Orthologs Set ID: EOG4003JD


Orthology Database
OrthoDB4
Gene Symbol(s)
IGSF9B

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Microcebus murinus 5362 27, 42, 244
Ochotona princeps 5534 30, 244
Spermophilus tridecemlineatus 3899 26
Tupaia belangeri 4032 27, 244

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Microcebus murinus 5362 ENSMICT00000004998 ENSMICG00000005003 micMur1
Ochotona princeps 5534 ENSOPRT00000009851 ENSOPRG00000009868 OchPri2.0
Spermophilus tridecemlineatus 3899 ENSSTOT00000003899 speTri1
Tupaia belangeri 4032 ENSTBET00000004033 ENSTBEG00000004050 IGSF9B tupBel1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Microcebus murinus 4559 ENSMICP00000004557 ENSMICG00000005003 micMur1
Ochotona princeps 4806 ENSOPRP00000009003 ENSOPRG00000009868 OchPri2.0
Spermophilus tridecemlineatus 3509 ENSSTOP00000003495 speTri1
Tupaia belangeri 3514 ENSTBEP00000003499 ENSTBEG00000004050 IGSF9B tupBel1

multiple sequence alignment in CLUSTALW format


Ochotona_princeps|5534             CTCTTTTTGCCATTGTGTCTCTGCCCCACCTTC------CCTGCAGTCGCCCACGGCCTG
Microcebus_murinus|5362            TCCTTT------------CTATGTCCC---TGGCTG---TCCTCAGGCGCCCACGGCCTT
Spermophilus_tridecemlineatus|3899 ---TTT------------CCATGTCCAACTTGGTTGTCTCCATTAGGTGCCCACGGCCTG
Tupaia_belangeri|4032              TGCTTT------------CCGTGTCCCACTTGGTTGTCCCCATTAGGTGCCCACGGCCTG
                                      ***            *  ** **.   *         *   **  *********** 

Ochotona_princeps|5534             CGAGAAGAGCCAGAGTTTGTGACCGCCCGAGCTGGCGAGGGTGTGGTCCTGCGATGCGAC
Microcebus_murinus|5362            CGAGAGGAACCCGAGTTTGTGACTGCGAGAGCCGGTGAGGCTGTGGTCCTGCGATGCGAC
Spermophilus_tridecemlineatus|3899 CGAGAGGAGCCCGAGTTTGTGACTGCAAGAGCTGGCGAGGGCGTGGTCCTGCGATGCGAT
Tupaia_belangeri|4032              CGAGAGGAGCCTGAGTTTGTGACCGCCCGAGCTGGCGAGGGCGTGGTCCTACGATGCGAC
                                   *****.**.** *********** ** .**** ** ****  ********.******** 

Ochotona_princeps|5534             GTGATCCACCCTGTGACGGGACAGCCCCCACCCTATGTGGTAGAGTGGTTCAAGTTTGGC
Microcebus_murinus|5362            GTGATCCACCCGGTGACGGGACAACCCCCGCCCTATGTCGTAGAGTGGTTCAAGTTCGGG
Spermophilus_tridecemlineatus|3899 GTGATCCACCCGGTGACAGGACAGCCCCCGCCCTATGTTGTAGAGTGGTTCAAGTTTGGG
Tupaia_belangeri|4032              GTGATCCACCCGGTGACGGGACAGCCTCCGCCCTATGTGGTAGAGTGGTTCAAGTTCGGG
                                   *********** *****.*****.** **.******** ***************** ** 

Ochotona_princeps|5534             GTCCCCATCCCTATCTTCATCAAGTTTGGCTATTACCCGCCCCACGTGGACCCTGAATAT
Microcebus_murinus|5362            GTGCCTATTCCTATCTTCATCAAGTTTGGCTACTACCCGCCCCACGTGGACCCCGAGTAT
Spermophilus_tridecemlineatus|3899 GTCCCCATTCCTATCTTCATCAAGTTTGGCTACTACCCGCCCCACGTGGACCCTGAGTAT
Tupaia_belangeri|4032              GTCCCCATCCCTATCTTCATCAAGTTTGGCTACTATCCTCCCCATGTGGACCCTGAGTAT
                                   ** ** ** *********************** ** ** ***** ******** **.***

Ochotona_princeps|5534             GCAGGCAGGGCCAGTCTTCACGACAAAGCGTCTCTACGGCTGGAGCAGGTGCGCTCC
Microcebus_murinus|5362            GCAGGCCGGGCCAGTCTCCACGATAAGGCATCCTTGCGGCTGGAGCAGGTTCGCTCC
Spermophilus_tridecemlineatus|3899 GCA------------------------------------------------------
Tupaia_belangeri|4032              GCAGGCCGGGCCAGTCTCCATGACAAAGCATCTCTGCGACTGGAGCAGGTCCGCTCG
                                   ***                                                      

multiple sequence alignment in CLUSTALW format


Ochotona_princeps|4806             LFLPLCLCPTF--PAVAHGLREEPEFVTARAGEGVVLRCDVIHPVTGQPPPYVVEWFKFG
Microcebus_murinus|4559            SF----LCP-WL-SSGAHGLREEPEFVTARAGEAVVLRCDVIHPVTGQPPPYVVEWFKFG
Spermophilus_tridecemlineatus|3509 -F----PCPTWLSPLGAHGLREEPEFVTARAGEGVVLRCDVIHPVTGQPPPYVVEWFKFG
Tupaia_belangeri|3514              CF----PCPTWLSPLGAHGLREEPEFVTARAGEGVVLRCDVIHPVTGQPPPYVVEWFKFG
                                    *     ** :  .  *****************.**************************

Ochotona_princeps|4806             VPIPIFIKFGYYPPHVDPEYAGRASLHDKASLRLEQVRS
Microcebus_murinus|4559            VPIPIFIKFGYYPPHVDPEYAGRASLHDKASLRLEQVRS
Spermophilus_tridecemlineatus|3509 VPIPIFIKFGYYPPHVDPEYA------------------
Tupaia_belangeri|3514              VPIPIFIKFGYYPPHVDPEYAGRASLHDKASLRLEQVRS
                                   *********************