Orthologs Set ID: EOG4006BF


Orthology Database
OrthoDB4
Gene Symbol(s)
CG43066,GE11976,GL17081

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Apis mellifera 36843 568, 822, 1068, 1179, 1421, 1578, 1858, 2018, 2181, 2382
Bombyx mori 14533 568, 822, 1068, 1179, 1421, 1653, 1858, 2018, 2193
Culex quinquefasciatus 18583 568, 822, 1421, 1578, 1858, 2018, 2181, 2382
Daphnia pulex 1357 568, 822, 1068, 1179, 1475, 1578, 1858, 2018, 2181
Drosophila melanogaster 7282 568, 822, 1421, 1578, 2018, 2181, 2448, 2517
Drosophila persimilis 5294 568, 822, 1421, 1578, 1797, 2018, 2181, 2388
Drosophila yakuba 15996 568, 822, 1421, 1578, 2018, 2181, 2448, 2517
Linepithema humile 4716 346, 412, 568, 801, 822, 1068, 1179, 1421, 1578, 1858, 2018, 2181, 2382
Nasonia vitripennis 11940 568, 822, 1068, 1179, 1421, 1578, 1858, 2018, 2181, 2382
Nematostella vectensis 14549 1858, 2018, 2181
Nematostella vectensis 21556 568, 881, 1068, 1179, 1389, 1578, 1858, 2018, 2181
Pediculus humanus 8506 209, 568, 822, 1068, 1179, 1421, 1578, 1858, 2018, 2181, 2282
Pogonomyrmex barbatus 13208 346, 822, 1068, 1179, 1421, 1578, 1858, 2018, 2181, 2382
Tribolium castaneum 7890 568, 822, 1421, 1578, 2181, 2382

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Apis mellifera 36843 GB18122-PA apiMel3
Bombyx mori 14533 BGIBMGA004216-TA v2.0
Culex quinquefasciatus 18583 CPIJ001296-RA 6032336 CPIJ001296 CpipJ1
Daphnia pulex 1357 e_gw1.245.2.1 1.1
Drosophila melanogaster 7282 FBtr0086698, NM_137496 37129 FBgn0262476 CG43066 dm3
Drosophila persimilis 5294 FBtr0182696 6592333 FBgn0154685 GL17081 droPer1
Drosophila yakuba 15996 FBtr0258494 6531073 FBgn0229754 GE11976 droYak2
Linepithema humile 4716 LH17527-RA 1.2
Nasonia vitripennis 11940 NV18326-RA 1.2
Nematostella vectensis 21556 estExt_gwp.C_200037 Nemve1
Nematostella vectensis 14549 gw.868.4.1 Nemve1
Pediculus humanus 8506 PHUM503850-RA 8231602 PHUM503850 PhumU1
Pogonomyrmex barbatus 13208 PB18056-RA 1.2
Tribolium castaneum 7890 GLEAN_09753 Tcas3.0

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Apis mellifera 8120 GB18122 apiMel3
Bombyx mori 4216 BGIBMGA004216-PA v2.0
Culex quinquefasciatus 3454 CPIJ001296 CpipJ1
Daphnia pulex 19073 JGI_V11_65729 1.1
Drosophila melanogaster 6684 FBpp0085877 dm3
Drosophila persimilis 6904 FBpp0181188 6592333 FBgn0154685 GL17081 droPer1
Drosophila yakuba 2657 FBpp0256986 6531073 FBgn0229754 GE11976 droYak2
Linepithema humile 5834 LH17527-PA 1.2
Nasonia vitripennis 8214 NV18326-PA 1.2
Nematostella vectensis 220 gw.868.4.1 Nemve1
Nematostella vectensis 14373 estExt_gwp.C_200037 Nemve1
Pediculus humanus 8343 PHUM503850-PA 8231602 PHUM503850 PhumU1
Pogonomyrmex barbatus 8056 PB18056-PA 1.2
Tribolium castaneum 9506 GLEAN_09753 Tcas3.0

multiple sequence alignment in CLUSTALW format


Nematostella_vectensis|21556 ------------------------------------------------------------
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           ATGTTCCTCAACGGGAGCGAGACGGGAGCTGACGGC---------AGTCATCAGCAGAGC
Pediculus_humanus|8506       ATGGCCAAAATAGTAAATAAACCTGATAGC---------------AGAAATGGACACGAG
Tribolium_castaneum|7890     ATGACC---------------------------------------CGGAACGGCCACGAA
Nasonia_vitripennis|11940    ATGGTGGTTAAGCCGGAGGAGGTCGGGACGACTACTGGCGGCAGGAGGAACGGCCACGAG
Apis_mellifera|36843         ATGGTAGTCAAGAACGAGAATACG---------------------AGAAATGGGCATGAG
Linepithema_humile|4716      ATGGTAGTCAAGACCGAGACCGCG---------------------AGAAATGGGCACGAG
Pogonomyrmex_barbatus|13208  ATGGTAGTCGAGACCGGA---------------------------AGAAATGGGCACGAG
Bombyx_mori|14533            ATGGCGGCCAAAGCTGAGACTATAGGGCCG---------------CGTAATGGCCACGAA
Culex_quinquefasciatus|18583 ATGGCCACCAAGGCGGACGGAACCGGTGGCGTCGGCGGTCCCCGGAACAACGGCCACGAG
Drosophila_persimilis|5294   ATGGCTGCCACCAAAATCATCGATGCACCG---------------CGCAACGGCCACGAG
Drosophila_melanogaster|7282 ATGGCTGCCACCAAAATCATAGATGCGCCG---------------CGCAACGGCCACGAG
Drosophila_yakuba|15996      ATGGCTGCCACCAAAATCATAGATGCGCCG---------------CGCAACGGCCACGAG
                                                                                         

Nematostella_vectensis|21556 ------------------------------------------------------------
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           TTGCGACCACCTCATCATAGGGGGCAAACATCAGCAGGAGGAGTTTCATCCGAAGGGCCG
Pediculus_humanus|8506       CTTGCTCAATTGAATAGTTCTAGAACGGGAGAT---------------------------
Tribolium_castaneum|7890     CTTGCTCCACTCAACACCCGGAACGGTCCCGAA------------------------GGG
Nasonia_vitripennis|11940    CTCGCGCCCTTGAACGAGGAGCGCGCCTTCGGCCAGCAGAGCGCAGTCTCTCCCGGCGCC
Apis_mellifera|36843         CTGGCTCCGTTGAACGAGGAACGTCAGGCAGGG---------------------------
Linepithema_humile|4716      TTGGCACCGTTGAACGAAAACCGCCAACTCCAG---------------------------
Pogonomyrmex_barbatus|13208  CTGGCTCCTTTAAACGACCACCGCCAACCCGCC---------------------------
Bombyx_mori|14533            TTGGCGCCATTAACGACGCGGGCTGACGGCTCT------------------------GAA
Culex_quinquefasciatus|18583 ATGGCCCCGCTTAACACGAGGGCCCGCGGCGAC---------------------------
Drosophila_persimilis|5294   ATGGCTCCATTGAACACAAGGGCACGGGGCGAT---------------------------
Drosophila_melanogaster|7282 ATGGCGCCGCTGAACACACGGGCACGGGGCGAT---------------------------
Drosophila_yakuba|15996      ATGGCGCCACTGAACACACGGGCACGTGGCGAT---------------------------
                                                                                         

Nematostella_vectensis|21556 ------------------------------------------------------------
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           GCGACATCAGGAGGACCTTCGCTGCTGCCGTCGGGTGTTGCCACAGCAGCGGGCCACAAT
Pediculus_humanus|8506       ------GGAGGAGTTACAATTGTCGTA---------------------TCGCCAACAAAT
Tribolium_castaneum|7890     GGCAAACCGGGTGTCACCATCGTGCTG---------------------CAGGGCCCTCGA
Nasonia_vitripennis|11940    GGGTCGCACAACGTCAGCATCCTCGTC---------------------GCCGGGAACAGC
Apis_mellifera|36843         ------CAGAACGTGACAATCGTGGTA---------------------ACCGGGAATCAA
Linepithema_humile|4716      ---------AACGTGACGATCGTGGCG---------------------GAAAGTCAA---
Pogonomyrmex_barbatus|13208  ------CACAACGTGACGATCGTCACG---------------------ACAGCGAGTCAA
Bombyx_mori|14533            CGACCCCACGGAGTTACCATCGTCCTC---------------------CAAGGTTCT---
Culex_quinquefasciatus|18583 GGAACGCACGGTGTAACCATAATGCTG---------------------TCCCCGCCGGAT
Drosophila_persimilis|5294   GGGACCCACGGCGTGACCATCGTCCTG---------------------ACCGCCCCGCAG
Drosophila_melanogaster|7282 GGAACCCACGGGGTGACCATCGTCCTT---------------------ACCGCCCCCCAG
Drosophila_yakuba|15996      GGCACCCATGGAGTGACCATCGTACTC---------------------ACTGCCCCCCAG
                                                                                         

Nematostella_vectensis|21556 ---------------------------------------ATGCAAGTTAACGATGATCGC
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           AAGAGCAGCGTGGTCAACGATGCCGTTCTTCACGTGCCCGAGTTGCTACCCCCGGAGCGC
Pediculus_humanus|8506       GGA------------------GGACACAGTTTAAGCATGGGAAGTCCTGGAGAAGAAAGA
Tribolium_castaneum|7890     GGCTCGATCATC---------TCCAGGGGCAGCGCCCCCATCGACCAGGATCCGGACCGC
Nasonia_vitripennis|11940    GGCAATGGCGCCGCGAGCGATGCCCTCCAGCAGCAGCCCGAGCCGAAGCAGGAGAACCGC
Apis_mellifera|36843         ---------------------AATGCTGCTGGCAGTCAAGAGACCAAGGAGGAGAACAGG
Linepithema_humile|4716      ---------------------AATGTCGCGGACGGCCCGGAGGCG---AATGAGAACAGA
Pogonomyrmex_barbatus|13208  ---------------------AATGTTGCCGACGGCCAGGACACGAAGGAAGAGAACAGG
Bombyx_mori|14533            ---------------------AGAGGATCATTGCACCGCGACGGACCGGACGATGACAGG
Culex_quinquefasciatus|18583 CGCAGCTCGGTGGGGTCCCGGGAGGGAGCTGGCCTCCCCGACGGC---GATCCAGACCGG
Drosophila_persimilis|5294   CGCAACTCGGTA---------CAGTCGGTGGACATTCCGGGCGGA---GATCCGGAGCGG
Drosophila_melanogaster|7282 CGCAACTCCGTG---------CAATCGGTGGACATTCCGGGCAAT---GAGCCGGAACGC
Drosophila_yakuba|15996      CGCAACTCCGTG---------CAATCGGTGGACATACCGGGCAAT---GAGCCGGAACGT
                                                                                         

Nematostella_vectensis|21556 GGAGGCTGGGGTAACAAGCTCGAGTTTATTCTTGCTACTGTTGGCTATGCCGTAGGACTA
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           CAAAAATGGGATAATAAATTGCAGTTCATGTTGAGCGCTATTGGATACTCGGTGGGATTG
Pediculus_humanus|8506       GCTGCTTGGTCTGGAAAATTACAATTTTTCCTAAGCATAATCGGATATTCAGTGGGTTTG
Tribolium_castaneum|7890     GCGGCCTGGTCCGGAAAAATGCAGTTCTTTCTGTCAATTATCGGGTACTCGGTGGGATTA
Nasonia_vitripennis|11940    GCCGAGTGGAGCGGCAAGATGCAGTTCTTCCTCAGCATCATCGGCTACAGCGTCGGCCTC
Apis_mellifera|36843         GCGGAATGGAGCGGGAAGATGCAATTTTTCCTCAGTATTATCGGTTACAGCGTGGGGCTT
Linepithema_humile|4716      GCGGCATGGAGCGGGAAAATGCAATTCTTCCTCAGTATTATCGGGTACAGCGTGGGTCTG
Pogonomyrmex_barbatus|13208  GCGGCATGGAGCGGGAAAATGCAATTCTTTCTCAGTATTATCGGATACAGCGTCGGTCTG
Bombyx_mori|14533            GCTGCCTGGTCCGGGAAACTACAGTTCTTTTTGTCGATTATTGGATACTCTGTGGGCTTG
Culex_quinquefasciatus|18583 GCGGCCTGGTCCGGCAAGATGCAGTTTTTCCTCAGTATTATCGGATATTCCGTCGGGTTG
Drosophila_persimilis|5294   GCCGCCTGGAGTGGCAAGATGCAGTTCTTCCTCAGCATCATCGGCTACTCGGTGGGCCTG
Drosophila_melanogaster|7282 GCCGCCTGGAGCGGCAAGATGCAGTTCTTCCTCAGCATCATCGGATACTCGGTGGGCCTC
Drosophila_yakuba|15996      GCCGCCTGGAGCGGCAAGATGCAGTTCTTCCTCAGCATCATCGGTTACTCGGTGGGCCTC
                                                                                         

Nematostella_vectensis|21556 GGCAATGTTTGGCGATTTCCTTATCTGTGCCAGAAAAACGGTGGA---------------
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           GGTAACGTTTGGCGTTTCCCTTATCTGGTCCAGCAAAACGGAGGC---------------
Pediculus_humanus|8506       GGAAATATATGGCGTTTTCCATATTTATGTCAACAAAATGGTGGA---------------
Tribolium_castaneum|7890     GGGAATATTTGGAGGTTTCCCTATCTGTGTCAACAGAACGGCGGG---------------
Nasonia_vitripennis|11940    GGCAACATCTGGAGATTCCCCTACCTGTGCCAACAGAACGGCGGC---------------
Apis_mellifera|36843         GGGAATATATGGAGATTCCCTTACCTGTGCCAACAGAACGGAGGA---------------
Linepithema_humile|4716      GGCAATATCTGGAGGTTTCCCTATCTGTGCCAACAGAACGGAGGTGCCGACATCGGATGT
Pogonomyrmex_barbatus|13208  GGCAATATCTGGAGGTTTCCTTACCTGTGCCAACAGAATGGAGGTGGT------------
Bombyx_mori|14533            GGTAACATTTGGCGGTTTCCGTATCTGTGTCAACAAAATGGCGGA---------------
Culex_quinquefasciatus|18583 GGCAACATCTGGCGGTTTCCGTACCTGTGCCAGCAGAACGGCGGA---------------
Drosophila_persimilis|5294   GGCAACATCTGGCGCTTTCCCTACCTGTGCCAACAGAACGGCGGC---------------
Drosophila_melanogaster|7282 GGCAATATCTGGCGGTTTCCCTACCTTTGCCAACAGAATGGAGGC---------------
Drosophila_yakuba|15996      GGCAATATCTGGCGGTTTCCCTACCTGTGCCAACAGAACGGCGGC---------------
                                                                                         

Nematostella_vectensis|21556 ------------------------------------------------------------
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           ------------------------------------------------------------
Pediculus_humanus|8506       ------------------------------------------------------------
Tribolium_castaneum|7890     ------------------------------------------------------------
Nasonia_vitripennis|11940    ------------------------------------------------------------
Apis_mellifera|36843         ------------------------------------------------------------
Linepithema_humile|4716      AAAGCGAAGAAGAGCAGGGACAAGGTTGCTCGATACGAGGGCAGTGGAGCCGGTAGGTCA
Pogonomyrmex_barbatus|13208  ------------------------------------------------------------
Bombyx_mori|14533            ------------------------------------------------------------
Culex_quinquefasciatus|18583 ------------------------------------------------------------
Drosophila_persimilis|5294   ------------------------------------------------------------
Drosophila_melanogaster|7282 ------------------------------------------------------------
Drosophila_yakuba|15996      ------------------------------------------------------------
                                                                                         

Nematostella_vectensis|21556 ------------------------------------------------------------
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           ------------------------------------------------------------
Pediculus_humanus|8506       ------------------------------------------------------------
Tribolium_castaneum|7890     ------------------------------------------------------------
Nasonia_vitripennis|11940    ------------------------------------------------------------
Apis_mellifera|36843         ------------------------------------------------------------
Linepithema_humile|4716      CGAGAAGTGCACGGTTGGCCCTTAGCGTGTGGCCTCATGACGCCAGAGTTTATACAAACT
Pogonomyrmex_barbatus|13208  ------------------------------------------------------------
Bombyx_mori|14533            ------------------------------------------------------------
Culex_quinquefasciatus|18583 ------------------------------------------------------------
Drosophila_persimilis|5294   ------------------------------------------------------------
Drosophila_melanogaster|7282 ------------------------------------------------------------
Drosophila_yakuba|15996      ------------------------------------------------------------
                                                                                         

Nematostella_vectensis|21556 ------------------------------------------------------------
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           ------------------------------------------------------------
Pediculus_humanus|8506       ------------------------------------------------------------
Tribolium_castaneum|7890     ------------------------------------------------------------
Nasonia_vitripennis|11940    ------------------------------------------------------------
Apis_mellifera|36843         ------------------------------------------------------------
Linepithema_humile|4716      CCGAAATCATATCGGTTACCATCCAGCAACTGCGCAGATTGTGCTTCCGTTACCAGATTA
Pogonomyrmex_barbatus|13208  ------------------------------------------------------------
Bombyx_mori|14533            ------------------------------------------------------------
Culex_quinquefasciatus|18583 ------------------------------------------------------------
Drosophila_persimilis|5294   ------------------------------------------------------------
Drosophila_melanogaster|7282 ------------------------------------------------------------
Drosophila_yakuba|15996      ------------------------------------------------------------
                                                                                         

Nematostella_vectensis|21556 ---------------------------GGTGCATTTCTCATCCCGTACGTGCTATGCCTG
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           ---------------------------GGAGCGTTTTTGATTCCGTTCTTCGTCATGCTA
Pediculus_humanus|8506       ---------------------------GGTGCTTTTCTGATACCCTTTGTCATAATGTTG
Tribolium_castaneum|7890     ---------------------------GGTGCCTTTCTTATTCCCTTCGCCGTAATGTTG
Nasonia_vitripennis|11940    ---------------------------GGTGCTTTCCTCATCCCCTTCTTCGTGATGCTC
Apis_mellifera|36843         ---------------------------GGTGCCTTTCTCATCCCCTTTTTCGTGATGCTA
Linepithema_humile|4716      CCGCTCTCACGCCTACCTCATGCTATAGGTGCCTTCCTCATCCCTTTTTTTGTGATGCTC
Pogonomyrmex_barbatus|13208  ---------------GCGTATATTTTAGGTGCCTTCCTCATTCCTTTTTTCGTGATGCTC
Bombyx_mori|14533            ---------------------------GGTGCCTTTCTGATTCCGTTCCTCATCATGTTG
Culex_quinquefasciatus|18583 ---------------------------GGCGCCTTTCTCATCCCCTTTATGGTGATGCTG
Drosophila_persimilis|5294   ---------------------------GGTGCATTCCTGATACCGTTCATGATTATGCTG
Drosophila_melanogaster|7282 ---------------------------GGTGCATTCCTGATACCCTTTATGGTTATGCTG
Drosophila_yakuba|15996      ---------------------------GGTGCATTTCTGATACCCTTCATGGTTATGCTG
                                                                                         

Nematostella_vectensis|21556 GCTCTACTCGGGATTCCTTTGTTCTTTATGGAGCTTGCTATTGGTCAAAGCGTGCGTCAA
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           CTGCTGGAGGGCATCCCGCTCTTCCTGGTGGAGTTGGCGCTGGGGCAGAAGTTACGTCAG
Pediculus_humanus|8506       ATATTAGAAGGGATACCACTTTTTTTAATAGAAATTGGAATCGGACAAAAAATGCGATTG
Tribolium_castaneum|7890     ATCCTTGAAGGCATCCCGCTCTTCCTCATCGAGCTGGGAATTGGCCAGAAGATGAGGTTG
Nasonia_vitripennis|11940    ATTCTGGAGGGAGTCCCGCTGTTCTTGATCGAACTGGGCCTTGGTCAACGGATGCGTCAA
Apis_mellifera|36843         ATCCTAGAGGGTGTACCTCTCTTTTTAATCGAGCTGGGTCTCGGTCAACGCATGCGACAG
Linepithema_humile|4716      ATCCTAGAGGGTGTACCCCTCTTTCTGATTGAGCTGGGCCTCGGGCAACGTATGCGGCAG
Pogonomyrmex_barbatus|13208  ATCTTGGAGGGTGTACCCCTCTTCCTGATCGAGCTGGGTCTCGGACAACGTATGCGGCAG
Bombyx_mori|14533            GTCCTGGAGGGTGTACCTCTGTTCCTGATAGAGATGGCCATAGGGCAGAAGATGCGTCTC
Culex_quinquefasciatus|18583 ATTCTGGAGGGAATCCCGCTCTTCCTAATCGAGCTCGGGATGGGTCAACGGATGCGGCTG
Drosophila_persimilis|5294   ATACTGGAGGGGATACCACTCTTCCTCATCGAACTGGGCATGGGGCAGCGCATGCGGCTG
Drosophila_melanogaster|7282 ATACTGGAGGGCATACCGCTGTTCCTAATCGAGTTGGGAATCGGGCAGAGAATGCGATTG
Drosophila_yakuba|15996      ATACTGGAGGGCATACCGCTGTTCCTAATCGAGTTGGGAATCGGCCAGCGGATGCGATTG
                                                                                         

Nematostella_vectensis|21556 GGCTCGGTCGGGGTCTGGAACTATATCCATCCCTACCTGGGAGGGGTGGGGATCTCATCT
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           GGCTCGCTCGGGGCCTGGAATCTCATCCACCCGTGGCTGGGCGGTCTGGGCATCGCTTCG
Pediculus_humanus|8506       GGAGCCTTGGGAGTATGGAATACGGTACATCCTTGGTTGGGTGGCATTGGTATTGCCAGT
Tribolium_castaneum|7890     GGCTCGTTGGGTGTCTGGAATACCATCCACCCATGGCTGGGCGGCATCGGAATCTCGTCG
Nasonia_vitripennis|11940    GGTGCTCTCGGCGTCTGGAACACGATCCACCCCTGGCTCGGCGGCATAGGCATTGCCTCC
Apis_mellifera|36843         GGCGCCCTTGGTGTATGGAACACGATACATCCATGGTTAGGCGGTATAGGGATAGCATCG
Linepithema_humile|4716      GGTGCTCTGGGTGTTTGGAACACTATACACCCTTGGTTAGGCGGCATAGGAATCGCGTCT
Pogonomyrmex_barbatus|13208  GGTGCCCTGGGCGTTTGGAACACAATACACCCTTGGCTAGGCGGTATAGGGATCGCGTCG
Bombyx_mori|14533            GGAAGCCTCGGCGTTTGGAACACCATCCATCCCTGGCTGGGTGGTATCGGCATATCCAGC
Culex_quinquefasciatus|18583 GGCGCCCTCGGCGTGTGGAACACGATACACCCCTGGCTGGGTGGCATCGGCATCTCGTCC
Drosophila_persimilis|5294   GGCGCGTTGGGGGTGTGGAACACCATCCATCCGTGGCTGGGCGGCATCGGCATCTCGTCG
Drosophila_melanogaster|7282 GGTGCCTTGGGTGTGTGGAACACCATCCATCCCTGGCTGGGTGGCATCGGAATCTCGTCG
Drosophila_yakuba|15996      GGTGCCTTGGGTGTGTGGAACACCATCCATCCCTGGCTGGGTGGCATCGGCATCTCGTCG
                                                                                         

Nematostella_vectensis|21556 GTTATCGTCTGCTTCCTTGTTGCTGTATATTATAACATGATTATTGCGTGGTGTTTCTAT
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           ACGCTGGTCGCCTTTCTCGTCGGCCTCTACTACAACGTCATCATCACCTGGTGTTTCTAC
Pediculus_humanus|8506       TGCATCGTAACCTTTTTCGTTGCTTTATATTACAACATAATTATAACTTGGTGTTTTTAT
Tribolium_castaneum|7890     TGTATCGTCACTTTCTTCGTAGCTCTCTATTACAATGTCATCATAACATGGTGCTTTTAT
Nasonia_vitripennis|11940    TGCATCGTGACCTTCTTCGTCACCCTCTACTACAACGTCATCATCACCTGGTGCTTCTAC
Apis_mellifera|36843         TGCATCGTCACCTTCTTCGTAGCACTTTATTACAACGTCATCATTACCTGGTGCTTCTAT
Linepithema_humile|4716      TGTATAGTTACTTTTTTCGTCGCGCTTTACTACAACGTAATTATTACCTGGTGCTTCTAC
Pogonomyrmex_barbatus|13208  TGTATAGTGACGTTTTTCGTTGCGCTTTACTACAACGTAATTATTACCTGGTGTGTCTAC
Bombyx_mori|14533            TGCATAGTGACCCTATTCGTCGCTCTGTACTACAACGTGATCATAACCTGGGTTTTCTTC
Culex_quinquefasciatus|18583 TGCATCGTGACGCTGTTCGTGGCCATCTACTACAACGTAATCATCACCTGGTGCTTTTTC
Drosophila_persimilis|5294   TGCATTGTGACGCTGTTCGTGGCCCTGTACTACAACGTCATCATCACGTGGGTCTTCTTC
Drosophila_melanogaster|7282 TGCATAGTGACGCTATTTGTGGCTCTCTATTACAACGTGATCATCACGTGGGTTTTCTTC
Drosophila_yakuba|15996      TGCATAGTGACGCTCTTTGTGGCTCTGTACTACAACGTGATCATCACGTGGGTGTTCTTC
                                                                                         

Nematostella_vectensis|21556 TACCTTTTTGCCTCC---------------------TGGCAGTCTCCT---------CTT
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           TACCTGTTCAACTCC---------------------TTCCAGTCTCCT---------CTA
Pediculus_humanus|8506       TATTTCTTCAATAGC---------------------TTCCAGTCGCCA---------TTG
Tribolium_castaneum|7890     TACTTCTTCAACAGC---------------------TTTCAGTACCCG---------CTC
Nasonia_vitripennis|11940    TACCTCTTCAATTCG---------------------TTCAGGGAGCCG---------CTG
Apis_mellifera|36843         TATCTTTTCAATTCA---------------------CTGGAGGAACCG---------TTG
Linepithema_humile|4716      TACCTCTTCAACTCGCTCGGGGCTGTCACGATCAATTTTGGTCAATCA---------CTG
Pogonomyrmex_barbatus|13208  TATCTCTTCAACTCG---------------------CTCGAGGAATCA---------CTG
Bombyx_mori|14533            TATCTATTCAACAGC---------------------ATCCGGCTAACAGCAGATCAGCTA
Culex_quinquefasciatus|18583 TACTTCTTCAACAGC---------------------TTTAGGGTCACC---------CTC
Drosophila_persimilis|5294   TACCTCTTCAACAGT---------------------TTTCGGTACCCC---------CTG
Drosophila_melanogaster|7282 TACCTTTTCAACAGT---------------------TTTCGGTATCCG---------CTG
Drosophila_yakuba|15996      TACCTCTTCAACAGT---------------------TTTCGCTATCCG---------CTG
                                                                                         

Nematostella_vectensis|21556 CCGTACAGCTATTGTCCGCAAGTTCTCACAAATAGTAAGTATTATGACCTTCCCGAGTGT
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           CCTTGGTCGACGTGTCCGATCGAC---TCAAACGGGACG------GCCGTCAAGGAATGC
Pediculus_humanus|8506       CCTTGGAGCGAATGTCCTGTCGTC------AATAATACT------GTAGTTTACGAATGT
Tribolium_castaneum|7890     CCTTGGGAAAACTGCCCCGTGGTG------AACGGCACC------GCGGTCCCCGAATGC
Nasonia_vitripennis|11940    CTCTGGTCGGAATGCCCGAAGATC------GACAACAGG------TCGGTCGAGGAGTGC
Apis_mellifera|36843         CCATGGGCGAAATGTCCGGAGGTT------GATGGGAAG------CCGGTGGAGGAATGC
Linepithema_humile|4716      CCGTGGGCAACGTGCCCCGAAAAG------AACGGGGAA------GTGATCGAGGAATGT
Pogonomyrmex_barbatus|13208  CCGTGGGCAAAATGCCCGGAATTG------GACGGAAAA------CCGGTTGAGGAATGT
Bombyx_mori|14533            CCCTGGTCTAGCTGTCCCCAGGAC------AACGGGACA------GCTGAGGCCGAATGC
Culex_quinquefasciatus|18583 CCGTGGTCCACCTGTCCCCAGTTC------AACGGCACC------GACCTGCCCGAGTGC
Drosophila_persimilis|5294   CCCTGGTCAACCTGTCCGACG---------AACGGCACTGGATTCGCGCTTGAAGAGTGC
Drosophila_melanogaster|7282 CCCTGGTCATCTTGTCCATTG---------AACGGCACAGGATTTGAGTTGGAGGAGTGC
Drosophila_yakuba|15996      CCCTGGTCATCTTGCCCCTTG---------AACGGCACCGGTTTTGAGTTGGAGGAGTGC
                                                                                         

Nematostella_vectensis|21556 GGGCTCGCTGGACGTACCCAGTACTACTGGTACCAGAATGCACTAAAAATAGCGCCGACT
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           ACGGCCGCCACCGAAACGGCTTACTTCTGGTACCGGACGGCCCTGGACATTTCGCCGAGC
Pediculus_humanus|8506       GAAGTAAGTTCGGAAACGGCATATTTTTGGTATCGTACCACATTAGACGTCGCACCGAAC
Tribolium_castaneum|7890     GACAAATCCTCCGCCACCGCCTATTTCTGGTACCGCACCACTCTGGACGCCGCCACCAGC
Nasonia_vitripennis|11940    GCCAAGAGCTCGGAGACGGCGTACTTCTGGTACCGCACCACCCTCGACGCGGCACCGTCG
Apis_mellifera|36843         GTGAAGAGTTCGGAAACTGCCTATTTTTGGTACAGAACCACTCTGGACGCGGCACCCTCG
Linepithema_humile|4716      GCCAAGAGTTCGGAGACCGCATATTTTTGGTACAGGGTTACCCTGGACGCGGCACCGTCG
Pogonomyrmex_barbatus|13208  ACCAGGAGTTCGGAGACCGCATATTTTTGGTATAGAACTACTTTGGACGCAGCACCGTCC
Bombyx_mori|14533            AACAAGGCCTCAGCAACAGTTTACTTCTGGTACCGGGAGGCTCTGGACGCGGCGCCCAGC
Culex_quinquefasciatus|18583 GAGCGGTCCTCGGAGACGGCATACTTCTGGTACCGGACCACGCTGGACGCATCGCCCAGC
Drosophila_persimilis|5294   GCCAAGTCGTCGGAGACAACGTACTTCTGGTACCGCACCACCCTGGACGCCGCCCCGTCC
Drosophila_melanogaster|7282 GCCAAATCCTCGGAGACGACGTACTTCTGGTACCGCACCACCTTGGATGCGGCACCGTCC
Drosophila_yakuba|15996      GCCAAATCGTCGGAGACGACGTACTTCTGGTACCGCACCACCTTGGATGCAGCGCCCTCC
                                                                                         

Nematostella_vectensis|21556 ATTGATGAGAGT---GGCGGGCTAGTGTGGCCCATGTGCCTGTCTTTGCTGCTCGCTTGG
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           GTCGACCAGCCG---GAAGGCATCAAGTGGTGGATGGCCCTGTGTCTTCTACTCTCCTGG
Pediculus_humanus|8506       ATTGAAGATCAT---GGTGGTCTCAAATGGTGGATCGTATTGTGTTTAATTTTATCATGG
Tribolium_castaneum|7890     ATCGAAGATCCG---GGGATTCCCCGCTGGTGGATCGTCCTCTGCCTCCTCCTGTCGTGG
Nasonia_vitripennis|11940    ATCGACGACGGC---CAGGGACTCAAGTGGTGGATCGTCCTGTGCCTGCTGCTCAGCTGG
Apis_mellifera|36843         ATCGAGGAAGGATCGAGCGGTCTGAAATGGTGGATTGTCCTTTGTCTACTGTTGAGTTGG
Linepithema_humile|4716      ATCGAGGACGGC---CAAGGTCTCAAGTGGTGGATCGTACTTTGCCTCTTGCTCAGCTGG
Pogonomyrmex_barbatus|13208  ATTGAGGACGGC---CAAGGTCTGAAATGGTGGATCGTACTTTGTCTTTTGTTCAGCTGG
Bombyx_mori|14533            ATCGAGGACCCG---GGGGTGCCGCGCTGGTGGATCGTGCTCTACTTACTTCTCGCTTGG
Culex_quinquefasciatus|18583 ATCGAGGAACCG---GAGGGCTTCAAGTGGTGGATCGTGCTCTGCCTGCTGCTGTCCTGG
Drosophila_persimilis|5294   ATGGACGAGCCC---GGCGGCCTCAAGTGGTGGATTGTGCTCTGCCTGATGCTCTCCTGG
Drosophila_melanogaster|7282 ATGGATGAGCCT---GGTGGCCTCAAGTGGTGGATCGTGCTCTGCCTGATGCTGTCCTGG
Drosophila_yakuba|15996      ATGGATGAGCCC---GGTGGCCTCAAGTGGTGGATCGTGCTCTGCCTGATGCTGTCCTGG
                                                                                         

Nematostella_vectensis|21556 ATCGTCGTCTTTTTGTGTATGATGAAAGGCGTGCAGTCTGCAGGCAAGGCTGTGTATTTC
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           ATCATCGTCTACTTCATCACGATGCGAGGCATCCAATCTTCCGGAAAGGTTGTCTATTTC
Pediculus_humanus|8506       ATCACCGTTTTCTTTATCGTTATGAAGGGAATACAAAGTTCTGGAAAGGTTGTGTATTTT
Tribolium_castaneum|7890     ATCATCGTGTTCTTCATTGTGATGAAAGGCATCCAAAGCTCGGGAAAAGTCGTCTACTTC
Nasonia_vitripennis|11940    TTCGTCGTCTTCTGCATCATGATGAAGGGCATCCAGTCGTCGGGCAAGGTCGTCTACTTC
Apis_mellifera|36843         ATCGTCGTCTTTTTTATCGTGATGAAAGGAATACAATCATCGGGGAAGGTGGTATATTTT
Linepithema_humile|4716      ATCGTCGTCTTCTTCATCGTAATGAAGGGAATACAATCGTCCGGCAAAGTGGTATACTTT
Pogonomyrmex_barbatus|13208  ATTGTCGTGTTCTTCATTGTCATGAAAGGAATACAATCGTCCGGCAAGGTGGTGTACTTT
Bombyx_mori|14533            GTTATCGTGTTCTGCATAGTGATGAAGGGAATCCAGAGTAGCGGGAAGGTGGTGTACTTC
Culex_quinquefasciatus|18583 ACGGTGGTGTTCTTCATCGTGATGAAGGGCATCCAGAGCTCGGGCAAGGTGGTCTACTTT
Drosophila_persimilis|5294   ACCATCGTCTTCTTCATCGTGATGAAGGGCATCCAGAGCTCCGGCAAGGTGGTCTACTTC
Drosophila_melanogaster|7282 ACCATTGTCTTCTTCATCGTAATGAAGGGCATCCAGAGCTCCGGCAAGGTTGTCTACTTC
Drosophila_yakuba|15996      ACCATTGTCTTCTTCATCGTGATGAAGGGCATCCAAAGCTCCGGCAAGGTGGTCTACTTC
                                                                                         

Nematostella_vectensis|21556 ACCGCGACGTTCCCTTATCTAGTTCTCATCATCTTCTTCGGTCGTGGCGTCACTCTAGAG
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           ACGGCGCTCTTCCCCTACGCCGTTCTCACCATCTTTTTCATCAGAGGCATCACCCTCAAG
Pediculus_humanus|8506       ACTTCCATGTTTCCTTACATCGTTTTGACAATATTTTTCGTCAGGGGTATTACGTTAAAA
Tribolium_castaneum|7890     ACCTCCATGTTCCCTTACCTCGTTCTGACAATATTCTTCATCCGGGGAATCACCCTGAAA
Nasonia_vitripennis|11940    ACATCCTTGTTCCCATACCTGGTACTCACCATCTTCTTTATTCGCGGGATAACTCTCAAA
Apis_mellifera|36843         ACATCCATGTTCCCGTATTTGGTGCTTACTATCTTTTTTATTCGTGGAATAACGTTAAAA
Linepithema_humile|4716      ACGTCCATGTTCCCGTATCTCGTGCTGACCATCTTTTTCATTCGCGGGATAACGTTGAAA
Pogonomyrmex_barbatus|13208  ACGTCCATGTTCCCGTATCTCGTACTGACCATCTTCTTCATCCGCGGAATAACGTTGAGG
Bombyx_mori|14533            ACGTCTCTGTTTCCGTACGTGGTCCTGACCATCTTCTTCATCAGAGGCATCACGTTGCCT
Culex_quinquefasciatus|18583 ACGTCGCTGTTTCCGTACATCGTGCTGACCATCTTCTTCATCCGCGGGATCACGCTGGAA
Drosophila_persimilis|5294   ACCTCGCTCTTCCCCTACATCGTCCTCACCATATTCTTCATCCGCGGCATAACCCTGCGC
Drosophila_melanogaster|7282 ACCTCGCTCTTTCCCTACATTGTGCTGACCATCTTCTTCATTCGCGGCATCACGTTGAGA
Drosophila_yakuba|15996      ACCTCCCTCTTCCCCTACATCGTGCTGACCATCTTCTTCATTCGCGGCATCACGTTGCGA
                                                                                         

Nematostella_vectensis|21556 GGAGCCGGACCAGGCGTCGCGCACATGTTCAAACCACAGTTTGAAAAGCTGGCGGACCCT
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           GGAGCTGGCGCTGGACTAGCGCACATGCTACAACCACAAATGCACAAATTATTGGACCCG
Pediculus_humanus|8506       GGATCGGGTGCTGGTTTAATGCACATGTACACTCCCAAGGTAGAAAAATTATCTGATCCC
Tribolium_castaneum|7890     GGCGCCAGCGCCGGCTTAGCCCACATGTACACCCCCAAAGTCGAGAAACTCCTCGACCCG
Nasonia_vitripennis|11940    GGTGCCGACGCGGGACTCGCTCACATGTACACGCCCAAGGTCGAAAAGCTGCTGGAGCCG
Apis_mellifera|36843         GGTGCCAGCGCTGGATTGGCCCACATGTACACGCCAAAGATCGAGAAGCTGTTAGAGCCG
Linepithema_humile|4716      GGCGCGAGCGCCGGACTGGCGCACATGTACACACCGAAGGTCGAGAAACTGTTGGAACCT
Pogonomyrmex_barbatus|13208  GGTGCGAGCGCCGGACTGGCGCACATGTACACGCCAAAGGTCGAGAAACTGTTGGAGCCC
Bombyx_mori|14533            GGCTCCTCGGACGGGATCCTTCATATGTACAAGCCGAAGCTGGAAAAACTTCTGGATCCA
Culex_quinquefasciatus|18583 GGGGCTGGGGCGGGCTTGATGCACATGTACACGCCCAAGGTGGAGAAGCTACTGGAACCG
Drosophila_persimilis|5294   GGCGCTGGCGCTGGTCTAATGCACATGTACACGCCGAAGGTGGAAAAGCTGCTGGAGCCA
Drosophila_melanogaster|7282 GGAGCGGGCGCTGGACTGATGCACATGTATACGCCAAAGGTGGAAAAATTACTGGAGCCC
Drosophila_yakuba|15996      GGCGCGGGCGCCGGACTGATGCACATGTATACGCCGAAGGTGGAAAAGTTACTGGAGCCC
                                                                                         

Nematostella_vectensis|21556 CGCGTGTGGCTCGAGGCAGCCACGCAAATCTTCTACTCTCTGGGCGTGGCATTCGGTGGT
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           ACCGTCTGGCTGGACGCGGCCACCCAGGTTTTTTATTCGTTCAACATCGGGTTCGGCTCG
Pediculus_humanus|8506       ACCGTTTGGATGGATGCTGCAACCCAAGTTTTTTATTCATTTGGACTCGCGTTTGGATCT
Tribolium_castaneum|7890     AAAGTGTGGCTCGAAGCTGCCACCCAAGTGTTTTACTCTTTTGGGTTGGCTTTCGGGTCA
Nasonia_vitripennis|11940    ACCGTCTGGTTGGACGCTGCGACGCAAGTGTTTTACAGCTTTGGACTAGCTTTCGGGTCT
Apis_mellifera|36843         ACGGTCTGGCTCGACGCAGCGACGCAAGTTTTTTATAGTTTCGGACTAGCGTTCGGCTCA
Linepithema_humile|4716      ACGGTCTGGCTTGATGCGGCGACTCAGGTCTTCTATAGCTTCGGGCTGGCGTTCGGTTCC
Pogonomyrmex_barbatus|13208  ACGGTCTGGCTTGACGCGGCGACCCAGGTCTTCTATAGCTTCGGACTGGCGTTCGGTTCC
Bombyx_mori|14533            ACCGTCTGGTTGGATGCGGCCACTCAAGTGTTCTATTCCTTCGGTCTGGCTTTCGGTTCG
Culex_quinquefasciatus|18583 ACGGTGTGGCTGGACGCGGCCACGCAGGTGTTTTACTCGTTTGGGTTGGCGTTCGGGTCG
Drosophila_persimilis|5294   ACGGTGTGGCTGGACGCGGCCACCCAGGTCTTTTACTCGTTTGGCCTCGCCTTCGGCTCG
Drosophila_melanogaster|7282 ACCGTTTGGCTGGATGCAGCCACACAGGTCTTTTACTCCTTTGGCCTGGCCTTTGGATCC
Drosophila_yakuba|15996      ACGGTTTGGCTGGACGCGGCCACGCAGGTCTTCTACTCCTTTGGCCTGGCCTTTGGATCT
                                                                                         

Nematostella_vectensis|21556 CTGATCGCCATGTCGAGCTATAACCCCGTGCATAATAACTGCCTTCGTGACGCCGTCATG
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           CTCATCGCCTTCGGCAGTTACAACCCGCCGCGCAACAATTGCGTCAAAGACACACTCATC
Pediculus_humanus|8506       CTAATTGCATTCGGATCGTACAATACTCCGAAAAATAATTGCGTGAGAGATGTTATATTG
Tribolium_castaneum|7890     CTGATCGCTTTCGGGTCGTACAACACGCCGAAGAATAATTGCGTCCGGGACGTGATTCTA
Nasonia_vitripennis|11940    CTGATAGCCTTCGGCAGCTACAACACGCCCGAGAATAACTGTGTGCGAGATGTGATCCTT
Apis_mellifera|36843         CTGATCGCGTTCGGATCTTACAACACTCCAGACAACCACTGCGTCCGGGACGTGATTCTG
Linepithema_humile|4716      CTGATCGCGTTCGGCAGCTACAACACTCCGAATAACAACTGCGTTCGGGACGTGATCCTG
Pogonomyrmex_barbatus|13208  CTGATCGCGTTCGGCAGCTACAACACTCCTGACAACAACTGCGTGAGGGACGTGATCCTG
Bombyx_mori|14533            CTGATCGCGTTCGGCTCGTACAACCCTCCCAACAACAACTGCGTGAGGGATGTGCTCCTC
Culex_quinquefasciatus|18583 TTGATCGCGTTCGGCAGTTACAATACGCCGAAGAACAACTGCGTGCGGGATGTCATTCTG
Drosophila_persimilis|5294   CTAATAGCCTTCGGGAGCTACAACACGCCGAAGAACAACTGCGTCCGCGACGTCCTGCTG
Drosophila_melanogaster|7282 CTGATCGCCTTCGGGAGCTACAACACGCCGAAGAACAACTGCGTGCGGGATGTGCTCCTG
Drosophila_yakuba|15996      CTGATCGCCTTCGGCAGCTACAACACGCCCAAGAACAACTGTGTGCGGGATGTGCTCCTG
                                                                                         

Nematostella_vectensis|21556 GTATCGCTCATCAACTGCGGCACGTCTGTCTTCGCGAGTATCGTCATCTTTTCCATTCTC
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           CTGTCCGTCTGCAACGCGGCCACGGCCGTCTACGCCAGCGTCGTCATCTTCGCCATTCTC
Pediculus_humanus|8506       GTATCCATTTGCAACGCAGCAACAGCAATCTATGCTAGCGTTGTCGTTTTTGCCATTTTA
Tribolium_castaneum|7890     GTGTCAGTTTGTAACGCCTTCACTGCGATTTACGCCAGCGTGGTAATTTTTGCCATTTTG
Nasonia_vitripennis|11940    GTCAGCGTCTGCAATGCATTCACAGCCATCTACGCCAGTGTCGTGATCTTCGCTATCCTA
Apis_mellifera|36843         GTTAGCTGTTGCAACGCCTTCACCGCAATTTACGCGAGTATCGTGATATTCGCCATTCTA
Linepithema_humile|4716      GTGAGCGTGTGCAACGCGTTTACTGCCATTTACGCGAGCGTTGTCATTTTCGCCATTTTG
Pogonomyrmex_barbatus|13208  GTGAGCGTGTGCAACGCGTTTACTGCCATTTACGCGAGCGTTGTCATTTTCGCCATTTTG
Bombyx_mori|14533            GTGTCCGTCTGCAACGCCCTCACCGCCATCTACGCCTCCGTGGTCATCTTCAGCATCCTC
Culex_quinquefasciatus|18583 GTGTCGGTGTGTAATGCCTTCACGGCGGTCTACGCCAGCGTCGTGATCTTCGCCATCCTC
Drosophila_persimilis|5294   GTGTCCGTCTGCAATGCAGTCACAGCCATCTACGCGAGTGTCGTCATCTTCGCCATTCTC
Drosophila_melanogaster|7282 GTGTCCGTGTGCAATGCAGTTACGGCTATCTACGCCAGCGTGGTCATCTTCGCCATTCTG
Drosophila_yakuba|15996      GTGTCCGTGTGCAATGCGGTTACGGCCATCTACGCCAGCGTGGTTATCTTTGCCATTCTG
                                                                                         

Nematostella_vectensis|21556 GGATTCAAGGCGCACGAGACCTTCACCGAGTGTATCGAGCTCTACACCAAG---------
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           GGCTTCAAGGCCGTCCGCTCTTACGACCTCTGCGTCAACCAGTCAGTTATTATATCTCTT
Pediculus_humanus|8506       GGATTTAAAGCCATGTTGAACTACGACAGATGCATTGATGGTAATAAAATCAAACTCGTA
Tribolium_castaneum|7890     GGGTTCAAAGCTGTGAGCAATGTTGACAAATGTTTGGAGCACAATATACAGTTTTTGATC
Nasonia_vitripennis|11940    GGCTTTAAGGCCATGTCCAACGTAGACAAGTGCCTTGAAAACAATCGAAACTGGCTCGTC
Apis_mellifera|36843         GGCTTTAAGGCGATGACAAATGTCGATAAGTGCCTCGCAGGTAATAAAGACTTACTCGTT
Linepithema_humile|4716      GGGTTCAAGGCAATGTCAAACGTGGAGAAGTGCGTTGTCAGCGCGAGGGACACCCTGGTA
Pogonomyrmex_barbatus|13208  GGGTTCAAGGCAATGTCAAACGTGGACAAGTGCGTCGTCAGCGCAAGGGATACTCTGATA
Bombyx_mori|14533            GGCTTCAAGGCGTACACCATGGTCGAAACCTGCATTACGAAGGAAATTAAAGTGCTGGCT
Culex_quinquefasciatus|18583 GGGTACAAGGCCACCGTCGGAGTGGATCGGTGTATCACGGTGAACAAACACATCCTGATC
Drosophila_persimilis|5294   GGCTTCAAGGCCACCATGAACGTGGATCGCTGTGTGGCAAGCAACACGGACATCCTCGTT
Drosophila_melanogaster|7282 GGCTTCAAGGCCACCGTCAATGTGGACCGTTGTGTAGCCAGTAACACGGAAATCCTGGTG
Drosophila_yakuba|15996      GGCTTCAAGGCCACCGTCAATGTGGATCGTTGTATAGCCAGTAACACGGAAATCCTGGTG
                                                                                         

Nematostella_vectensis|21556 ------------------------------GACAATGTGACGTTACCAGGCAACCAGACT
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           CATTCCATTTTCAAAATTATTGAT------AACTTTTTGACTGACGAGGCCTACGCCAAT
Pediculus_humanus|8506       TCTCATCAAATTATTCCAAGC---------GTTAACATAAGCGAATCCGAATACGATTTG
Tribolium_castaneum|7890     AGCAATGGGCACTTTGCAAATGCAAAAGTGGCCGATATTTCGACGACGATGTACGAGGAA
Nasonia_vitripennis|11940    GAGCACGGCTTTCTTCTC------------GCCAACGCCACGAGCGAACAGTTCGACAGC
Apis_mellifera|36843         CAACACGGATTTGCCTAT------------CAGAACACCAGCATGGAGAGATACAAGGAT
Linepithema_humile|4716      CATAATGGGCTCTTGAATAGCACC------ATGCCGTTCGCCCTCGAGGACTACGAACGC
Pogonomyrmex_barbatus|13208  GAAAATGGAAAATGGAGTAATTCC------ACCCCATTCAACCTCGAGGACTATGAACTC
Bombyx_mori|14533            CTCAACCACATCGGCGGGTTCACG------CTCAACTCCACTCAAGATTACTACCGCGAG
Culex_quinquefasciatus|18583 AAGCACGGGTTGCTTCCGTCG---------GTTCACGTGGACAATGCCGAGTACGAACGG
Drosophila_persimilis|5294   AGGCATGCGTTTCTGGAAAAC---------AAGAACGCCACCACCCTGGAGTACGAGCAT
Drosophila_melanogaster|7282 AAAAACAAACTGCTGGGCCTGAAT---------------GACACACAGGGCTACGAGCAA
Drosophila_yakuba|15996      AAGAACAAACTGCTGGGCCTGAAT---------------GACACACAGGGCTATGAACAA
                                                                                         

Nematostella_vectensis|21556 GTCGGCGAGGCATGCAAG------------------------------------ACGCTG
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           TTCCTGCAGTACCGCGACGAGTCC------AAAGACCTGGGACTGCGAGGTTGCAACCTG
Pediculus_humanus|8506       ATTCTTCGTGAA---AAAGTCACAAACCATACGATGTATGATTTGGAAGAATGCAGTCTG
Tribolium_castaneum|7890     GCGGTTAAAAATTTAAACAACTCG------ACTTTAGCGCAACTTCGGACTTGTTCGTTA
Nasonia_vitripennis|11940    GCCGTCAAACGCTTCAATTCTTCCATT---GATAACAATACGCTAAGCGAATGCAGTTTG
Apis_mellifera|36843         ATTGTAAATAATCTGAATGAAACAAAA---ATGAATTTCACCCTTGAAACGTGTAGCCTG
Linepithema_humile|4716      TTTATGAAGACCTTCAACTCTTCGGCA---GTGAACTTCACAATGAGACCGTGTAGTCTC
Pogonomyrmex_barbatus|13208  TTTATGGGCGATTTCAATTCCTCGGCA---ATGAACTTCACAATGAAACCATGCAGTCTC
Bombyx_mori|14533            GAGTATCCGAAGCTGAACGAGACCCTCGTGGCTGCCTTCAACTTGACCGGCTGCACCATG
Culex_quinquefasciatus|18583 GTTATGCACGGGCTGGACCCGGTTGCGTCGGCCAACTGGACGTTGGAGCACTGCAGTCTT
Drosophila_persimilis|5294   GCGATGGACAAGCTGAAAGACACGGAGAAGACCCTCTTTCAGATGAGCGAGTGCACCCTA
Drosophila_melanogaster|7282 GCCATGAGTCTACTGAATGGCACTGAGTTGCTCCGCCTGCAATTGAGCGAATGCAGCTTG
Drosophila_yakuba|15996      GCCATGAATCAACTAAATGGCAGTGAGTTCGTCCGTTTGCAATTGAGCGAGTGCAGCTTG
                                                                                         

Nematostella_vectensis|21556 GAATACTGGCTTGGTCAG------------------------------------------
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           GAAGAAATCATGAACGAG------------------------------------------
Pediculus_humanus|8506       GAGAAAGAATTGGATCAG------------------------------------------
Tribolium_castaneum|7890     GAGGACGAACTGAGCGGA------------------------------------------
Nasonia_vitripennis|11940    AGCGAACAACTCGACAAC------------------------------------------
Apis_mellifera|36843         AGCGAACAATTGGACAAC------------------------------------------
Linepithema_humile|4716      GCCGAGGAACTGAACAGC------------------------------------------
Pogonomyrmex_barbatus|13208  AGTAAGGAGTTGGACAAC------------------------------------------
Bombyx_mori|14533            AGCCGACAACTAGATGAGGTGATTCCCGAATTTTTCGTGTTCGAACGTGCAATACACAAT
Culex_quinquefasciatus|18583 GAAGATCAGCTGGATAGT------------------------------------------
Drosophila_persimilis|5294   TCCAAGGAGCTGGACAAT------------------------------------------
Drosophila_melanogaster|7282 GCCCACGAACTGGACAAT------------------------------------------
Drosophila_yakuba|15996      GCCCACGAACTGGACAAT------------------------------------------
                                                                                         

Nematostella_vectensis|21556 ---------------------------------TCTGCAGAGGGGCCTGGTCTGACTTTC
Nematostella_vectensis|14549 ---------------------------------------GAGGGGCCTGGTCTGACTTTC
Daphnia_pulex|1357           ---------------------------------TCGGTGGAAGGGACGGGTCTGGTGTTC
Pediculus_humanus|8506       ---------------------------------GCTGCTGAAGGTACTGGATTGGCATTC
Tribolium_castaneum|7890     ---------------------------------GCCGCCCAAGGAACTGGTTTAGCCTTC
Nasonia_vitripennis|11940    ---------------------------------GCTGCCGAAGGCACGGGACTGGCGTTC
Apis_mellifera|36843         ---------------------------------GCTGCCGAAGGAACGGGATTAGCTTTC
Linepithema_humile|4716      ---------------------------------GCCGCCGAGGGTACCGGGCTGGCTTTC
Pogonomyrmex_barbatus|13208  ---------------------------------GCTGCCGAGGGCACTGGACTGGCATTT
Bombyx_mori|14533            CCTACTAATCCTACTAATATTATAAACGCGAAAGCTGCCGAAGGTACAGGGCTGGCCTTC
Culex_quinquefasciatus|18583 ---------------------------------GCCGCCGAGGGCACCGGTCTCGCCTTC
Drosophila_persimilis|5294   ---------------------------------GCCGCCGAGGGAACGGGCTTGGCCTTC
Drosophila_melanogaster|7282 ---------------------------------GCTGCCGAGGGCACCGGTTTGGCCTTC
Drosophila_yakuba|15996      ---------------------------------GCTGCTGAGGGCACTGGGCTGGCCTTC
                                                                     *.** .* **  * .  ** 

Nematostella_vectensis|21556 ATTGCGTTCACCGAGGCGATCGTCAAGATGCCCGCACTCTCGCCACTTTGGGCCACGCTC
Nematostella_vectensis|14549 ATTGCGTTCACCGAGGCGATCGTCAAGATGCCCGCACTCTCGCCACTTTGGGCCACGCTC
Daphnia_pulex|1357           ATCGTCTTCACGCAGGCCATCGTCGAGCTACCGGCG---GCCCCGTTCTGGGCCATTCTC
Pediculus_humanus|8506       GTCGTTTTCACGCAAGCAATTGTCGAGTTACCCGGA---GCTCCATTTTGGAGTGTGATA
Tribolium_castaneum|7890     ATCGTGTTCACCCAAGCCATCGTCGAGCTTCCAGGT---GCTCCTTTTTGGGCTGTGATA
Nasonia_vitripennis|11940    ATAGTTTTCACGCAAGCCATCGTCGAGCTTCCTGGG---GCGCCGTTTTGGTCCTGTATC
Apis_mellifera|36843         ATAGTGTTCACACAGGCGATAGTCGAGCTACCAGGC---GCTCCTTTCTGGTCCTGTATT
Linepithema_humile|4716      ATCATATTTACACAGGCGATCGTGGAGCTGCCGGGC---GCGCCGTTCTGGTCTTGCATC
Pogonomyrmex_barbatus|13208  ATCATATTTACCCAGGCGATCGTGGAACTACCGGGG---GCGCCATTCTGGTCTTGCATC
Bombyx_mori|14533            ATAGTGTTCACGCAGGCGATTCTGAAGCTGACTCCA---GCTCCGTTCTGGTCCATAATC
Culex_quinquefasciatus|18583 ATTGTCTTCACCCAGGCAATCGTGCAGCTCCCAGGA---GCGCCCTTCTGGGCGGTTCTC
Drosophila_persimilis|5294   ATCGTGTTCACCCAGGCAATTGTGGAGCTGCCGGGC---AAACCCTTCTGGGCCGTGCTC
Drosophila_melanogaster|7282 ATCGTATTCACCCAGGCCATCGTGGAGCTGCCCGGT---GCTCCATTCTGGGCCGTCCTT
Drosophila_yakuba|15996      ATCGTGTTCACCCAGGCCATCGTGGAGCTGCCCGGC---GCTCCCTTCTGGGCCGTGCTC
                             .* .  ** **  *.** **  *  *. * .*        . **  * ***      .* 

Nematostella_vectensis|21556 TTCTTCTGCATGCTTCTCACCCTTGGCCTCGGCTCCATGTTTGGGACCCTGGAGGGCGTG
Nematostella_vectensis|14549 TTCTTCTGCATGCTTCTCACCCTTGGCCTCGGCTCCATGTTTGGGACCCTGGAGGGCGTG
Daphnia_pulex|1357           TTCTTTCTGATGTTGCTGGCCCTGGGCGTCGGCTCCCAGATCGGCACGCTCGAAGGCGTC
Pediculus_humanus|8506       TTTTTCATGATGCTTCTTTCCCTCGGAATTGGATCTCAAATAGGAATTCTCGAGGGAATG
Tribolium_castaneum|7890     TTCTTCTTGATGCTCCTTTCCCTTGGAATTGGCTCGCAGATCGGCATTTTGGAAGGAATG
Nasonia_vitripennis|11940    TTCTTCTTGATGCTCCTAGCGCTCGGGCTAGGTTCGCAGATTGGTCTTCTCGAAGGGATG
Apis_mellifera|36843         TTCTTTCTGATGCTTCTAGCCCTAGGTCTCGGTTCCCAAATCGGTATACTGGAGGGCATG
Linepithema_humile|4716      TTCTTCCTCATGCTTCTCGCCCTTGGTCTGGGCTCGCAAATCGGAATACTCGAAGGCATG
Pogonomyrmex_barbatus|13208  TTCTTCATGATGCTTCTAGCTCTTGGATTGGGCTCGCAAATCGGTCTACTCGAGGGTATG
Bombyx_mori|14533            TTCTTTCTGATGCTGCTGTCCCTGGGTCTGGGCAGCCAGATTGGTATCATGGAAGGGATG
Culex_quinquefasciatus|18583 TTCTTTACGATGCTGTTATCGCTCGGACTCGGTTCCCAGATCGGCATCCTGGAGGGTATG
Drosophila_persimilis|5294   TTCTTCACCATGCTGCTGCCAACTGGGACTGGGCTCGCAGATCGGCATCTGGAGGGCATG
Drosophila_melanogaster|7282 TTCTTCACCATGCTGCTGTCGCTGGGACTGGGATCACAGATCGGCATCCTGGAGGGCATG
Drosophila_yakuba|15996      TTCTTCACCATGCTGCTGTCGCTGGGACTGGGATCACAGATCGGCATCCTGGAGGGCATG
                             ** **    *** *  *  * .  **    **      . :  * .   * **.** .* 

Nematostella_vectensis|21556 ATTACCCCCGTGTACGACGCCAAACTTGTGTCG---TGGAGAAAGGAGTTTGTCTCGGGC
Nematostella_vectensis|14549 ATTACCCCCGTGTACGACGCCAAAATTGTGTCG---TGGAGAAAGGAGTTTGTCTCGGGC
Daphnia_pulex|1357           ATCAGCACCGTCTTTGACATTCAGATAGTCCGCGGAGCCCGCAAGGAAGTCGTCTCCGCC
Pediculus_humanus|8506       TTATGCACCATTTTCGATATAGAAATATTCAAACGGATAAAAAAACAATATTTAACCGGT
Tribolium_castaneum|7890     CTTTGTACCATCTTTGATATCGAGATCCTCAAAAGAATCAGAAAGCAGTACATCACAGCG
Nasonia_vitripennis|11940    CTGTGCGTCGTATTCGAAATAGATCTGTTCAAGAGAATAAAAAAGCAGTACATAACAGGT
Apis_mellifera|36843         CTGTGCGTCATCTTCGACATAGATCTGTTCAAGAGAATAAAAAAGCAATATATGACAGGG
Linepithema_humile|4716      CTGTGCGTAATCTTCGACATAGATCTTTTCAAAAGAATAAAAAAGCAATACATGACGGGA
Pogonomyrmex_barbatus|13208  CTGTGCGTCATCTTCGATATAGATCTCTTCAAGAGAATAAAAAAGCAATATATGACAGGT
Bombyx_mori|14533            CTGTGCACCATTTTCGATATTGACTTCTTCAAACGACTCAGCAAGCCAGTTATAACCGGA
Culex_quinquefasciatus|18583 CTGTGTACGATATTCGACATCGACATCTTCAAGCGGATTCGGAAACCGTACGTGACGGGT
Drosophila_persimilis|5294   ------------------------------------------------------------
Drosophila_melanogaster|7282 CTGTGCACCCTCTTCGACATTGACATTATCAAGCGGGTTAAGAAACAGCATGTCACTGGC
Drosophila_yakuba|15996      CTGTGCACCCTCTTCGACATTGACATTATCAAGCGGGTTAAGAAACAGCATGTCACTGGC
                                                                                         

Nematostella_vectensis|21556 GCCATCTGTCTCGTGTCGTTCCTGCTTGGACTGCTGTTCTGTCAGAATTCGGGCGAGTAC
Nematostella_vectensis|14549 GCCATCTGTCTCGTGTCGTTCCTGCTTGGACTGCTGTTCTGTCAGAATTCGGGCGAGTAC
Daphnia_pulex|1357           GCCGTGTGCATCGTCAGTTACCTGATCGGCCTGCTGTTTGTGACCGGCTCTGGCGAGTAC
Pediculus_humanus|8506       TTCGTCTGTTTGATTTGCTGCATTGTAGGATTATTGTTTTGCACTGGAGCCGGTGAATAT
Tribolium_castaneum|7890     TTCGTCTGTGTCGTCTGCTTCTGCATCGGCATGATCTTCACAACAGGAGCTGGCGAATAT
Nasonia_vitripennis|11940    GTCCTATGCTTGTTCTGCTTCTTCGTGGGATTGATATTCTGTACAGGAGCTGGAGAGTAT
Apis_mellifera|36843         GTAGTTTGCACGGTGTGCTTCTTTGTTGGTTTAATATTCTGTACCGGAGCCGGAGAATAT
Linepithema_humile|4716      GTCGTTTGCGTCGTGTGCTTTTTCGTCGGGCTTATCTTCTGCACCGGTGCCGGAGAGTAC
Pogonomyrmex_barbatus|13208  GTTGTCTGTGTTGTATGCTTCTTTGTGGGACTTATCTTTTGTACTGGTGCTGGAGAGTAT
Bombyx_mori|14533            ATTGTCTGCTCGTTCTGTTTCCTCGTCGGTCTGATCTTCACGACCGGAGCCGGGGAGTAC
Culex_quinquefasciatus|18583 GTGGTCTGCGTGTTCTGCTTCTCGATCGGATTGATCTTCACCACCGGAGCCGGTGAGTAC
Drosophila_persimilis|5294   ------------------------------------------------------------
Drosophila_melanogaster|7282 GTGGTGTGTCTCTTCTGCTTCATTGTCGGTTTCATCTTCTGCACAGGTGCCGGGGAGTAC
Drosophila_yakuba|15996      GTGGTGTGTCTCTTCTGCTTCATTGTCGGTTTCATCTTCTGCACAGGTGCCGGGGAGTAC
                                                                                         

Nematostella_vectensis|21556 TGGCTGCAGATGTTCGACTCGTTCTCTGGAACCCTCCCCCTCCTTGTCATCGGAATGCTG
Nematostella_vectensis|14549 TGGCTGCAGATGTTCGACTCGTTCTCTGGAACCCTCCCCCTGCTTGTCATCGGAATGCTG
Daphnia_pulex|1357           TGGGTCAAGATCTTCGACTCGTTCGCCGGAACCACCGGATTGATCTTTATCGCCCTCCTA
Pediculus_humanus|8506       TGGTTAAAACTTTTCGATTCATTTGCTGGAACTATCGGTTTAGTATTTTTAGCACTTTTA
Tribolium_castaneum|7890     TGGCTGAAGATGTTTGATTCATTCGCCGCCACCATCGGACTGGTCCTTGTGGCACTGATG
Nasonia_vitripennis|11940    TGGCTCAAAATGTTTGATAGCTTTGCTGGCACTATCGGCCTCGTACTGGTCGCGCTGATG
Apis_mellifera|36843         TGGCTAAAGATGTTCGACAGTTTCGCAGGTACCATCGGCCTCGTGATGGTCGCGCTCATG
Linepithema_humile|4716      TGGCTGAAGATGTTCGACAGCTTCGCAGGTACCATCGGTCTTGTCATGGTCGCGCTCATG
Pogonomyrmex_barbatus|13208  TGGTTGAAAATGTTCGACAGCTTTGCCGGTACCATCGGTCTCGTCATTGTCGCCCTGATG
Bombyx_mori|14533            TGGCTGAAGATGTTTGATTCGTTCGCCGGCACCATAGGCCTGGTGGTCGTCGCTCTGCTG
Culex_quinquefasciatus|18583 TGGCTCAAGATGTTCGACTCGTTCGCTGGAACGATCGGGTTGGTCGTGGTGGCTCTCATG
Drosophila_persimilis|5294   ------------------------------------------------------------
Drosophila_melanogaster|7282 TGGCTCAAGATGTTCGACTCTTTTGCCGGCACCATTGGTCTCGTGGTGGTGGCGCTGATG
Drosophila_yakuba|15996      TGGCTCAAGATGTTCGACTCTTTTGCCGGCACCATTGGCCTCGTCGTGGTGGCGCTAATG
                                                                                         

Nematostella_vectensis|21556 GAAATGATCGGAGTGTGCTGGGTGTACGGATCCAAGAGGTTTGAGGACGATATCGAATAC
Nematostella_vectensis|14549 GAAATGATCGGAGTGTGCTGGGTGTACGGATCCAAGAGGTTTGAGGACGATATCGAATAC
Daphnia_pulex|1357           GAGTCCGTCGCCGTCATGTACATTTACGGACACCGAAAATTCTCGCAAGACATCCTGCAG
Pediculus_humanus|8506       GAAACGTTTGCTGTCATGTACGTGTACGGTCACGCCAAGTTTACTCAAGATATCGAAGAT
Tribolium_castaneum|7890     GAGATGATTTCCGTGATTTATGTTTACGGACACGAGAAATTTACGAAGGATATTCAAGAT
Nasonia_vitripennis|11940    GAAATGCTGGCGGTCGTCTACGTTTACGGGCACAAAAAGTTCACGCAAGATATCGAAGAC
Apis_mellifera|36843         GAAATGATTTCCGTCATCTTTGTTTATGGCCACGAAAAATTCACGAAAGATATAGAAGAG
Linepithema_humile|4716      GAGATGATCTCCGTGGTCTTCGTGTACGGCCATGAAAAATTCACGAAAGACATCGAGGAG
Pogonomyrmex_barbatus|13208  GAAATGATCTCCGTTATCTTCGTTTATGGCCACGAAAAATTTACGAAGGACATCGAAGAG
Bombyx_mori|14533            GAGATGGTCTCCGTGATCTACATATACGGACACGAAAGGTTCAGCAACGATATATACGAG
Culex_quinquefasciatus|18583 GAGACCATTGCCGTCATCTACATTTACGGACACAAGAAGTTCACTGAGGACATCTACCAA
Drosophila_persimilis|5294   ------ATCGCCGTTATCTTTATCTACGGACACGAGCGCTTCACTGAGGACATCTATCAG
Drosophila_melanogaster|7282 GAGATGATAGCCGTGATCTTTATCTACGGACACGAGCGCTTCACCGAGGACATTTTCCAG
Drosophila_yakuba|15996      GAGATGATAGCCGTCATATTTATCTACGGACACGAGCGCTTCACAGAGGACATTTACCAG
                                    *    **    *  .* ** **  .    .. **     * ** **  :  * 

Nematostella_vectensis|21556 ATGATCAGCAAGCGGCCTAACTGGTACTTCAAGATCACGTGGAGGTACGAGGCACCGGTC
Nematostella_vectensis|14549 ATGATCAGCAAGCGGCCTAACTGGTACTTCAAGATCACGTGGAGGTACGAGGCGCCGGTC
Daphnia_pulex|1357           ATGACGGGTCACATGCCCGGGCCGTACTGGCAGATCACATGGCGTTTTGTCGGCCCCGTA
Pediculus_humanus|8506       ATGACTGGTTACAGACCAGGATGGTACTGGCAAATAACGTGGAGATTTATAGGTCCCATT
Tribolium_castaneum|7890     ATGACCGGGATTAAGCCGGGGGTGTATTGGCAGCTGACTTGGAGGTTCTTAGCGCCGATT
Nasonia_vitripennis|11940    ATGACTGGCTACAGACCAGGTTTATATTGGCAAATAACTTGGAAGTACCTGGCTCCAGTA
Apis_mellifera|36843         ATGACAGGATACAGACCAGGGGCGTATTGGCAATTCACCTGGCGATTTCTCGCTCCTATA
Linepithema_humile|4716      ATGACCGGATATAGGCCAGGGGCTTATTGGCAGATCACGTGGCGATTTCTCGCCCCCATT
Pogonomyrmex_barbatus|13208  ATGACTGGATATAAACCGGGACCTTACTGGCAATTTACGTGGCGATTTCTCGCTCCCATT
Bombyx_mori|14533            ATGACCGGCTACCGGCCCGGGCTGTACTGGCAGGTGACTTGGCGCTACGTGGGGCCCTTC
Culex_quinquefasciatus|18583 ATGACTGGAGTCCGACCTGGAATCTACTGGCAGATGACGTGGAGGTACATCGGTCCGGTG
Drosophila_persimilis|5294   ATGACTGGCTACAGACCCGGCCTCTACTGGCAGCTTACATGGCGCTACATTGGGCCCGTA
Drosophila_melanogaster|7282 ATGACTGGCTACCGACCTGGTCGTTACTGGCAGTGGACCTGGCGGTACATTGGTCCCGTC
Drosophila_yakuba|15996      ATGACTGGCTACCGACCTGGTCGCTACTGGCAGTGGACCTGGCGGTACATTGGTCCCGTC
                             ****  .*  : . .** ..    ** *  .*.   ** ***.. *:  : *  **  * 

Nematostella_vectensis|21556 GTCGTGGCAGGGATAGTGGTTGCGAGTTTGGTGGGCATGATATCCAAACCGATCACATAC
Nematostella_vectensis|14549 GTCGTGGCAGGGATAGTGGTTGCGAGTTTGGTGGGCATGATATCCAAACCGATCACATAC
Daphnia_pulex|1357           TTGATCAGCGTCCTCTTGGTGGCGTCCATCATTTACCGCTCGTTCGACAAACCCGCCTAT
Pediculus_humanus|8506       ATAATGACCGCCATATTAGTTTCATCGATTGTTTATAGGATTGTCAATAAGCCTACATTT
Tribolium_castaneum|7890     ATAATGACCGCCATCCTGATTGCTTCCATTGCAGACATGGTGAAGAAGCATCCGTCGTAT
Nasonia_vitripennis|11940    ATTATGGTTGCTATCTTAATCGCCAGCATTGTATCCATGTTCATAAAAAAACCCATGTAC
Apis_mellifera|36843         ATCATGGTCTGCATCCTCGTCTCCAGTATAATCTCCATGGTTGTGAAAAAGCCTCAATAT
Linepithema_humile|4716      ATAATGGTTGGAATTCTCGTGTCTAGCATCGCTTCCATGTTCATTAAGAAACCACAATAT
Pogonomyrmex_barbatus|13208  ATAATGGTTTGCATCCTCCTATTCAGCATTGTCTCTATGTTCATCAAAAAACCGCAATAT
Bombyx_mori|14533            ATAGTCACCTGCATCCTGTTCTCGTCACTGGTCTTCATGCTGATCAACCCGCCGACGTAC
Culex_quinquefasciatus|18583 ATTATGACCGGTATCCTGATATCTTCAGTACTGAGTATGATCCTCAGCAGTCCCAAGTAT
Drosophila_persimilis|5294   ATCATGGTCTGCATCCTGGCCTCGTCCATCGTCTTTATGGTAATCCGCAATCCCACATAC
Drosophila_melanogaster|7282 ATTATGGTCTGCATCTTGGTGTCTTCAGTGGTCTTCATGGTCATTAGAAATCCAACTTAC
Drosophila_yakuba|15996      ATTATGGTCTGCATCCTGGTGTCTTCAGTGGTCTTTATGGTCATTAGGAATCCCACTTAC
                              * .* .     .*  *       :   *       .         . .  .     *: 

Nematostella_vectensis|21556 TCCGCATGGTCTAACTCTGAGTCGAAAGTTATCGACACCGAGTACCCCGGTTGGGGTCTG
Nematostella_vectensis|14549 TCCGCATGGTCTAACTCTGAGTCGAAAGTTATCGACACCGAGTACCCCGGTTGGGGTCTG
Daphnia_pulex|1357           TATGCCTGGAATGCCCAAGAGGGTAAGAGCTTTCTGACACCCTACCCGCAGTGGGTGTTG
Pediculus_humanus|8506       TCTGCTTGGGATTCAAAAACGGGTGAAACATTTCCTGCTGAATATCCCACTTGGGTGTTA
Tribolium_castaneum|7890     GAAGCGTGGATCCCTGACCTGGGTAAAGCTGTGGAAACGGTTTATCCCGGCTGGGTTTTG
Nasonia_vitripennis|11940    AGTGCATGGGACGCCTCTACGGGAACGACTGTCCCGATGTTTTATCCAGACTGGGTGCTC
Apis_mellifera|36843         TCCGCGTGGGACGCGTCACGAGGCATAGCTGTACCGACCGCGTATCCCAGCTGGGTGTTG
Linepithema_humile|4716      TCAGCATGGAATGCAACATTGGGTGCGACAGAATACACGAATTATCCCAGCTGGGTGCTG
Pogonomyrmex_barbatus|13208  TCGGCATGGAACGCGGCATTGGGTNAGGCAATACCTACGAATTATCCTGGCTGGGTGCTG
Bombyx_mori|14533            GGCGCTTGGGATGCTAAC------------GAGAAGAAGGAACAT---------------
Culex_quinquefasciatus|18583 TCCGCGTGGAACGGTGAACTGGGTATCACCGAGAACAAATCCTACCCGGACTGGGTGATG
Drosophila_persimilis|5294   GGAGCTTGGAATGCCGAATTGGGTGTGGTGGAGCAGAAGGAATACCCCAGGTGGGTCATG
Drosophila_melanogaster|7282 GGTGCTTGGAATGCCGATTTGGGTATGATTGAGCAGAAGAGCTACCCCAATTGGGTGATG
Drosophila_yakuba|15996      GGTGCTTGGAATGCCGATTTGGGTATGATTGAGCAGAAGAGCTACCCCAACTGGGTGATG
                                ** ***       .              :    .      *                

Nematostella_vectensis|21556 GGTTGCATTGCTGTCATCATCGCCGTGTCCATCCTACCCATCCCACTAGTGTTTATCCTA
Nematostella_vectensis|14549 GGTTGCATTGCTGTCATCATCGCCGTGTCCATCCTACCCATCCCACTAGTGTTTATCCTA
Daphnia_pulex|1357           ATCGTTGGCGGTTTGCTGGCCACCCTGTCGGTCCTGCCCATTCCGGCCGTGTTCCTGTTG
Pediculus_humanus|8506       ATAATAGCTATTATGATGATATTGGCTGGAACGCTACCTATTCCTTTAGTATTTTTACTT
Tribolium_castaneum|7890     GCCATAGCTGTCGCAATGATCGCCGCTGGGGTTCTCCCTATCCCAATGGTGTTCCTCTTG
Nasonia_vitripennis|11940    GCCATCGCGATAGTTATAATACTGGTTGGCATCGCGCCGATTCCTGTAGTATTTCTATTA
Apis_mellifera|36843         GCTATAGCGGTCGTCATCATTTTTGCGGGCATCGCGCCAATACCGATTGTATTCCTTTTG
Linepithema_humile|4716      GGCATCGCTGCGGTCATTATTTTCGCGGGTATCGCGCCGATCCCGATTGTTTTTCTCCTA
Pogonomyrmex_barbatus|13208  GGCATTGCCGTCGTTATTATCTTGGCTGGTATTGCGCCGATTCCTATCGTTTTCCTTCTA
Bombyx_mori|14533            ------------------------------------------------------------
Culex_quinquefasciatus|18583 GGGATCGCCCTGGCCATGATCCTGGCGTCCGTGCTTCCGATGCCGGTGGTGTTCCTGCTG
Drosophila_persimilis|5294   GGCATCGCCCTGTCGATGATCATGGCCGGCGTCCTGCCCATGCCCATTGTGTTCCTCATG
Drosophila_melanogaster|7282 GGCATCGCACTATCCATGATCCTGGCTGGCGTCCTGCCCATGCCCATCGTGTTCCTCATG
Drosophila_yakuba|15996      GCCATCGCACTATCCATGATCCTGGCTGGCGTCCTGCCCATGCCCATCGTGTTCCTCATG
                                                                                         

Nematostella_vectensis|21556 CGGCGATTCGGTTTTACTAAATACGAGAGGCAGACCTCTAAGGGGGCG---------GAG
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           CGTCGCTTCCAATTCCTCCGGCTCGACACGGACATCAACAAAGGTGTCATCCGCCGCAAC
Pediculus_humanus|8506       AGGCGATTCCAGTGTTTGAAACTGGATGTAGATATTCATCAAGGTTCGATCAGAAGAATT
Tribolium_castaneum|7890     CGCCGCTACCAATGCCTGAAGATGGATATCAACATCCACGAAGGTTCCATCAGAAGAATT
Nasonia_vitripennis|11940    AGGGTTACGCAATGCCATAAACTGGATGTAGATATTCATCAAGGTAGCATTCGTCGCATC
Apis_mellifera|36843         AGGCGGTTCCAATGCGTCAAGTTGGACGTTGACATTCACCAGGGCAGCATACGACGTATC
Linepithema_humile|4716      CGGCGATTCCAATTGGTGAAACTCGATGTGGACATACATCAAGGAAGCATACGTCGTATA
Pogonomyrmex_barbatus|13208  CGACGATTCCAATTAGTGAAACTCGATGTTGACATCCATCAGGGCAGTATTCGACGTATA
Bombyx_mori|14533            ------------------------------------------------------------
Culex_quinquefasciatus|18583 CGCCGGTTCCAGATCCTCAAGGTCGACCTGGACATCCACCAGGGCTCGATCCGGCGTAAC
Drosophila_persimilis|5294   CGCAGCTTCCAGTGCCTGAAGGTGGACCTGGACATACACCAGGGATCGATCCGGCGCAAC
Drosophila_melanogaster|7282 CGCAGCTTCCAGTGCCTGAAGGTGGACCTGGACATCCACCAAGGATCGATTCGTCGCAAT
Drosophila_yakuba|15996      CGTAGCTTCCAGTGCCTGAAGGTGGACCTCGATATCCATCAAGGATCGATACGGCGTAAC
                                                                                         

Nematostella_vectensis|21556 GAGAACATCGTCCCCCCCGGGGCCATGACCCCTAACCTTACC------------------
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           GAGACGACCATTTCCACCAAGCAGATGATGACCGACGTCGAC------------------
Pediculus_humanus|8506       GATACGACGGTATCTACAAAAGAAATGATGGGAGACATGGAT------------------
Tribolium_castaneum|7890     GACACAACAGTGTCCACCAAAGAAATGATCACAGACGTTGATTTGGACGACGACGAGGAT
Nasonia_vitripennis|11940    GAGACCACTGTGTCTACTAAAGAAATGATGGGCGATGTCGATATGGACGAGTATCATGAC
Apis_mellifera|36843         GATACCACCGTTTCTACCAAAGAAATGATGGGAGATGTCGATTTGGACGAGTACCACGAT
Linepithema_humile|4716      GACACAACTGTTTCCACCAAAGAAATGATGAATGATGTCGACCTTGACGAATATCCCGAT
Pogonomyrmex_barbatus|13208  GACACCACCGTTTCCACGAAGGAAATGATGGGAGACGTTGACCTTGATGAATATCATGAT
Bombyx_mori|14533            ------------------------------------------------------------
Culex_quinquefasciatus|18583 GAGACTACGGCGTCCACCAAGGAGATGATCGACGAGGACGAC------------------
Drosophila_persimilis|5294   GAGACAACCGCCTCTACCAAGGAGATGATTGACAACGACGAC---GATGAGGACGATGAG
Drosophila_melanogaster|7282 GAAACAACCGCCTCCACCAAGGAGATGATTGACAATGATGAC------------------
Drosophila_yakuba|15996      GAAACAACCGCCTCCACCAAGGAGATGATTGACAATGATGAC------------------
                                                                                         

Nematostella_vectensis|21556 ---------------------------------------------------CGGGTGCCG
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           ------------------------------------------------------------
Pediculus_humanus|8506       ------------------------------------------------------------
Tribolium_castaneum|7890     GACGTTGGTCCTCTGGGGGAGTACCACGAC---------------GATTCGGATGACGAT
Nasonia_vitripennis|11940    CGTCTAGAGGACTTCCCTGAAGAAGATGAAGATGACGGTAATAGTGATGATGATAATAAC
Apis_mellifera|36843         CGCCTCGAAGATTTTCCCGAGGAGGACGAA---GACGTGAACAGCGATGACGACAACAAC
Linepithema_humile|4716      CGACTCGAGGATTTCCCGGAAGAGGATGAGGATGATATCAATAGCGATGACGATGATAAT
Pogonomyrmex_barbatus|13208  CGGCTCGAGGACTTCCCGGAAGAAGATGAG---GATGTAAACAGTGATGATGATACGAAT
Bombyx_mori|14533            ------------------------------------------------------------
Culex_quinquefasciatus|18583 ------------------------------------------------GTGGTCAGTCCC
Drosophila_persimilis|5294   AACGATTTCAGCGGACCCGCCCTGGGTGGCCACGTCAAGACCCAGAGCGACTTTTCCGAC
Drosophila_melanogaster|7282 ---------------------------------------------GATAATATGAGTCCG
Drosophila_yakuba|15996      ---------------------------------------------GATAATATGAGTCCG
                                                                                         

Nematostella_vectensis|21556 ATCACTATGACGGAGGAGCCAATGGGAGGAGCCGAGGATGATGACGATGAGATGAGAATC
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           ------------------------------GTCAGTTTTTTAAAAAAA------------
Pediculus_humanus|8506       ---------------------GTAAGTAGAAAAATTTTATTACATTTACCTTTTTTTTAT
Tribolium_castaneum|7890     GATGGGCCTCAAGTCAATAGCCGTCTAGAAAAAAGCTTTCGTATGGAAGTTATAGATGAT
Nasonia_vitripennis|11940    GGCCCACCTACGCTTGCGAAGATAGCCTCGAGTAATATGAAAGGAAGAGGTTTCAAAATG
Apis_mellifera|36843         AGCGCCCCGCCGATAACGAAGATCGTCCCTAACAAACTTCAGGGTAAACCGTTCAAAATG
Linepithema_humile|4716      GTCGCGCCGTCTATGAGTAAAATGGCCAATAAAGCGATGAAGGGTAGAGGTTTCAAGATG
Pogonomyrmex_barbatus|13208  ACCGCACCGACTATGAGTAAAATAGCTAACAAAGCGATGAAGGGTAGGGCTTTCAAAATG
Bombyx_mori|14533            ------------------------------------------------------------
Culex_quinquefasciatus|18583 GATTTGCCACCGCCGCAGTCGCTGGCAGGAACACGGTTCACGATCGGAGATTTTGATGTA
Drosophila_persimilis|5294   GACGACGAGGAGGACAAGCCCATGACCATGCGGATGATGATGATGCGTCCAACAACAACA
Drosophila_melanogaster|7282 GATATGCCACCGCAAGATTCACTAGCGGCGACACGCTTCACAATTGGAGACTTTGAAAAT
Drosophila_yakuba|15996      GATATGCCACCGCAAGATTCACTAGCGGCGACACGCTTCACAATTGGAGACTTTGAAAAT
                                                                                         

Nematostella_vectensis|21556 AAC---------------------------------------------------------
Nematostella_vectensis|14549 ------------------------------------------------------------
Daphnia_pulex|1357           ------------------------------------------------------------
Pediculus_humanus|8506       TTTTTTTTCGTAAAATATTACGGGGCG---------------------------------
Tribolium_castaneum|7890     TAT---------------------------------------------------------
Nasonia_vitripennis|11940    GAAGCGATG---AACTTT------------------------------------------
Apis_mellifera|36843         GAAGTGATG---GACTTT------------------------------------------
Linepithema_humile|4716      GAAGCGAAA---AACTATAGAAGTACA---------------------------------
Pogonomyrmex_barbatus|13208  GAAGTCATG---AACTTT------------------------------------------
Bombyx_mori|14533            ------------------------------------------------------------
Culex_quinquefasciatus|18583 AGT---------------------------------------------------------
Drosophila_persimilis|5294   TCGAACGTGTTAAATGTGCCAACAAGCAGAAAGCAGCAGAACTACAAAAAGGATGCGTAC
Drosophila_melanogaster|7282 ------------------------------------------------------------
Drosophila_yakuba|15996      ------------------------------------------------------------
                                                                                         

Nematostella_vectensis|21556 ------TGA
Nematostella_vectensis|14549 ---------
Daphnia_pulex|1357           ------TAA
Pediculus_humanus|8506       ------TAA
Tribolium_castaneum|7890     ------TGA
Nasonia_vitripennis|11940    ---------
Apis_mellifera|36843         ------TAA
Linepithema_humile|4716      ------TAA
Pogonomyrmex_barbatus|13208  ------TAA
Bombyx_mori|14533            ------TAG
Culex_quinquefasciatus|18583 ------TAA
Drosophila_persimilis|5294   GATGTGTAG
Drosophila_melanogaster|7282 ------TAG
Drosophila_yakuba|15996      ------TAG
                                      

multiple sequence alignment in CLUSTALW format


Nematostella_vectensis|14373 ------------------------------------------------------------
Nematostella_vectensis|220   ------------------------------------------------------------
Daphnia_pulex|19073          MFLNGSETGADG---SHQQSLRPPHHRGQTSAGGVSSEGPATSGGPSLLPSGVATAAGHN
Pediculus_humanus|8343       MAKIVNKPDS-----RNGHELAQLNSSRTGD-----------GGVTIVV-------SPTN
Tribolium_castaneum|9506     MT-------------RNGHELAPLNTRNGPE--------GGKPGVTIVL-------QGPR
Nasonia_vitripennis|8214     MVVKPEEVGTTTGGRRNGHELAPLNEERAFGQQSAVSPGAGSHNVSILV-------AGNS
Apis_mellifera|8120          MVVKNENT-------RNGHELAPLNEERQAG-----------QNVTIVV-------TGNQ
Linepithema_humile|5834      MVVKTETA-------RNGHELAPLNENRQLQ------------NVTIVA-------ESQ-
Pogonomyrmex_barbatus|8056   MVVETG---------RNGHELAPLNDHRQPA-----------HNVTIVT-------TASQ
Bombyx_mori|4216             MAAKAETIGP-----RNGHELAPLTTRADGS--------ERPHGVTIVL-------QGS-
Culex_quinquefasciatus|3454  MATKADGTGGVGGPRNNGHEMAPLNTRARGD---------GTHGVTIML-------SPPD
Drosophila_persimilis|6904   MAATKIIDAP-----RNGHEMAPLNTRARGD---------GTHGVTIVL-------TAPQ
Drosophila_melanogaster|6684 MAATKIIDAP-----RNGHEMAPLNTRARGD---------GTHGVTIVL-------TAPQ
Drosophila_yakuba|2657       MAATKIIDAP-----RNGHEMAPLNTRARGD---------GTHGVTIVL-------TAPQ
                                                                                         

Nematostella_vectensis|14373 -------------MQVNDDRGGWGNKLEFILATVGYAVGLGNVWRFPYLCQKNGG-----
Nematostella_vectensis|220   ------------------------------------------------------------
Daphnia_pulex|19073          KSSVVNDAVLHVPELLPPERQKWDNKLQFMLSAIGYSVGLGNVWRFPYLVQQNGG-----
Pediculus_humanus|8343       G------GHSLSMGSPGEERAAWSGKLQFFLSIIGYSVGLGNIWRFPYLCQQNGG-----
Tribolium_castaneum|9506     GSII---SRGSAPIDQDPDRAAWSGKMQFFLSIIGYSVGLGNIWRFPYLCQQNGG-----
Nasonia_vitripennis|8214     GNGAASDALQQQPEPKQENRAEWSGKMQFFLSIIGYSVGLGNIWRFPYLCQQNGG-----
Apis_mellifera|8120          -------NAAGSQETKEENRAEWSGKMQFFLSIIGYSVGLGNIWRFPYLCQQNGG-----
Linepithema_humile|5834      -------NVADGPEA-NENRAAWSGKMQFFLSIIGYSVGLGNIWRFPYLCQQNGGADIGC
Pogonomyrmex_barbatus|8056   -------NVADGQDTKEENRAAWSGKMQFFLSIIGYSVGLGNIWRFPYLCQQNGGG----
Bombyx_mori|4216             -------RGSLHRDGPDDDRAAWSGKLQFFLSIIGYSVGLGNIWRFPYLCQQNGG-----
Culex_quinquefasciatus|3454  RSSVGSREGAGLPDG-DPDRAAWSGKMQFFLSIIGYSVGLGNIWRFPYLCQQNGG-----
Drosophila_persimilis|6904   RNSV---QSVDIPGG-DPERAAWSGKMQFFLSIIGYSVGLGNIWRFPYLCQQNGG-----
Drosophila_melanogaster|6684 RNSV---QSVDIPGN-EPERAAWSGKMQFFLSIIGYSVGLGNIWRFPYLCQQNGG-----
Drosophila_yakuba|2657       RNSV---QSVDIPGN-EPERAAWSGKMQFFLSIIGYSVGLGNIWRFPYLCQQNGG-----
                                                                                         

Nematostella_vectensis|14373 ------------------------------------------------------------
Nematostella_vectensis|220   ------------------------------------------------------------
Daphnia_pulex|19073          ------------------------------------------------------------
Pediculus_humanus|8343       ------------------------------------------------------------
Tribolium_castaneum|9506     ------------------------------------------------------------
Nasonia_vitripennis|8214     ------------------------------------------------------------
Apis_mellifera|8120          ------------------------------------------------------------
Linepithema_humile|5834      KAKKSRDKVARYEGSGAGRSREVHGWPLACGLMTPEFIQTPKSYRLPSSNCADCASVTRL
Pogonomyrmex_barbatus|8056   ------------------------------------------------------------
Bombyx_mori|4216             ------------------------------------------------------------
Culex_quinquefasciatus|3454  ------------------------------------------------------------
Drosophila_persimilis|6904   ------------------------------------------------------------
Drosophila_melanogaster|6684 ------------------------------------------------------------
Drosophila_yakuba|2657       ------------------------------------------------------------
                                                                                         

Nematostella_vectensis|14373 ---------GAFLIPYVLCLALLGIPLFFMELAIGQSVRQGSVGVWNYIHPYLGGVGISS
Nematostella_vectensis|220   ------------------------------------------------------------
Daphnia_pulex|19073          ---------GAFLIPFFVMLLLEGIPLFLVELALGQKLRQGSLGAWNLIHPWLGGLGIAS
Pediculus_humanus|8343       ---------GAFLIPFVIMLILEGIPLFLIEIGIGQKMRLGALGVWNTVHPWLGGIGIAS
Tribolium_castaneum|9506     ---------GAFLIPFAVMLILEGIPLFLIELGIGQKMRLGSLGVWNTIHPWLGGIGISS
Nasonia_vitripennis|8214     ---------GAFLIPFFVMLILEGVPLFLIELGLGQRMRQGALGVWNTIHPWLGGIGIAS
Apis_mellifera|8120          ---------GAFLIPFFVMLILEGVPLFLIELGLGQRMRQGALGVWNTIHPWLGGIGIAS
Linepithema_humile|5834      PLSRLPHAIGAFLIPFFVMLILEGVPLFLIELGLGQRMRQGALGVWNTIHPWLGGIGIAS
Pogonomyrmex_barbatus|8056   -----AYILGAFLIPFFVMLILEGVPLFLIELGLGQRMRQGALGVWNTIHPWLGGIGIAS
Bombyx_mori|4216             ---------GAFLIPFLIMLVLEGVPLFLIEMAIGQKMRLGSLGVWNTIHPWLGGIGISS
Culex_quinquefasciatus|3454  ---------GAFLIPFMVMLILEGIPLFLIELGMGQRMRLGALGVWNTIHPWLGGIGISS
Drosophila_persimilis|6904   ---------GAFLIPFMIMLILEGIPLFLIELGMGQRMRLGALGVWNTIHPWLGGIGISS
Drosophila_melanogaster|6684 ---------GAFLIPFMVMLILEGIPLFLIELGIGQRMRLGALGVWNTIHPWLGGIGISS
Drosophila_yakuba|2657       ---------GAFLIPFMVMLILEGIPLFLIELGIGQRMRLGALGVWNTIHPWLGGIGISS
                                                                                         

Nematostella_vectensis|14373 VIVCFLVAVYYNMIIAWCFYYLFAS-------WQSP---LPYSYCPQVLTNSKYYDLPEC
Nematostella_vectensis|220   ------------------------------------------------------------
Daphnia_pulex|19073          TLVAFLVGLYYNVIITWCFYYLFNS-------FQSP---LPWSTCPID-SNGT--AVKEC
Pediculus_humanus|8343       CIVTFFVALYYNIIITWCFYYFFNS-------FQSP---LPWSECPVV--NNT--VVYEC
Tribolium_castaneum|9506     CIVTFFVALYYNVIITWCFYYFFNS-------FQYP---LPWENCPVV--NGT--AVPEC
Nasonia_vitripennis|8214     CIVTFFVTLYYNVIITWCFYYLFNS-------FREP---LLWSECPKI--DNR--SVEEC
Apis_mellifera|8120          CIVTFFVALYYNVIITWCFYYLFNS-------LEEP---LPWAKCPEV--DGK--PVEEC
Linepithema_humile|5834      CIVTFFVALYYNVIITWCFYYLFNSLGAVTINFGQS---LPWATCPEK--NGE--VIEEC
Pogonomyrmex_barbatus|8056   CIVTFFVALYYNVIITWCVYYLFNS-------LEES---LPWAKCPEL--DGK--PVEEC
Bombyx_mori|4216             CIVTLFVALYYNVIITWVFFYLFNS-------IRLTADQLPWSSCPQD--NGT--AEAEC
Culex_quinquefasciatus|3454  CIVTLFVAIYYNVIITWCFFYFFNS-------FRVT---LPWSTCPQF--NGT--DLPEC
Drosophila_persimilis|6904   CIVTLFVALYYNVIITWVFFYLFNS-------FRYP---LPWSTCPT---NGTGFALEEC
Drosophila_melanogaster|6684 CIVTLFVALYYNVIITWVFFYLFNS-------FRYP---LPWSSCPL---NGTGFELEEC
Drosophila_yakuba|2657       CIVTLFVALYYNVIITWVFFYLFNS-------FRYP---LPWSSCPL---NGTGFELEEC
                                                                                         

Nematostella_vectensis|14373 GLAGRTQYYWYQNALKIAPTIDES-GGLVWPMCLSLLLAWIVVFLCMMKGVQSAGKAVYF
Nematostella_vectensis|220   ------------------------------------------------------------
Daphnia_pulex|19073          TAATETAYFWYRTALDISPSVDQP-EGIKWWMALCLLLSWIIVYFITMRGIQSSGKVVYF
Pediculus_humanus|8343       EVSSETAYFWYRTTLDVAPNIEDH-GGLKWWIVLCLILSWITVFFIVMKGIQSSGKVVYF
Tribolium_castaneum|9506     DKSSATAYFWYRTTLDAATSIEDP-GIPRWWIVLCLLLSWIIVFFIVMKGIQSSGKVVYF
Nasonia_vitripennis|8214     AKSSETAYFWYRTTLDAAPSIDDG-QGLKWWIVLCLLLSWFVVFCIMMKGIQSSGKVVYF
Apis_mellifera|8120          VKSSETAYFWYRTTLDAAPSIEEGSSGLKWWIVLCLLLSWIVVFFIVMKGIQSSGKVVYF
Linepithema_humile|5834      AKSSETAYFWYRVTLDAAPSIEDG-QGLKWWIVLCLLLSWIVVFFIVMKGIQSSGKVVYF
Pogonomyrmex_barbatus|8056   TRSSETAYFWYRTTLDAAPSIEDG-QGLKWWIVLCLLFSWIVVFFIVMKGIQSSGKVVYF
Bombyx_mori|4216             NKASATVYFWYREALDAAPSIEDP-GVPRWWIVLYLLLAWVIVFCIVMKGIQSSGKVVYF
Culex_quinquefasciatus|3454  ERSSETAYFWYRTTLDASPSIEEP-EGFKWWIVLCLLLSWTVVFFIVMKGIQSSGKVVYF
Drosophila_persimilis|6904   AKSSETTYFWYRTTLDAAPSMDEP-GGLKWWIVLCLMLSWTIVFFIVMKGIQSSGKVVYF
Drosophila_melanogaster|6684 AKSSETTYFWYRTTLDAAPSMDEP-GGLKWWIVLCLMLSWTIVFFIVMKGIQSSGKVVYF
Drosophila_yakuba|2657       AKSSETTYFWYRTTLDAAPSMDEP-GGLKWWIVLCLMLSWTIVFFIVMKGIQSSGKVVYF
                                                                                         

Nematostella_vectensis|14373 TATFPYLVLIIFFGRGVTLEGAGPGVAHMFKPQFEKLADPRVWLEAATQIFYSLGVAFGG
Nematostella_vectensis|220   ------------------------------------------------------------
Daphnia_pulex|19073          TALFPYAVLTIFFIRGITLKGAGAGLAHMLQPQMHKLLDPTVWLDAATQVFYSFNIGFGS
Pediculus_humanus|8343       TSMFPYIVLTIFFVRGITLKGSGAGLMHMYTPKVEKLSDPTVWMDAATQVFYSFGLAFGS
Tribolium_castaneum|9506     TSMFPYLVLTIFFIRGITLKGASAGLAHMYTPKVEKLLDPKVWLEAATQVFYSFGLAFGS
Nasonia_vitripennis|8214     TSLFPYLVLTIFFIRGITLKGADAGLAHMYTPKVEKLLEPTVWLDAATQVFYSFGLAFGS
Apis_mellifera|8120          TSMFPYLVLTIFFIRGITLKGASAGLAHMYTPKIEKLLEPTVWLDAATQVFYSFGLAFGS
Linepithema_humile|5834      TSMFPYLVLTIFFIRGITLKGASAGLAHMYTPKVEKLLEPTVWLDAATQVFYSFGLAFGS
Pogonomyrmex_barbatus|8056   TSMFPYLVLTIFFIRGITLRGASAGLAHMYTPKVEKLLEPTVWLDAATQVFYSFGLAFGS
Bombyx_mori|4216             TSLFPYVVLTIFFIRGITLPGSSDGILHMYKPKLEKLLDPTVWLDAATQVFYSFGLAFGS
Culex_quinquefasciatus|3454  TSLFPYIVLTIFFIRGITLEGAGAGLMHMYTPKVEKLLEPTVWLDAATQVFYSFGLAFGS
Drosophila_persimilis|6904   TSLFPYIVLTIFFIRGITLRGAGAGLMHMYTPKVEKLLEPTVWLDAATQVFYSFGLAFGS
Drosophila_melanogaster|6684 TSLFPYIVLTIFFIRGITLRGAGAGLMHMYTPKVEKLLEPTVWLDAATQVFYSFGLAFGS
Drosophila_yakuba|2657       TSLFPYIVLTIFFIRGITLRGAGAGLMHMYTPKVEKLLEPTVWLDAATQVFYSFGLAFGS
                                                                                         

Nematostella_vectensis|14373 LIAMSSYNPVHNNCLRDAVMVSLINCGTSVFASIVIFSILGFKAHETFTECIELYTK---
Nematostella_vectensis|220   ------------------------------------------------------------
Daphnia_pulex|19073          LIAFGSYNPPRNNCVKDTLILSVCNAATAVYASVVIFAILGFKAVRSYDLCVNQSVIISL
Pediculus_humanus|8343       LIAFGSYNTPKNNCVRDVILVSICNAATAIYASVVVFAILGFKAMLNYDRCIDGNKIKLV
Tribolium_castaneum|9506     LIAFGSYNTPKNNCVRDVILVSVCNAFTAIYASVVIFAILGFKAVSNVDKCLEHNIQFLI
Nasonia_vitripennis|8214     LIAFGSYNTPENNCVRDVILVSVCNAFTAIYASVVIFAILGFKAMSNVDKCLENNRNWLV
Apis_mellifera|8120          LIAFGSYNTPDNHCVRDVILVSCCNAFTAIYASIVIFAILGFKAMTNVDKCLAGNKDLLV
Linepithema_humile|5834      LIAFGSYNTPNNNCVRDVILVSVCNAFTAIYASVVIFAILGFKAMSNVEKCVVSARDTLV
Pogonomyrmex_barbatus|8056   LIAFGSYNTPDNNCVRDVILVSVCNAFTAIYASVVIFAILGFKAMSNVDKCVVSARDTLI
Bombyx_mori|4216             LIAFGSYNPPNNNCVRDVLLVSVCNALTAIYASVVIFSILGFKAYTMVETCITKEIKVLA
Culex_quinquefasciatus|3454  LIAFGSYNTPKNNCVRDVILVSVCNAFTAVYASVVIFAILGYKATVGVDRCITVNKHILI
Drosophila_persimilis|6904   LIAFGSYNTPKNNCVRDVLLVSVCNAVTAIYASVVIFAILGFKATMNVDRCVASNTDILV
Drosophila_melanogaster|6684 LIAFGSYNTPKNNCVRDVLLVSVCNAVTAIYASVVIFAILGFKATVNVDRCVASNTEILV
Drosophila_yakuba|2657       LIAFGSYNTPKNNCVRDVLLVSVCNAVTAIYASVVIFAILGFKATVNVDRCIASNTEILV
                                                                                         

Nematostella_vectensis|14373 ----------DNVTLPGNQTVGEACK------------TLEYWLGQ--------------
Nematostella_vectensis|220   ------------------------------------------------------------
Daphnia_pulex|19073          HSIFKIID--NFLTDEAYANFLQYRDES--KDLGLRGCNLEEIMNE--------------
Pediculus_humanus|8343       SHQIIPS---VNISESEYDLILRE-KVTNHTMYDLEECSLEKELDQ--------------
Tribolium_castaneum|9506     SNGHFANAKVADISTTMYEEAVKNLNNS--TLAQLRTCSLEDELSG--------------
Nasonia_vitripennis|8214     EHGFLL----ANATSEQFDSAVKRFNSSI-DNNTLSECSLSEQLDN--------------
Apis_mellifera|8120          QHGFAY----QNTSMERYKDIVNNLNETK-MNFTLETCSLSEQLDN--------------
Linepithema_humile|5834      HNGLLNST--MPFALEDYERFMKTFNSSA-VNFTMRPCSLAEELNS--------------
Pogonomyrmex_barbatus|8056   ENGKWSNS--TPFNLEDYELFMGDFNSSA-MNFTMKPCSLSKELDN--------------
Bombyx_mori|4216             LNHIGGFT--LNSTQDYYREEYPKLNETLVAAFNLTGCTMSRQLDEVIPEFFVFERAIHN
Culex_quinquefasciatus|3454  KHGLLPS---VHVDNAEYERVMHGLDPVASANWTLEHCSLEDQLDS--------------
Drosophila_persimilis|6904   RHAFLEN---KNATTLEYEHAMDKLKDTEKTLFQMSECTLSKELDN--------------
Drosophila_melanogaster|6684 KNKLLGLN-----DTQGYEQAMSLLNGTELLRLQLSECSLAHELDN--------------
Drosophila_yakuba|2657       KNKLLGLN-----DTQGYEQAMNQLNGSEFVRLQLSECSLAHELDN--------------
                                                                                         

Nematostella_vectensis|14373 -----------SAEGPGLTFIAFTEAIVKMPALSPLWATLFFCMLLTLGLGSMFGTLEGV
Nematostella_vectensis|220   -------------EGPGLTFIAFTEAIVKMPALSPLWATLFFCMLLTLGLGSMFGTLEGV
Daphnia_pulex|19073          -----------SVEGTGLVFIVFTQAIVELPA-APFWAILFFLMLLALGVGSQIGTLEGV
Pediculus_humanus|8343       -----------AAEGTGLAFVVFTQAIVELPG-APFWSVIFFMMLLSLGIGSQIGILEGM
Tribolium_castaneum|9506     -----------AAQGTGLAFIVFTQAIVELPG-APFWAVIFFLMLLSLGIGSQIGILEGM
Nasonia_vitripennis|8214     -----------AAEGTGLAFIVFTQAIVELPG-APFWSCIFFLMLLALGLGSQIGLLEGM
Apis_mellifera|8120          -----------AAEGTGLAFIVFTQAIVELPG-APFWSCIFFLMLLALGLGSQIGILEGM
Linepithema_humile|5834      -----------AAEGTGLAFIIFTQAIVELPG-APFWSCIFFLMLLALGLGSQIGILEGM
Pogonomyrmex_barbatus|8056   -----------AAEGTGLAFIIFTQAIVELPG-APFWSCIFFMMLLALGLGSQIGLLEGM
Bombyx_mori|4216             PTNPTNIINAKAAEGTGLAFIVFTQAILKLTP-APFWSIIFFLMLLSLGLGSQIGIMEGM
Culex_quinquefasciatus|3454  -----------AAEGTGLAFIVFTQAIVQLPG-APFWAVLFFTMLLSLGLGSQIGILEGM
Drosophila_persimilis|6904   -----------AAEGTGLAFIVFTQAIVELPG-KPFWAVLFFTMLLPTGTGLADRHLEGM
Drosophila_melanogaster|6684 -----------AAEGTGLAFIVFTQAIVELPG-APFWAVLFFTMLLSLGLGSQIGILEGM
Drosophila_yakuba|2657       -----------AAEGTGLAFIVFTQAIVELPG-APFWAVLFFTMLLSLGLGSQIGILEGM
                                          :*.**.*: **:**:::.   *:*: :** ***. * *     :**:

Nematostella_vectensis|14373 ITPVYDAKLVS-WRKEFVSGAICLVSFLLGLLFCQNSGEYWLQMFDSFSGTLPLLVIGML
Nematostella_vectensis|220   ITPVYDAKIVS-WRKEFVSGAICLVSFLLGLLFCQNSGEYWLQMFDSFSGTLPLLVIGML
Daphnia_pulex|19073          ISTVFDIQIVRGARKEVVSAAVCIVSYLIGLLFVTGSGEYWVKIFDSFAGTTGLIFIALL
Pediculus_humanus|8343       LCTIFDIEIFKRIKKQYLTGFVCLICCIVGLLFCTGAGEYWLKLFDSFAGTIGLVFLALL
Tribolium_castaneum|9506     LCTIFDIEILKRIRKQYITAFVCVVCFCIGMIFTTGAGEYWLKMFDSFAATIGLVLVALM
Nasonia_vitripennis|8214     LCVVFEIDLFKRIKKQYITGVLCLFCFFVGLIFCTGAGEYWLKMFDSFAGTIGLVLVALM
Apis_mellifera|8120          LCVIFDIDLFKRIKKQYMTGVVCTVCFFVGLIFCTGAGEYWLKMFDSFAGTIGLVMVALM
Linepithema_humile|5834      LCVIFDIDLFKRIKKQYMTGVVCVVCFFVGLIFCTGAGEYWLKMFDSFAGTIGLVMVALM
Pogonomyrmex_barbatus|8056   LCVIFDIDLFKRIKKQYMTGVVCVVCFFVGLIFCTGAGEYWLKMFDSFAGTIGLVIVALM
Bombyx_mori|4216             LCTIFDIDFFKRLSKPVITGIVCSFCFLVGLIFTTGAGEYWLKMFDSFAGTIGLVVVALL
Culex_quinquefasciatus|3454  LCTIFDIDIFKRIRKPYVTGVVCVFCFSIGLIFTTGAGEYWLKMFDSFAGTIGLVVVALM
Drosophila_persimilis|6904   ------------------------------------------------------------
Drosophila_melanogaster|6684 LCTLFDIDIIKRVKKQHVTGVVCLFCFIVGFIFCTGAGEYWLKMFDSFAGTIGLVVVALM
Drosophila_yakuba|2657       LCTLFDIDIIKRVKKQHVTGVVCLFCFIVGFIFCTGAGEYWLKMFDSFAGTIGLVVVALM
                                                                                         

Nematostella_vectensis|14373 EMIGVCWVYGSKRFEDDIEYMISKRPNWYFKITWRYEAPVVVAGIVVASLVGMISKPITY
Nematostella_vectensis|220   EMIGVCWVYGSKRFEDDIEYMISKRPNWYFKITWRYEAPVVVAGIVVASLVGMISKPITY
Daphnia_pulex|19073          ESVAVMYIYGHRKFSQDILQMTGHMPGPYWQITWRFVGPVLISVLLVASIIYRSFDKPAY
Pediculus_humanus|8343       ETFAVMYVYGHAKFTQDIEDMTGYRPGWYWQITWRFIGPIIMTAILVSSIVYRIVNKPTF
Tribolium_castaneum|9506     EMISVIYVYGHEKFTKDIQDMTGIKPGVYWQLTWRFLAPIIMTAILIASIADMVKKHPSY
Nasonia_vitripennis|8214     EMLAVVYVYGHKKFTQDIEDMTGYRPGLYWQITWKYLAPVIMVAILIASIVSMFIKKPMY
Apis_mellifera|8120          EMISVIFVYGHEKFTKDIEEMTGYRPGAYWQFTWRFLAPIIMVCILVSSIISMVVKKPQY
Linepithema_humile|5834      EMISVVFVYGHEKFTKDIEEMTGYRPGAYWQITWRFLAPIIMVGILVSSIASMFIKKPQY
Pogonomyrmex_barbatus|8056   EMISVIFVYGHEKFTKDIEEMTGYKPGPYWQFTWRFLAPIIMVCILLFSIVSMFIKKPQY
Bombyx_mori|4216             EMVSVIYIYGHERFSNDIYEMTGYRPGLYWQVTWRYVGPFIVTCILFSSLVFMLINPPTY
Culex_quinquefasciatus|3454  ETIAVIYIYGHKKFTEDIYQMTGVRPGIYWQMTWRYIGPVIMTGILISSVLSMILSSPKY
Drosophila_persimilis|6904   --IAVIFIYGHERFTEDIYQMTGYRPGLYWQLTWRYIGPVIMVCILASSIVFMVIRNPTY
Drosophila_melanogaster|6684 EMIAVIFIYGHERFTEDIFQMTGYRPGRYWQWTWRYIGPVIMVCILVSSVVFMVIRNPTY
Drosophila_yakuba|2657       EMIAVIFIYGHERFTEDIYQMTGYRPGRYWQWTWRYIGPVIMVCILVSSVVFMVIRNPTY
                               ..* ::**  :* .**  * .  *. *:: **:: .*.::  ::  *:         :

Nematostella_vectensis|14373 SAWSNSESKVIDTEYPGWGLGCIAVIIAVSILPIPLVFILRRFGFTKYERQTSKGA---E
Nematostella_vectensis|220   SAWSNSESKVIDTEYPGWGLGCIAVIIAVSILPIPLVFIL--------------------
Daphnia_pulex|19073          YAWNAQEGKSFLTPYPQWVLIVGGLLATLSVLPIPAVFLLRRFQFLRLDTDINKGVIRRN
Pediculus_humanus|8343       SAWDSKTGETFPAEYPTWVLIIAIMMILAGTLPIPLVFLLRRFQCLKLDVDIHQGSIRRI
Tribolium_castaneum|9506     EAWIPDLGKAVETVYPGWVLAIAVAMIAAGVLPIPMVFLLRRYQCLKMDINIHEGSIRRI
Nasonia_vitripennis|8214     SAWDASTGTTVPMFYPDWVLAIAIVIILVGIAPIPVVFLLRVTQCHKLDVDIHQGSIRRI
Apis_mellifera|8120          SAWDASRGIAVPTAYPSWVLAIAVVIIFAGIAPIPIVFLLRRFQCVKLDVDIHQGSIRRI
Linepithema_humile|5834      SAWNATLGATEYTNYPSWVLGIAAVIIFAGIAPIPIVFLLRRFQLVKLDVDIHQGSIRRI
Pogonomyrmex_barbatus|8056   SAWNAALGXAIPTNYPGWVLGIAVVIILAGIAPIPIVFLLRRFQLVKLDVDIHQGSIRRI
Bombyx_mori|4216             GAWDAN----EKKEH---------------------------------------------
Culex_quinquefasciatus|3454  SAWNGELGITENKSYPDWVMGIALAMILASVLPMPVVFLLRRFQILKVDLDIHQGSIRRN
Drosophila_persimilis|6904   GAWNAELGVVEQKEYPRWVMGIALSMIMAGVLPMPIVFLMRSFQCLKVDLDIHQGSIRRN
Drosophila_melanogaster|6684 GAWNADLGMIEQKSYPNWVMGIALSMILAGVLPMPIVFLMRSFQCLKVDLDIHQGSIRRN
Drosophila_yakuba|2657       GAWNADLGMIEQKSYPNWVMAIALSMILAGVLPMPIVFLMRSFQCLKVDLDIHQGSIRRN
                              **           :                                             

Nematostella_vectensis|14373 ENIVPPGAMTPNLT-----------------------RVPITMTEEPMGGAEDDDDEMRI
Nematostella_vectensis|220   ------------------------------------------------------------
Daphnia_pulex|19073          ETTISTKQMMTDVD------------------------------------VSFLKK----
Pediculus_humanus|8343       DTTVSTKEMMGDMD---------------------------------VSRKILLHLPFFY
Tribolium_castaneum|9506     DTTVSTKEMITDVDLDDDEDDVGPLGEYHD-----DSDDDDGPQVNSRLEKSFRMEVIDD
Nasonia_vitripennis|8214     ETTVSTKEMMGDVDMDEYHDRLEDFPEEDEDDGNSDDDNNGPPTLAKIASSNMKGRGFKM
Apis_mellifera|8120          DTTVSTKEMMGDVDLDEYHDRLEDFPEEDE-DVNSDDDNNSAPPITKIVPNKLQGKPFKM
Linepithema_humile|5834      DTTVSTKEMMNDVDLDEYPDRLEDFPEEDEDDINSDDDDNVAPSMSKMANKAMKGRGFKM
Pogonomyrmex_barbatus|8056   DTTVSTKEMMGDVDLDEYHDRLEDFPEEDE-DVNSDDDTNTAPTMSKIANKAMKGRAFKM
Bombyx_mori|4216             ------------------------------------------------------------
Culex_quinquefasciatus|3454  ETTASTKEMIDEDD----------------------VVSPDLPPPQSLAGTRFTIGDFDV
Drosophila_persimilis|6904   ETTASTKEMIDNDD-DEDDENDFSGPALGGHVKTQSDFSDDDEEDKPMTMRMMMMRPTTT
Drosophila_melanogaster|6684 ETTASTKEMIDNDD---------------------DNMSPDMPPQDSLAATRFTIGDFEN
Drosophila_yakuba|2657       ETTASTKEMIDNDD---------------------DNMSPDMPPQDSLAATRFTIGDFEN
                                                                                         

Nematostella_vectensis|14373 N---------------------
Nematostella_vectensis|220   ----------------------
Daphnia_pulex|19073          ----------------------
Pediculus_humanus|8343       FFFVKYYGA-------------
Tribolium_castaneum|9506     Y---------------------
Nasonia_vitripennis|8214     EAM-NF----------------
Apis_mellifera|8120          EVM-DF----------------
Linepithema_humile|5834      EAK-NYRST-------------
Pogonomyrmex_barbatus|8056   EVM-NF----------------
Bombyx_mori|4216             ----------------------
Culex_quinquefasciatus|3454  S---------------------
Drosophila_persimilis|6904   SNVLNVPTSRKQQNYKKDAYDV
Drosophila_melanogaster|6684 ----------------------
Drosophila_yakuba|2657       ----------------------