolagus_cuniculus|1743         TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAGGTGCTGCTGATGTGCAACAAATCC
Pan_troglodytes|25696              TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAACAAATCT
Rattus_norvegicus|25888            TTTCTGGTCCACAAT---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAACAAATCT
Rattus_norvegicus|30773            TTTCTGGTCCACAAT---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAACAAATCT
Tupaia_belangeri|12862             TTCCTGGTCCACAAC---GTCAAGGAGCTG---GAAGTGCTGCTGATGTGCAATAAGTCC
                                   *: *                                           .** *.     * 

Spermophilus_tridecemlineatus|6627 TTTTTTGCTGAGATTGCC------------------CACAAC---GTTTCCTCCAAGAAC
Tupaia_belangeri|12728             TACTATGCTGAGATTGCT------------------CAC------GTTTCCTCCAAGTGC
Rattus_norvegicus|1568             TACTGTGCTGAGATTGCT------------------CACAGT---GTGTCCTCTAAGAAC
Tupaia_belangeri|2078              TACTGTGCTGAGATCGCC------------------CACAAC---GTTTCCTCCAAGAAC
Tupaia_belangeri|10941             TACTATGCTGAGATCACC------------------CACAAC---CCCTCCTCCAAAAAC
Oryctolagus_cuniculus|2911         TACTTTCAAAAGATTGTT------------------CACAATCGTTTTCCTCCAAGAACC
Cavia_porcellus|20874              TACTGTGCAGAGATTGCT------------------CACAGT---GTCTCCTCCAAGAAC
Rattus_norvegicus|5326             TACTGTGCTGAGATTGCT------------------CACAGT---GTGACCTCTAAGAAC
Rattus_norvegicus|33429            TACTGTGCTGAGATTGCT------------------CACAGT---GTGTCCTCTAAGAAC
Rattus_norvegicus|20058            TACTGTGCTGAGATTGCT------------------CCCAAT---GTATCCTTTGAGAAT
Rattus_norvegicus|34427            TACAGTGCTGAGATTGCT------------------CACAAT---GTGTCCTCTAAGAAC
Callithrix_jacchus|51434           TACTGTGCTGAGATCGCT------------------CACAAT---GTTTCCTCCAAGAAC
Callithrix_jacchus|54095           TACTGCACTGAGATCGCT------------------CACAAT---GTTTCCTCCAAGAAC
Oryctolagus_cuniculus|4898         TACTGTGAAGAGATTGCT------------------CACAAT---GTCTCCTCCAAGAAC
Rattus_norvegicus|37258            TACTGTGCTGAGATTGCT------------------CACAAT---GTGTCCTCTAAGAAC
Mus_musculus|46156                 TACTGTGCTGAGATTGCT------------------CACAAT---GTGTCCTCTAAGAAC
Mus_musculus|26318                 TACCGTGCTGAGATTGCT------------------CACAAC---GTGTCCTCTAAGAAC
Callithrix_jacchus|53142           TACTGTGCTGAGATCGCT------------------CACAAT---GTTTCCTCCAAGAAC
Pan_troglodytes|33711              TACTGTGCCGAGATCGCT------------------CACAAT---GTTTCCTCCAAGAAC
Oryctolagus_cuniculus|23321        TGCTGTGCAGAGATTGCT------------------CACAAC---GTCTCCTCCAAGAAC
Callithrix_jacchus|54074           TACTGTGCTGAGATCGCT------------------CACAAT---GTTTCCTCCAAGAAC
Callithrix_jacchus|53483           TACTGTGCTGAGATCACT------------------CACAAT---GTTTCCTCCAAGAAC
Gorilla_gorilla|34180              CACTGTGCCGCGATCGCT------------------CACAAT---GTTTCCTCCAAGAAC
Oryctolagus_cuniculus|16684        TACTGTGCAGAGATTGCT------------------CACAAC---GTCTCCTCCAAGAAC
Oryctolagus_cuniculus|23725        TACTGTGCAGAGATTGCT------------------CACAAC---GTCTCCTCCAAGAAC
Oryctolagus_cuniculus|12109        TACTGTGCAGAGATTGCT------------------CACAAC---GTCTCCTCCAAGAAC
Rattus_norvegicus|27675            TACTGTGCTGAGATTGCT------------------CACAAT---GTGTCCTCTAAGAAC
Oryctolagus_cuniculus|8085         TACTGTGCAGAGATTGCT------------------CACAAT---GTCTCCTCCAAGAAT
Callithrix_jacchus|53661           TACTGTGCTGAGATCGCT------------------CACAAT---GTTTCCTCTAAGAAC
Callithrix_jacchus|61              TACTGTGCTGAGATCGCT------------------CACAAT---GTTTCCTCCAAGAAC
Tupaia_belangeri|8914              TACTGTGCTGAGATCGCC------------------CACAAC---GTCTCCTCCAAGAAC
Oryctolagus_cuniculus|19675        TACTGTGCAGAGATTGCT------------------CACAAC---GTCTCCTCCAAGAAC
Rattus_norvegicus|23051            TACTGTGCTGAGATTGTATTGTGTGCTTACATTGCTCACAAT---GTGTCCTCTAAGAAC
Gorilla_gorilla|22535              TACTGTGCCGAGATCGCT------------------CACAAT---GTTTCCTCCAAGAAC
Oryctolagus_cuniculus|19025        TACTGTGCAGAGATTGCT------------------CACAAC---GTCTCCTCCAAGAAC
Callithrix_jacchus|54160           TACTGTGCTGAGATCGCT------------------CACAAT---GTTTCCTCCAAGAAC
Callithrix_jacchus|16147           TACTGTGCTGAGATCGCT------------------CACAAT---GTTTCCTCCAAGAAC
Callithrix_jacchus|53205           TACTGTGCTGAGATCGCT------------------CACAAT---GTTTCCTCCAAGAAC
Cavia_porcellus|2420               TACTGTGCAGAGATTGCT------------------CACAAT---GTCTCCTCCAAGAAC
Dipodomys_ordii|15216              TACTGCGCCGAGATCGCC------------------CACAAT---GTTTCCTCCAAGAAC
Homo_sapiens|60828                 TACTGTGCCGAGATCGCT------------------CACAAT---GTTTCCTCCAAGAAC
Mus_musculus|36395                 TACTGTGCTGAGATTGCT------------------CACAAT---GTGTCCTCTAAGAAC
Oryctolagus_cuniculus|18886        TACTGTGCAGAGATTGCT------------------CACAAC---GTCTCCTCCAAGAAC
Oryctolagus_cuniculus|13503        TACTGTGCAGAGATTGCT------------------CACAAC---GTCTCCTCCAAGAAC
Oryctolagus_cuniculus|1743         TACTGTGCAGAGATTGCT------------------CACAAC---GTCTCCTCCAAGAAC
Pan_troglodytes|25696              TACTGTGCCGAGATCGCT------------------CACAAT---GTTTCCTCCAAGAAC
Rattus_norvegicus|25888            TACTGTGCTGAGATTGCT------------------CAC---------------------
Rattus_norvegicus|30773            TACTGTGCTGAGATTGCT------------------CACAAT---GTGTCCTCTAAGAAC
Tupaia_belangeri|12862             TACTGTGCTGAGATCGCC------------------CACAAC---GTCTCCTCCAAGAAC
                                          . ..*** .                    *.*                     

Spermophilus_tridecemlineatus|6627 CGCAAAGCCATCGTGGAGAGA---GCAGCCCAGCTGGCCATCAGAGTCACCAACCCCAAC
Tupaia_belangeri|12728             AAGGGCATCGAAATA---------TCAGCCCATTTG------------------------
Rattus_norvegicus|1568             CGAAAAGCCATCATAGAAAGAGCAGCAGCACAGCTGGCCATCAGAGTCACCAATCCCAAG
Tupaia_belangeri|2078              CACAAGGCCATTGTGGGAAGA---GCTGCCCAGCTGGCCCTC---GTCACCAATCCCAAT
Tupaia_belangeri|10941             TGCAAGGCCATCATGGGATGG---ACAGTCCAGCTGGCCATCAGAGTCACCAATTCCAAC
Oryctolagus_cuniculus|2911         GCAAATCCATTGTGGAGAGAG---TGGTTCCAGCTGGCCATCAGGGTCACCAACCCCAAC
Cavia_porcellus|20874              GGCAAGGCCATTGTGGAACGA---GCAGCCCAGCTAGCCATCCGA---------CCCAAT
Rattus_norvegicus|5326             CGAAAAGCCATCGTAGAAAGA---GCAGCACAGCTGGCCATCAGAGTCACCAATCCCAAC
Rattus_norvegicus|33429            CGAAAAGCCACTGTAGCAAGA---GCAGCACAGCTGGCCATCAGAGTCACCAATCCCAAA
Rattus_norvegicus|20058            GGAAAAACCATCAGAGAAAGA---GCAGCACAGCTGGCCATCAGAATTACCAATCCCAAT
Rattus_norvegicus|34427            CGAAAAGCCATCGTAGAAAGA---GCAGCA---CTGGCCATCAGAGTCACCAATTCCAAC
Callithrix_jacchus|51434           CGCAAAGCCATCGTGGAAAGA---GCTGCCCAGCTGGCCATCAGAGTCACCAAGCCCAAT
Callithrix_jacchus|54095           CGCAAAGCCATCGTGGAAAGA---GCTGCCCAGCTGGCCATCAAAGTCACCAACTCCAAT
Oryctolagus_cuniculus|4898         CACAAGGCCATTGTGGAGAGA---GCGGCCCAGCTGGCCATCAGGGTCACCAACCCCAAC
Rattus_norvegicus|37258            CGAAAAGCCATCTTAGAAAGA---GCAGCACAGCTGGCCATCAGAGTCACCAATCCCAAC
Mus_musculus|46156                 CGAGAAGCCATTGTAGAAAGA---GCAGCACAGCTGGCTATCAGAGTCTCCAATCCCAAC
Mus_musculus|26318                 CGAAAAGCCATTGTAGAAAGA---GCAGCACAGCTGGCCATCAGAGTCACCAATCCCAAC
Callithrix_jacchus|53142           CGCAAAGCCATCGTGGAAAGA---GCTGCCCAGCTGGCCATCAGAGCCACCAACCCCAAT
Pan_troglodytes|33711              CGCAAAGCCATCGTGGAAACA---GCTGCCCAACTGGCCATCAGAGTCACCAACCCCAAT
Oryctolagus_cuniculus|23321        CACAAAGCCATTGTGGAGAGA---GCGGCCCAGCTGGCCATCAGGGTCACCAACCCCAAC
Callithrix_jacchus|54074           CGCAGAGCCATCGTGGAAAGA---GCTGCCCAGCTGGCCATCAGAGCCACCAACCCCAAT
Callithrix_jacchus|53483           CGCAAAGCCATCGTGGAAAGA---GCTGCCCAGCTGGCCATCAGAGTCACCAACCCCAAT
Gorilla_gorilla|34180              CGCAAAGCCATAGTGGAAAGA---GCTGCCCAACTGGCCATCAGAGTCACCAACCCCAAT
Oryctolagus_cuniculus|16684        TGCAAAGCCATTGTGGAGAGA---GCGGCCCAGCTGGCCATCAGGGTCACCAACCCCAAC
Oryctolagus_cuniculus|23725        CGCAAAGCCATTGTGGAGAGA---GCGGCCCAGCTGGCCATCAGGGTCACCAACCCCAAC
Oryctolagus_cuniculus|12109        CGCAAAGCCATTGTGGAGAGA---GCGGCCCAGCTGGCCATCAGGGTCACCAACCCCAAC
Rattus_norvegicus|27675            CGAAAAGCCATC---------------------------ATCAGAGTCACTAATCCCAAC
Oryctolagus_cuniculus|8085         CGCAAAGCCATTGTGGAGAGA---GCGGCCCAGCTGGCCATCAGGGTCACCAACCCCAAC
Callithrix_jacchus|53661           CGCAAAGCCATCGTGGAAAGA---GCTGCCCAGCTGGCCATCAGAGTCACCAACCCCAAT
Callithrix_jacchus|61              CGCAAAGCCATCGTGGAAAGA---GCTGCCCAGCTGGCCATCAGAGTCACCAACCCCAAT
Tupaia_belangeri|8914              CGCAAGGCCATCGTGGAACGG---GCAGCCCAGCTGGCCATCAGAGTCACCAATCCCAAC
Oryctolagus_cuniculus|19675        CGCAAAGCCATTGTGGAGAGA---GCGGCCCAGCTGGCCATCAGGGTCACCAATCCCAAC
Rattus_norvegicus|23051            CGAAAAGCCATCGTAGAAAGA---GCAGCACAGCTGGCCATCAGAGTCACCAATCCCAAC
Gorilla_gorilla|22535              CGCAAAGCCATTGTGGAAAGA---GCTGCCCAACTGGCCATCAGAGTCACCAACCCCAAT
Oryctolagus_cuniculus|19025        CGCAAAGCCATTGTGGAGAGA---GCGGCCCAGCTGGCCATCAGGGTCACCAACCCCAAC
Callithrix_jacchus|54160           CGCAAAGCCATCGTGGAAAGA---GCTGCCCAGCTGGCCATCAGAGTCACCAACCCCAAT
Callithrix_jacchus|16147           CGCAAAGCCATCGTGGAAAGA---GCTGCCCAGCTGGCCATCAGAGTCACCAACCCCAAT
Callithrix_jacchus|53205           CGTAAAGCCATCGTGGAAAGA---GCTGCCCAGCTGGCCATCAGAGTCACCAACCCCAAT
Cavia_porcellus|2420               CGCAAGGCCATTGTGGAACGA---GCAGCCCAGCTAGCCATCCGAGTCACCAACCCCAAT
Dipodomys_ordii|15216              CGAAAAGCCATCGTGGAACGA---GCAGCCCAGCTGGCCATCAGAGTCACCAATCCCAAC
Homo_sapiens|60828                 CGCAAAGCCATCGTGGAAAGA---GCTGCCCAACTGGCCATCAGAGTCACCAACCCCAAT
Mus_musculus|36395                 CGAAAAGCCATTGTAGAAAGA---GCAGCACAGCTGGCCATCAGAGTCACCAATCCCAAC
Oryctolagus_cuniculus|18886        CGCAAAGCCATTGTGGAGAGA---GCGGCCCAGCTGGCCATCAGGGTCACCAACCCCAAC
Oryctolagus_cuniculus|13503        CGCAAAGCCATTGTGGAGAGA---GCGGCCCAGCTGGCCATCAGGGTCACCAACCCCAAC
Oryctolagus_cuniculus|1743         CGCAAAGCCATTGTGGAGAGA---GCGGCCCAGCTGGCCATCAGGGTCACCAACCCCAAC
Pan_troglodytes|25696              CGCAAAGCCATCGTGGAAAGA---GCTGCCCAACTGGCCATCAGAGTCACCAACCCCAAT
Rattus_norvegicus|25888            ------------------------------------------------------------
Rattus_norvegicus|30773            CGAAAAGCCATCGTAGAAAGA---GCAGCACAGCTGGCCATCAGAGTCACCAATCCCAAC
Tupaia_belangeri|12862             CGCAAGGCCATCGTGGAACGG---GCAGCCCAGCTGGCCATCAGAGTCACCAATCCCAAC
                                                                                               

Spermophilus_tridecemlineatus|6627 GCCAGGCTGCGCAGTGAAGAAAATGAA---TAG
Tupaia_belangeri|12728             ---------------------------------
Rattus_norvegicus|1568             GCCAGGCTACACAGCGGAAAAAAA------TGA
Tupaia_belangeri|2078              GCCAGGCTGCGCAGTGAAGAAAATGAGTGG---
Tupaia_belangeri|10941             GCCAGGCTGTGCAGTGAAGAAAATGAG---TAG
Oryctolagus_cuniculus|2911         GCCAAGCTGCGCAGTGAAGAAAATGAG---TAG
Cavia_porcellus|20874              GCCAGGCTGCACAGTGAAGAAAATGAG------
Rattus_norvegicus|5326             GCCAGGCTACGCAGCGAAAGAATGAAT------
Rattus_norvegicus|33429            GCCAGGCTACGCAGAGAAGAAAATGAA---TAG
Rattus_norvegicus|20058            GCCAGGCTACACAGAGAAGAAAATGTA------
Rattus_norvegicus|34427            GCCAGGCTACACAGCGAAGAAAATGAA---TAG
Callithrix_jacchus|51434           GCCAGGCTGCGCAGTGAAGAAAATGAG---TAG
Callithrix_jacchus|54095           GCCAGGCTGTGCAGCGAAGAAACTGAG---TAG
Oryctolagus_cuniculus|4898         GCCAGGCTGCGCAGTGAAGAAAATGAG---TAG
Rattus_norvegicus|37258            GACAGGCTATGCAGCAAAGAGAATGAA---TAG
Mus_musculus|46156                 GCCAGGCTACGCAGCGAAGAAAATGAA---TAG
Mus_musculus|26318                 ACCAGGCTACACAGCGAAGAAAATGAA---TAG
Callithrix_jacchus|53142           GCCAGGCTGCGCGGCGAAGAAAATGAG---TAG
Pan_troglodytes|33711              GCCAGGCTGTGCAGTGAAGAAAATGAG---TAG
Oryctolagus_cuniculus|23321        GCCAGGCTGCGCAGTGAAGAAAATGAG---TAG
Callithrix_jacchus|54074           GCCAGGCTGTGCAGCGAAGAAAATGAG---TAG
Callithrix_jacchus|53483           GCCAGGCTGTGCAGTGAAGAAAATGAG---TAG
Gorilla_gorilla|34180              GCCAGGCTGCGCAGCGAAGAAAATGAG---TAG
Oryctolagus_cuniculus|16684        GCCAGGCTGCGCAGTGAAGAAAATGAG---TAG
Oryctolagus_cuniculus|23725        GCCAGGCTGTGCAGTGAAGAAAATGAG---TAG
Oryctolagus_cuniculus|12109        GCCAGGCTGCGCAGTGAAGAAAATGAG---TAG
Rattus_norvegicus|27675            GCCAGGCTACGCAGCGAAGAGAATGAA---TAG
Oryctolagus_cuniculus|8085         GCCAGGCTGCGCAGTGAAGAAAATGAG---TAG
Callithrix_jacchus|53661           GCCAGGCTGCGCAGCGAAGAAAATGAA---TAG
Callithrix_jacchus|61              GCCAGGCTGCGCAGTGAAGAAAATGAA---TAG
Tupaia_belangeri|8914              GCCAGGCTGCGCAGTGAAGAAAACGAG---TAG
Oryctolagus_cuniculus|19675        GCCAGGCTGCGCAGTGAAGAAAATGAG---TAG
Rattus_norvegicus|23051            GCCAGGCTACGCAGCAAAGAGAATGAA---TAG
Gorilla_gorilla|22535              GCCAGGCTGCGCAGTGAAGAAAATGAG---TAG
Oryctolagus_cuniculus|19025        GCCAGGCTGCGCAGTGAAGAAAATGAG------
Callithrix_jacchus|54160           GCCAGGCTGCGCAGTGAAGAAAATGAA---TAG
Callithrix_jacchus|16147           GCCAGGCTGCGCAGTGAAGAAAATGAA---TAG
Callithrix_jacchus|53205           GCCAGGCTGCGCAGTGAAGAAAATGAA---TAG
Cavia_porcellus|2420               GCCAGGCTGCGCAGCGAAGAAAACGAG---TAG
Dipodomys_ordii|15216              GCCAGGCTGCGCAGTGAAGAAAACGAG---TAG
Homo_sapiens|60828                 GCCAGGCTGCGCAGTGAAGAAAATGAG---TAG
Mus_musculus|36395                 GCCAGGCTACGCAGCGAAGAAAATGAG---TAG
Oryctolagus_cuniculus|18886        GCCAGGCTGCGCAGTGAAGAAAATGAG---TAG
Oryctolagus_cuniculus|13503        GCCAGGCTGCGGAGTGAAGAAAATGAG---TAG
Oryctolagus_cuniculus|1743         GCCAGGCTGCGCAGTGAAGAAAATGAG---TAG
Pan_troglodytes|25696              GCCAGGCTGCGCAGTGAAGAAAATGAG---TAG
Rattus_norvegicus|25888            ---------------------------------
Rattus_norvegicus|30773            GCCAGGCTACGCAGCGAAGAGAATGAA---TAG
Tupaia_belangeri|12862             GCCAGGCTGCGCAGTGAAGAAAACGAG---TAG
                                                                    

multiple sequence alignment in CLUSTALW format


Spermophilus_tridecemlineatus|5937 ----KP-VKPQITKN-----ENFIQPESD-YAKIS-------------------Q--KKP
Tupaia_belangeri|11040             MAALTPVV-PKILKKRT---EKFIWHWSYRYVKIK-------------------CNWQKS
Rattus_norvegicus|26916            MAALWSLVKPKIVK-RT---KKFIRHPSDQYV----------------------RRW-KP
Tupaia_belangeri|1813              MAAFRPLVKPKIIQ-RT---KKFIRHQSDQYLKTK-------------------SNWQKP
Tupaia_belangeri|9484              MAAFRSLVKPKIIKKRT---KKFIPHQSDQYAKIK-------------------HNWQKP
Oryctolagus_cuniculus|13028        MASLRPLVKPKIIKKWT---KKFIRHQSDRYVKIK-------------------RNWRKP
Cavia_porcellus|16438              MAAFRPLVKPKIVKKRT---KKFICHQSNRYVKIK-------------------RNWQKP
Rattus_norvegicus|14430            MAALRPRVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Rattus_norvegicus|30811            MATLLCLVKPKIVKKRT---KKFIRHQLDQYVKIK-------------------RKWWKP
Rattus_norvegicus|27939            MAALLPLVKPKIIKKRT---KKFIRHQ-------------------------------KP
Rattus_norvegicus|23015            MAALRPLVKPKIIKKRT---KEFNRHQSDQYVKIK-------------------GNWQKP
Callithrix_jacchus|42432           ----KPMPPPHSVSSQNFVKKKFIWHQSDRYVKIK-------------------RNWRKP
Callithrix_jacchus|45046           MAALRALVKPKTVKKRT---KKFIPHQSDRYVKIK-------------------HNWRKP
Oryctolagus_cuniculus|18709        MAALRPLVEPKIVKKKT---KKFIRHHRT-------------------------ANWWKP
Rattus_norvegicus|32478            MAALRPLMKPKIIQKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Mus_musculus|54291                 MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------QNWWKP
Mus_musculus|28037                 MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------WNWRKP
Callithrix_jacchus|44098           MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------CNWRKP
Pan_troglodytes|33592              MAALRPLVKPKIVKKRT---KKFIWHQSDQYVKIK-------------------RNCRKP
Oryctolagus_cuniculus|15271        IAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNRQKP
Callithrix_jacchus|45025           TAALRPLVKSKIVKKRT---KKFIRHQSDQYVKIK-------------------RNWQKP
Callithrix_jacchus|44434           MAALRPLVKPKIVKKRT---KKFIRHQSDRHVKIK-------------------RNWRKP
Gorilla_gorilla|26310              MATLRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------CNWRKP
Oryctolagus_cuniculus|15065        MAALRPLEKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Oryctolagus_cuniculus|16026        MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWWKP
Oryctolagus_cuniculus|12138        MAALRPLVKPKIVKKRT---KKFICHQSDRYVKIK-------------------RNWRKP
Rattus_norvegicus|32462            MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Oryctolagus_cuniculus|12560        MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Callithrix_jacchus|44612           MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Callithrix_jacchus|43590           MAALRPLVKPKIVKKRT---KKFIRHQSDQYVKIK-------------------RNWRKP
Tupaia_belangeri|7739              MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Oryctolagus_cuniculus|14961        MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Rattus_norvegicus|16042            MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Gorilla_gorilla|17706              MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIKEEFALCTDANPPVYY-FLQRNWRKP
Oryctolagus_cuniculus|10834        MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIKVGASGWTWTHPAYRCGFSQRNWRKP
Callithrix_jacchus|45111           MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Callithrix_jacchus|8756            MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Callithrix_jacchus|44161           MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Cavia_porcellus|1893               MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Dipodomys_ordii|14302              MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Homo_sapiens|70645                 MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Mus_musculus|43387                 MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Oryctolagus_cuniculus|17276        MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Oryctolagus_cuniculus|12580        MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Oryctolagus_cuniculus|13506        MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Pan_troglodytes|11071              MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Rattus_norvegicus|7460             MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Rattus_norvegicus|31759            MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
Tupaia_belangeri|11160             MAALRPLVKPKIVKKRT---KKFIRHQSDRYVKIK-------------------RNWRKP
                                            .:  .      ::*                                   *.

Spermophilus_tridecemlineatus|5937 RGIDNSMS-RFKGPILMPDIVYG-NKRIVHMLPGSFQ--NFLISN--VEL-KVLQACN-S
Tupaia_belangeri|11040             RGIDNRVWRRFKAQIMMPNSGYGSNKKTKDMLPSGFW--KFLVHN-VKEM-EALLMCSKS
Rattus_norvegicus|26916            RDIDNRVQRRFKGQILMPDISYKGNEKTKHMLPSGFW--KFLVHN-VEEL-EVLLIWNKS
Tupaia_belangeri|1813              RSIDNRVW-RLRGQNFMSNTGYGSNKK-KHILPSGFW--KFLVHN-VKEL-EVLLMCSKS
Tupaia_belangeri|9484              KGIDNRVRRRFKGQILMPNISYGSNKKTIHMLLSGFQ--KYLVHN-VKEL-EVLLMCNKS
Oryctolagus_cuniculus|13028        RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHS-FKEL-ELHTLCNIS
Cavia_porcellus|16438              RGINNRVWRRFKGQIWMPNIDYGSNKKMKHMIPSGFQ--KFQVHR---------RICNKS
Rattus_norvegicus|14430            RGIDNRVQRRFKGQILMSN-GYGSNKKTKHMLPAASG--SFRSHS-VREL-DVQLMCN-S
Rattus_norvegicus|30811            RGIENRVRRRFKGQILMPNIGDGSNKKTKHVLPSGFR--EFLAHN-VKEL-EVQLMCNKS
Rattus_norvegicus|27939            RGIDNSVWRRFKGQILIPNIGYGSKKKTKPMLSS-FW--KFLVHN-VKEL-EVLLMCNKS
Rattus_norvegicus|23015            RGIDNRVQRRVKGQILMPNIGDGSN--TKHVLPSGFR--KFLAHN-VKEL-EVQLMCNKS
Callithrix_jacchus|42432           RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFQNAKFLVHN-VKEL-EVLLMCNKS
Callithrix_jacchus|45046           RGIDNRVRRRFKGQILMTNIGYGSNKKTKYMLPSSFR--KFLVHN-FKEL-EVLLVCNKS
Oryctolagus_cuniculus|18709        RGIDNRVRRRFKGQILMPSTGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EMLLMCNKS
Rattus_norvegicus|32478            RGINNRVRRRFKGQILVPNIGYGNNKKTKHMLPSCFR--KFLVHN-VKEL-EVLLMCSKS
Mus_musculus|54291                 RGIYNRVRRRFKGEILMPNISYRSNKKTKHMLPSSFC--KFLVHD-VKEL-EVLLMCNKS
Mus_musculus|28037                 RGIDNRVRRRFKGQILMPNIGYRSNKKTKHTLSSGFR--KFLVHN-IKEP-EVLLMCNKS
Callithrix_jacchus|44098           RGIDNRVRRRFKGEILIPNFGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKP
Pan_troglodytes|33592              RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGCR--KFLVHN-IKEL-EVLLMCNKS
Oryctolagus_cuniculus|15271        RGIDSRVRRRFKGQILMPNTGYGSNKKTKHMLPSGFR--KFLVHNVVKELEEVLLMCNKS
Callithrix_jacchus|45025           RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Callithrix_jacchus|44434           RGIDNRVRRRFKGQILMPNTGYGSNKKTKHMLPNGFR--KFLVHK-VKEL-EVLLMCNKS
Gorilla_gorilla|26310              RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Oryctolagus_cuniculus|15065        RGIDNRVRRRFKGQILMPNIGYGSNKKTRHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Oryctolagus_cuniculus|16026        RGIDNRVWRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Oryctolagus_cuniculus|12138        RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFH--KFLVHN-VKEL-EVLLMCNKS
Rattus_norvegicus|32462            RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHD-VKEL-EVLLMCNKS
Oryctolagus_cuniculus|12560        RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFL----VQEL-EVLLMCNKS
Callithrix_jacchus|44612           RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLPMCNKS
Callithrix_jacchus|43590           RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Tupaia_belangeri|7739              RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFW--KFLVHN-VKEL-EVLLMCNKS
Oryctolagus_cuniculus|14961        RGIDNRVRRRFKGQILMPNTGYGSNKKTKHMLPSGFR--KFLVHN-VKELEEVLLMCNKS
Rattus_norvegicus|16042            RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Gorilla_gorilla|17706              RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Oryctolagus_cuniculus|10834        RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Callithrix_jacchus|45111           RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Callithrix_jacchus|8756            RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Callithrix_jacchus|44161           RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Cavia_porcellus|1893               RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Dipodomys_ordii|14302              RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Homo_sapiens|70645                 RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Mus_musculus|43387                 RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Oryctolagus_cuniculus|17276        RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Oryctolagus_cuniculus|12580        RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Oryctolagus_cuniculus|13506        RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Pan_troglodytes|11071              RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Rattus_norvegicus|7460             RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Rattus_norvegicus|31759            RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
Tupaia_belangeri|11160             RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFR--KFLVHN-VKEL-EVLLMCNKS
                                   :.* . :  *.:.   :..     :      :       .:                . .

Spermophilus_tridecemlineatus|5937 FFAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Tupaia_belangeri|11040             YYAEIA------H--VSSKCKGIEI---SAHL------------------
Rattus_norvegicus|26916            YCAEIA------HS-VSSKNRKAIIERAAAQLAIRVTNPKARLHSGKK--
Tupaia_belangeri|1813              YCAEIA------HN-VSSKNHKAIVGR-AAQLAL-VTNPNARLRSEENEW
Tupaia_belangeri|9484              YYAEIT------HN-PSSKNCKAIMGW-TVQLAIRVTNSNARLCSEENE-
Oryctolagus_cuniculus|13028        YFQKIV------HNRFPPRTANPLWRE-WFQLAIRVTNPNAKLRSEENE-
Cavia_porcellus|16438              YCAEIA------HS-VSSKNGKAIVER-AAQLAIR---PNARLHSEENE-
Rattus_norvegicus|14430            YCAEIA------HS-VTSKNRKAIVER-AAQLAIRVTNPNARLRSERMN-
Rattus_norvegicus|30811            YCAEIA------HS-VSSKNRKATVAR-AAQLAIRVTNPKARLRREENE-
Rattus_norvegicus|27939            YCAEIA------PN-VSFENGKTIRER-AAQLAIRITNPNARLHREENV-
Rattus_norvegicus|23015            YSAEIA------HN-VSSKNRKAIVER-AA-LAIRVTNSNARLHSEENE-
Callithrix_jacchus|42432           YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTKPNARLRSEENE-
Callithrix_jacchus|45046           YCTEIA------HN-VSSKNRKAIVER-AAQLAIKVTNSNARLCSEETE-
Oryctolagus_cuniculus|18709        YCEEIA------HN-VSSKNHKAIVER-AAQLAIRVTNPNARLRSEENE-
Rattus_norvegicus|32478            YCAEIA------HN-VSSKNRKAILER-AAQLAIRVTNPNDRLCSKENE-
Mus_musculus|54291                 YCAEIA------HN-VSSKNREAIVER-AAQLAIRVSNPNARLRSEENE-
Mus_musculus|28037                 YRAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNTRLHSEENE-
Callithrix_jacchus|44098           YCAEIA------HN-VSSKNRKAIVER-AAQLAIRATNPNARLRGEENE-
Pan_troglodytes|33592              YCAEIA------HN-VSSKNRKAIVET-AAQLAIRVTNPNARLCSEENE-
Oryctolagus_cuniculus|15271        CCAEIA------HN-VSSKNHKAIVER-AAQLAIRVTNPNARLRSEENE-
Callithrix_jacchus|45025           YCAEIA------HN-VSSKNRRAIVER-AAQLAIRATNPNARLCSEENE-
Callithrix_jacchus|44434           YCAEIT------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLCSEENE-
Gorilla_gorilla|26310              HCAAIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Oryctolagus_cuniculus|15065        YCAEIA------HN-VSSKNCKAIVER-AAQLAIRVTNPNARLRSEENE-
Oryctolagus_cuniculus|16026        YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLCSEENE-
Oryctolagus_cuniculus|12138        YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Rattus_norvegicus|32462            YCAEIA------HN-VSSKNRKAI---------IRVTNPNARLRSEENE-
Oryctolagus_cuniculus|12560        YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Callithrix_jacchus|44612           YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Callithrix_jacchus|43590           YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Tupaia_belangeri|7739              YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Oryctolagus_cuniculus|14961        YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Rattus_norvegicus|16042            YCAEIVLCAYIAHN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSKENE-
Gorilla_gorilla|17706              YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Oryctolagus_cuniculus|10834        YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Callithrix_jacchus|45111           YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Callithrix_jacchus|8756            YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Callithrix_jacchus|44161           YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Cavia_porcellus|1893               YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Dipodomys_ordii|14302              YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Homo_sapiens|70645                 YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Mus_musculus|43387                 YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Oryctolagus_cuniculus|17276        YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Oryctolagus_cuniculus|12580        YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Oryctolagus_cuniculus|13506        YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Pan_troglodytes|11071              YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Rattus_norvegicus|7460             YCAEIA------H-------------------------------------
Rattus_norvegicus|31759            YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
Tupaia_belangeri|11160             YCAEIA------HN-VSSKNRKAIVER-AAQLAIRVTNPNARLRSEENE-
                                       *.