Orthologs Set ID: EOG4006BG


Orthology Database
OrthoDB4
Gene Symbol(s)
SI:CH1073-201C17.1

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Danio rerio 13023 657, 968, 1133
Fugu rubripes 13845 100, 161, 310, 657, 957, 1133
Gasterosteus aculeatus 16062 161, 310, 657, 957, 1133
Oryzias latipes 2397 161, 310, 474, 657, 957, 1133

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Danio rerio 13023 ENSDART00000075902 570492 ENSDARG00000053803 si:ch1073-201c17.1 danRer6
Fugu rubripes 13845 ENSTRUT00000010449 101075683 ENSTRUG00000004371 si:ch1073-201c17.1 fr2
Gasterosteus aculeatus 16062 ENSGACT00000002746 ENSGACG00000002089 si:ch1073-201c17.1 gasAcu1
Oryzias latipes 2397 ENSORLT00000009483 ENSORLG00000007567 si:ch1073-201c17.1 oryLat2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Danio rerio 15770 ENSDARP00000070382 570492 ENSDARG00000053803 si:ch1073-201c17.1 danRer6
Fugu rubripes 10391 ENSTRUP00000010391 101075683 ENSTRUG00000004371 si:ch1073-201c17.1 fr2
Gasterosteus aculeatus 2623 ENSGACP00000002736 ENSGACG00000002089 si:ch1073-201c17.1 gasAcu1
Oryzias latipes 8883 ENSORLP00000009482 ENSORLG00000007567 si:ch1073-201c17.1 oryLat2

multiple sequence alignment in CLUSTALW format


Danio_rerio|13023            ------------------------------------------------------------
Oryzias_latipes|2397         ATGGCAGCCCTGGACATCGCACAGCTGAACAGCCTCAACCTGCAGCTGCCACCGCCTGCC
Gasterosteus_aculeatus|16062 ------------------------------------------------------------
Fugu_rubripes|13845          AAACGCGTGGTATCACATCTCCAACATTCA------------------------------
                                                                                         

Danio_rerio|13023            ------------------------------------------------------------
Oryzias_latipes|2397         ATCAAGCCAGGGGAGCGTGGCTTCGGCCTGGGCAGCGAGCTCACTCGGCCCCTGCATGGC
Gasterosteus_aculeatus|16062 ------------------------------------------------------------
Fugu_rubripes|13845          ---------------AAGGCATCTCCTGCACGGATCCTTGTGACACGACCCCAGCACGGC
                                                                                         

Danio_rerio|13023            ------------------------------------------------------------
Oryzias_latipes|2397         AACGCACTGCTGGAGGAGCTCAGCAAGATGCGCCAGGAAAAGTTCCTGACTGATCTGGAG
Gasterosteus_aculeatus|16062 ---------------------------ATGCGGCAGGAGAAGTTCCTGACTGACCTTGAG
Fugu_rubripes|13845          AAtgccctgctggaggagctcagcaaGATGCGGCAAGAGAAGTTCCTGACTGACCTGGAG
                                                                                         

Danio_rerio|13023            ------------------------------------------------------------
Oryzias_latipes|2397         CTGGCCTGTAAGACCAAGGCCTTCGACGTCCACAAACTGGTCATTTCCTCCATCAGTCAG
Gasterosteus_aculeatus|16062 TTGGCCTGCAAGACCAAAGCCTTCGACGTCCACAAGCTGGTCATCTCCTCCATCAGTCAG
Fugu_rubripes|13845          CTGGCCTGTAAGACAAAATCATTTGATGTCCATAAATTAGTAATCTCCTCCATCAGCCAG
                                                                                         

Danio_rerio|13023            ------------------------------------------------------------
Oryzias_latipes|2397         TACTTTAGAGAGATTCTGGCCAAAGACCCTGGAATGAAGCGTCTGGAGCTCCCCTCACTC
Gasterosteus_aculeatus|16062 TACTTCAGGGAGATTCTGGCCAAAGACCCGGGCATGAAGCGCCTGGAGCTGCCCTCGCTC
Fugu_rubripes|13845          TACTTCAGAGAGATTCTAGCCAAAGATCCAGGCATGAAGCGTCTGGAGCTCCCCTCCCTT
                                                                                         

Danio_rerio|13023            ---------GGACTTGCCAATGTGATTACCTTTGCTTACCTGGGCCGTGTGCACATGTCT
Oryzias_latipes|2397         TCACCTCTGGGTCTAGCCAATGTCATCACTTTTGCTTACCTGGGCCGCGTCCACATGTCC
Gasterosteus_aculeatus|16062 TCACCCCTAGGCCTGGCTAACGTCATCACCTTCGCCTACCTGGGTCGCGTCCACATGTCG
Fugu_rubripes|13845          TCACCTCTAGGCCTGGCCAATGTCATCACTTTCGCCTATCTGGGTCGTGTCCATATGTCC
                                      ** ** ** ** ** ** ** ** ** ** ***** ** ** ** ***** 

Danio_rerio|13023            CTGTACACCATTGGTTGCACTGTGTCTGCAGCCAGCACTCTGCAGATCCCGCATCTTCTC
Oryzias_latipes|2397         CTCTACACCATCGGCTGCACTGTCTCTGCCGCCACTGCATTGCAGATCCCGCAACTCCTC
Gasterosteus_aculeatus|16062 CTGTACACCATCGGCTGCACCGCTTCCGCCGCCGCCACCCTGCAGATCCCTCAGCTCCTC
Fugu_rubripes|13845          CTCTACACCATTGGCTGCACAGCCTCCGCAGCCACCACCCTGCAGATCCCCCAGCTCCTG
                             ** ******** ** ***** *  ** **.***.  .*  ********** ** ** ** 

Danio_rerio|13023            CAGATGTGCATGGATTTCCTGATGGCCGAGCTGAACACACACACCTGTGTGTATGTGTGG
Oryzias_latipes|2397         AAGATGTGCATGGACTTCCTGCTGGCGGAGCTCAACATTCAGACCTGCGTCTAC------
Gasterosteus_aculeatus|16062 AAGATGTGCATGGACTTCCTGCTGGCCGAGCTCAACGTGCAGACCTGCGTCTACATCTGG
Fugu_rubripes|13845          AAGATGTGtgtggacttcctgttggctGAGCTCAATGTTCAAACTTGCGTGTATATCTGG
                             .******* .**** ****** **** ***** ** .  ** ** ** ** **       

Danio_rerio|13023            AACATCGGTGCTGCCTACGGCCTTATGCCTGTCCGAGATGCCGCCCGGCGCTACATCTTA
Oryzias_latipes|2397         ------------------------------------------------------------
Gasterosteus_aculeatus|16062 AACATCGCCGCCGCCTACGGCCTGACGTCGGTGAGCGACGCGGCACGCCGCTTCGTCCTG
Fugu_rubripes|13845          AATATTGCAGCCGCCTATGGCCTGCTGCCCGTCTGTGATGCTGCCCGGCGCTTCATCCTA
                                                                                         

Danio_rerio|13023            GAGAATTTTGCCCAGTTTTCTGAAACAACCCAATTCAATCAACTCACCTTTGAGCAGATC
Oryzias_latipes|2397         ------------------------------------------CTGACCCTGGAGCAGATC
Gasterosteus_aculeatus|16062 GAGAACTTCGTGCAGTTCGCGGACACGCCCCTGTTCACCCAGCTGACCCTGGAGCAGATC
Fugu_rubripes|13845          GACAACTTTGTTCAATTTGCCGAAACACCTCTGTTCACCCAGCTGACACTGGAGCAAGTT
                                                                       ** **. * *****..* 

Danio_rerio|13023            ACAGCTTTCCTGCAGGATGACAACCTTATTCTTCCTTCAGAGGTCTCCACGTTTCAGATT
Oryzias_latipes|2397         TCTGCTTTCCTTCAGGACAACTCGCTGGTGTTGCCCTCAGAGGTCATGGCTTtccagctt
Gasterosteus_aculeatus|16062 TCCGCCTTCCTGCAGGACGACGCGCTGCTGCTGCCTTCAGAGGTCACAGCCTTCCAGCTG
Fugu_rubripes|13845          TCTGCCTTCTTGCAGGATGATTCACtgctgttgccttcagaggTCACTGCcttccagCTG
                             :* ** *** * ***** .*  . **  *  * ** *********:  .* ** ***.* 

Danio_rerio|13023            GCAATGAAGTGGTTAGACTTTGACCCTAAGAGGCAGGAGCACGCTGCAGAACTGCTGTCC
Oryzias_latipes|2397         gCCATGAAGTGGCTGGACTTTAACGCCTCCCGCCAGGCTCACGCTTCTGACCTTCTGTCA
Gasterosteus_aculeatus|16062 GCCATGAGGTGGCTCGACTTTGACTCGTCTCGTCAGGCTCACGCCGCCGAGCTGCTGTCC
Fugu_rubripes|13845          GCCATGAAGTGGCTCGACTTTGATGCCTCTCGCCAGCCTCACTCTGCAGAACTCCTGTCT
                             **.****.**** * ******.*  * :. .* *** . *** *  * ** ** ***** 

Danio_rerio|13023            CACGTGCGATTTGAGACCATCCCGGCTAGTGAGCTGGTTAGCGAGATCCAGCCGGTGCCA
Oryzias_latipes|2397         CATATTCGTTTTGAGACCATCCCAGCCAGCGAGCTGGTGAGCCAGATCCAGCCGGTGCCT
Gasterosteus_aculeatus|16062 CACGTCCGCTTCGAGACGATCCCCGCCAGCGAGCTGGTGAGCCAGATCCAGCCGGTGCCC
Fugu_rubripes|13845          CATGTCCGCTTCGAGACAATCCCAGCCAGTGAACTAGTCAGTCAGATCCAGCCATTGCCC
                             ** .* ** ** ***** ***** ** ** **.**.** **  **********. **** 

Danio_rerio|13023            CGTATGATGCTAGATCCCCAGTGTCACCGTCTTCTGGTGGATGCCATGAACTACCATTTG
Oryzias_latipes|2397         CGCATGATGCTGGATCCACAGTGTCACCGCCAGCTGGTGGACGCCATGAACTACCACCTG
Gasterosteus_aculeatus|16062 CGCATGATGATGGACCCGCACTGCCACCGGCTGCTGGTGGACGCCATGAACTACCACCTG
Fugu_rubripes|13845          CGGATGATGATGGACCCTCAGTGTCACCGTCTACTGGTGGATGCCATGAACTACCACTTG
                             ** ******.*.** ** ** ** ***** *: ******** **************  **

Danio_rerio|13023            CTGCCCTACCAGCAGAACACACTGCAGTCACGCCGAACAAAAGTCCGCGGGAGCCAGAAT
Oryzias_latipes|2397         CTGCCCTACCAGCAAAACACCCTGCAGTCCAGGCGCACGCAGGTCCGGGGGGCCCAGCCG
Gasterosteus_aculeatus|16062 CTGCCCTTCCAGCAGAACAGCCTGCAGTCCCGACGCACGCAGGTCCGAGCCGGTCAGCAG
Fugu_rubripes|13845          CTGCCCTTCCAGCAGAACACCTTGCAGTCCCGACGCACACAGGTGCGTGGGGCCCAGCAG
                             *******:******.**** . *******..* **.**..*.** ** *  .  ***.. 

Danio_rerio|13023            GCTCTACTAACCATTGGAGGACGGCCTTCGCTGACTGAACGTGCCCTAAGTCGAGAGGTA
Oryzias_latipes|2397         ACTCTGCTGACCATCGGAGGACGCCCGTCTCTCACAGAGAGGGCTCTCAGCCGAGAGGTT
Gasterosteus_aculeatus|16062 GCCCTGCTCAGCGTGGGCGGGCGGCCGTCGCTCACCGAGAGAGCTCTTAGCCGCGAGGTA
Fugu_rubripes|13845          ACTCTCCTCACCATTGGTGGCCGACCTTCGCTTACAGAGAGAGCTCTCAGCCGTGAGGTA
                             .* ** ** * *.* ** ** ** ** ** ** ** **..* ** ** ** ** *****:

Danio_rerio|13023            ------CAAGATCCTCGAGAGGGAACGGCTACATGGCGCCATCTTACTCAACTTCCAGCA
Oryzias_latipes|2397         CTGTGGAGGGACCCTCGTGACAGTGGTGCCACCTGGCGCCACCTGACCCAGCTGCCAGCG
Gasterosteus_aculeatus|16062 CTGTGGAGGGACCCTCGAGAAGGAACAGCCACATGGCGTCACCTCACCCAGCTGCCGGCG
Fugu_rubripes|13845          CTGTGGAGGGACCCTCGTGAAGGAGGAGCCACATGGCGCCACCTCACTCAGCTACCAGCA
                                   ...** *****:** .*:.  ** **.***** ** ** ** **.** **.**.

Danio_rerio|13023            AAGAGCTTCAACCAGTGTGTGGCCGTGATGGACGGATTCCTGTATGTAGCAGGAGGAGAG
Oryzias_latipes|2397         AAGAGCTTCAACCAGTGTGTGGCTGTGATGGATGGCTTCCTGTACGTGGCTGGAGGAGAG
Gasterosteus_aculeatus|16062 AAGAGCTTCAACCAGTGTGTGGCCGTGATGGACGGCTTCTTGTACGTGGCGGGTGGGGAG
Fugu_rubripes|13845          AAGAGCTTCAACCAGTGTGTGGCTGTCATGGACGGCTTCCTGTACGTGCTTGGTGGAGAG
                             *********************** ** ***** **.*** **** **.   **:**.***

Danio_rerio|13023            GATCAAAACGATGCCCGAAACCAGGCTAAACATGCTGTTGGTACCCTTAGCAGATATGAC
Oryzias_latipes|2397         GACCAGAACGACGCCCGGAACCAGGCCAAACACGCCGTCAGCACCCTCAACAGATATGAC
Gasterosteus_aculeatus|16062 GACCAGAACGACGCCCGCAACCAGGCCAAGCACGCCGTCAGCACCCTCAGCAGATACGAC
Fugu_rubripes|13845          GACCAGAACGATGCCCGTAACCAGGCCAAGCATGCCGTCAGCACCCTCAGCAGATATGAT
                             ** **.***** ***** ******** **.** ** ** .* ***** *.****** ** 

Danio_rerio|13023            CCTCGCTTCAACACATGGCTGCATCTGACCAGCATGCGCCAACGACGTACCCACTTCAGT
Oryzias_latipes|2397         CCCCGCTTCAACACCTGGCTCCACCTGGCAAGCATGCGTCAGCGCCGCACCCACTTCTCC
Gasterosteus_aculeatus|16062 CCTCGCTTCAACACCTGGCTCCACCTGGCCAGCATGCGACAGCGCCGCACCCACTTCTCT
Fugu_rubripes|13845          CCTCGCTTTAACACCTGGCTCCACCTGGCCAGTATGCGTCAGCGGCGCACTCATTTCTCT
                             ** ***** *****.***** ** ***.*.** ***** **.** ** ** ** ***:  

Danio_rerio|13023            TTGGTGGCCACAAATGGGCGTCTATACGCCATTGGCGGCCGCAACACCGACGGCCTATTG
Oryzias_latipes|2397         CTGGCAGCCAGCGGTGGCCGCCTGTACGCCATCGGTGGCCGTAACGTCGAGGGCCTGCTG
Gasterosteus_aculeatus|16062 CTGGCAGCCAGCGGCGGCCGCCTGTACGCCATCGGCGGCCGCAACGTGGAGGGTCTGCTG
Fugu_rubripes|13845          CTGGCAGCCAGCGGTGGGCGGCTGTACGCCATTGGTGGCCGCAACGTAGAAGGTCTGCTG
                              *** .**** ... ** ** **.******** ** ***** ***.  ** ** **. **

Danio_rerio|13023            GCCACCATAGAAAGCTACCAACCTTCAACCAACACATGGCAGCTCCGCACCCCAATGGAT
Oryzias_latipes|2397         GCCACCACGGAGAGCTACCTGCCCTCCTCCAACACCTGGCAGATGCGTGCCCCCATGGAA
Gasterosteus_aculeatus|16062 GCCACCACCGAGAGCTACCTGCCGTCCTCCAACGCCTGGCAGATGCGCGCTCCCATGGAG
Fugu_rubripes|13845          GCCACCACTGAGAGCTACCTGCCCTCCTCCAACACTTGGCAGATGCGTGCACCCATGGAG
                             *******  **.*******:.** **.:*****.* ******.* ** .* **.***** 

Danio_rerio|13023            ATGCCAAGATGCTGCCATTCCAGCGCGGTCCTTCCCTCAGGAGATATATTAGTGACCGGC
Oryzias_latipes|2397         GCGCCCCGCTGCTGCCACTCCAGTGCCACTCTGCCCTCCGGAGACATACTGGTGACCGGT
Gasterosteus_aculeatus|16062 GTGCCCCGCTGCTGCCACTCCAGCGCCACCCTGCCCTCTGGAGACCTCCTGGTGACCGGC
Fugu_rubripes|13845          ATGCCTCGTTGCTGCCACTCCAGTTCCACCCTTCCCTCTGGAAACATCCTGGTGACCGGT
                             . *** .* ******** *****  * .  ** ***** ***.* .*. *.******** 

Danio_rerio|13023            GGCTACGTCAACTGCGCATACTCCCGCTCTGTCATCCAATACAGCATTGACAGAGATGCA
Oryzias_latipes|2397         GGGTACATCAGCTGCGCCTACTCCCGCTCTGCCTCATGCTACAATGTAGAGACCGACACC
Gasterosteus_aculeatus|16062 GGCTACATCAACTGCGCCTACTCCCGCTCCGTGGCGTGCTACAACGTTGACAGCGACTCC
Fugu_rubripes|13845          GGCTACATCAACTGTGCCTACTCTCGCTCTGTGGCCTGCTACCAAGTGGAGAGCGACACC
                             ** ***.***.*** **.***** ***** *      ..***.. .* ** * .**  *.

Danio_rerio|13023            TGGAGCGAGAAAGGAGAGCTGGAAACACCACGCGGGTGGCATTGCTCTGCATTACTAGCA
Oryzias_latipes|2397         TGGAGCGAGAAAACCCCCATGGATACGCCCCGCGGCTGGCACTGCTCCGCCACCCTGGGT
Gasterosteus_aculeatus|16062 TGGAGCGAGAAGGCCCCCATGGAGACACCACGCGGCTGGCACTGCTCCGCCGCTCTGGGA
Fugu_rubripes|13845          TGGGTCGATTTAGCCCCAATGGAGACACCCCGTGGTTGGCACTGCTCTGCTACCCTTGGG
                             ***. *** ::.. . . .**** **.**.** ** ***** ***** **    ** *  

Danio_rerio|13023            GGAAAAGTGTATGTTGTTGGTGGAAGCCAATTGGGAGCGGGTGGAGTCCGTATTGATGTG
Oryzias_latipes|2397         GGGAAGGTGTAtgtggtgggaggaagccagctCGGACCTGGTGGAGAGCGGATCGATGTG
Gasterosteus_aculeatus|16062 GGGAAGGTGTACGTGGTGGGAGGGAGCCAGTTGGGGCCGGGCGGGGAGCGGGTAGACGTG
Fugu_rubripes|13845          GGCAAGGTGTATGTAGTTGGAGGAAGTCAACTGGGCCCAGGAGGTGAGCGTGTAGATGTG
                             ** **.***** ** ** **:**.** **. * **  * ** ** *: ** .* ** ***

Danio_rerio|13023            ATGACCATGGAGGTTTATTCTTCGGAGAGCCAGGAGTGGAGTAGAGCTGCTAATCTGCCA
Oryzias_latipes|2397         CTCTCAGTGGAAGTCTTCAGCCCTGACAGTGGAGCGTGGAGCCGGGCGGCACCGCTGCCC
Gasterosteus_aculeatus|16062 CTCTCCGTGGAGGTGTTCTCCCCGGAGGGCAGCGGCTGGAGCCGGGCCGCCCCTCTCCTC
Fugu_rubripes|13845          GTTTCAGTTGAAGTTTTCTCACCAGAGAGTGGCACATGGAGCCGAGCAGCTCCTCTGCCT
                              * :*..* **.** *: :   * ** .*  . .  ***** .*.** ** .. ** *  

Danio_rerio|13023            ATAGGAGTGAGCACGGCTGGGATGTCCCCAATCGGGAGTCATCTGTATATATTAGGTGGA
Oryzias_latipes|2397         TTGGGCGTGAGCACCGCTGGCCTCTCCCTGCTGGGTGAGAAGCTGTACCTGCTGGGGGGC
Gasterosteus_aculeatus|16062 CTCGGCGTGAGCACCGCCGGACTCTCCCCGCTCGCCGACAAGCTGTACCTGCTGGGCGGC
Fugu_rubripes|13845          CTTGGAGTGAGCACCGCTGGTCTAGCCCCGCTGACCGACAAGCTGTATCTACTGGGGGGC
                              * **.******** ** ** .*  *** ..* .  .. .* ***** .*. *.** **.

Danio_rerio|13023            TGGAATGAAGCAGAAAAGCGCTACAAGTCGGCGGTGCAGAGGTATGATCCTGGCACCGAC
Oryzias_latipes|2397         TGGAACGAGGCAGAGAAACGCTACAAGGCAGCCGTGCAGAAGTACGACCCGGCCACAGAT
Gasterosteus_aculeatus|16062 TGGAACGAGGCGGAGAAGCGCTACAAGGCGGCCGTCCAGAAGTACGACCCGGCCACAGAC
Fugu_rubripes|13845          TGGAATGAGGCTGAGAAGCGCTACAAAGCAGCTGTTCAGAAGTATGACCCCGCCACAGAC
                             ***** **.** **.**.********. *.** ** ****.*** ** ** * ***.** 

Danio_rerio|13023            AGCTGGGCAGCAGTGGAGGATCTACCTGAACCCATCGTTGGAGTGTCCTGCTGCGCTCTG
Oryzias_latipes|2397         AGCTGGTCGAAGGGGGAGGATCTACCAGAGCCCACAGTGGGAGTCTCCTGCTGCGCCCTG
Gasterosteus_aculeatus|16062 AGCTGGTCCGCGGCGGAGGACCTGCCCGAGCCCACCGTGGGAGTGTCCTGCTGCACCTTG
Fugu_rubripes|13845          AGCTGGTCTATGGCCGAGGATCTGCCCGAGCCCACAGTAGGAGTTTCATGCTGCACCCTG
                             ****** * . .*  ***** **.** **.**** .** ***** **.******.*  **

Danio_rerio|13023            GGTTTGCCTCCAAGACACACGTCCCGCAGA------CACCGAAACACCCCGTCCCATGAA
Oryzias_latipes|2397         GCGCTGCCACCCCGCCACGCACCCCGCCGACAGCTGCACCGCAACACCCCGGGACACGAG
Gasterosteus_aculeatus|16062 ACCCTGCCGCCCCGCCACGCGCCGCGCCGGCAGCAGCACCGCAACACGCCG---------
Fugu_rubripes|13845          ACCATAcccccccGCCACTCAACACGCCGTCAACAGCAGCGCAGAGCCCCAACaaatgag
                             .   *.** **..*.*** *. * ***.*       ** **.*...* **.         

Danio_rerio|13023            GACCACAGCAGTGTGACT
Oryzias_latipes|2397         GAGCAGAGCCCG------
Gasterosteus_aculeatus|16062 ------------------
Fugu_rubripes|13845          gag---------------
                                               

multiple sequence alignment in CLUSTALW format


Danio_rerio|15770           ------------------------------------------------------------
Oryzias_latipes|8883        MAALDIAQLNSLNLQLPPPAIKPGERGFGLGSELTRPLHGNALLEELSKMRQEKFLTDLE
Gasterosteus_aculeatus|2623 -------------------------------------------------MRQEKFLTDLE
Fugu_rubripes|10391         KRVVSHLQHS---------------KASPARILVTRPQHGNALLEELSKMRQEKFLTDLE
                                                                                        

Danio_rerio|15770           -------------------------------------------GLANVITFAYLGRVHMS
Oryzias_latipes|8883        LACKTKAFDVHKLVISSISQYFREILAKDPGMKRLELPSLSPLGLANVITFAYLGRVHMS
Gasterosteus_aculeatus|2623 LACKTKAFDVHKLVISSISQYFREILAKDPGMKRLELPSLSPLGLANVITFAYLGRVHMS
Fugu_rubripes|10391         LACKTKSFDVHKLVISSISQYFREILAKDPGMKRLELPSLSPLGLANVITFAYLGRVHMS
                                                                       *****************

Danio_rerio|15770           LYTIGCTVSAASTLQIPHLLQMCMDFLMAELNTHTCVYVWNIGAAYGLMPVRDAARRYIL
Oryzias_latipes|8883        LYTIGCTVSAATALQIPQLLKMCMDFLLAELNIQTCVY----------------------
Gasterosteus_aculeatus|2623 LYTIGCTASAAATLQIPQLLKMCMDFLLAELNVQTCVYIWNIAAAYGLTSVSDAARRFVL
Fugu_rubripes|10391         LYTIGCTASAATTLQIPQLLKMCVDFLLAELNVQTCVYIWNIAAAYGLLPVCDAARRFIL
                            *******.***::****:**:**:***:**** :****                      

Danio_rerio|15770           ENFAQFSETTQFNQLTFEQITAFLQDDNLILPSEVSTFQIAMKWLDFDPKRQEHAAELLS
Oryzias_latipes|8883        --------------LTLEQISAFLQDNSLVLPSEVMAFQLAMKWLDFNASRQAHASDLLS
Gasterosteus_aculeatus|2623 ENFVQFADTPLFTQLTLEQISAFLQDDALLLPSEVTAFQLAMRWLDFDSSRQAHAAELLS
Fugu_rubripes|10391         DNFVQFAETPLFTQLTLEQVSAFLQDDSLLLPSEVTAFQLAMKWLDFDASRQPHSAELLS
                                          **:**::*****: *:***** :**:**:****:..** *:::***

Danio_rerio|15770           HVRFETIPASELVSEIQPVPRMMLDPQCHRLLVDAMNYHLLPYQQNTLQSRRTKVRGSQN
Oryzias_latipes|8883        HIRFETIPASELVSQIQPVPRMMLDPQCHRQLVDAMNYHLLPYQQNTLQSRRTQVRGAQP
Gasterosteus_aculeatus|2623 HVRFETIPASELVSQIQPVPRMMMDPHCHRLLVDAMNYHLLPFQQNSLQSRRTQVRAGQQ
Fugu_rubripes|10391         HVRFETIPASELVSQIQPLPRMMMDPQCHRLLVDAMNYHLLPFQQNTLQSRRTQVRGAQQ
                            *:************:***:****:**:*** ***********:***:******:**..* 

Danio_rerio|15770           ALLTIGGRPSLTERALSREV--QDPREGTATWRHLTQLPAKSFNQCVAVMDGFLYVAGGE
Oryzias_latipes|8883        TLLTIGGRPSLTERALSREVLWRDPRDSGATWRHLTQLPAKSFNQCVAVMDGFLYVAGGE
Gasterosteus_aculeatus|2623 ALLSVGGRPSLTERALSREVLWRDPREGTATWRHLTQLPAKSFNQCVAVMDGFLYVAGGE
Fugu_rubripes|10391         TLLTIGGRPSLTERALSREVLWRDPREGGATWRHLTQLPAKSFNQCVAVMDGFLYVLGGE
                            :**::***************  :***:. *************************** ***

Danio_rerio|15770           DQNDARNQAKHAVGTLSRYDPRFNTWLHLTSMRQRRTHFSLVATNGRLYAIGGRNTDGLL
Oryzias_latipes|8883        DQNDARNQAKHAVSTLNRYDPRFNTWLHLASMRQRRTHFSLAASGGRLYAIGGRNVEGLL
Gasterosteus_aculeatus|2623 DQNDARNQAKHAVSTLSRYDPRFNTWLHLASMRQRRTHFSLAASGGRLYAIGGRNVEGLL
Fugu_rubripes|10391         DQNDARNQAKHAVSTLSRYDPRFNTWLHLASMRQRRTHFSLAASGGRLYAIGGRNVEGLL
                            *************.**.************:***********.*:.**********.:***

Danio_rerio|15770           ATIESYQPSTNTWQLRTPMDMPRCCHSSAVLPSGDILVTGGYVNCAYSRSVIQYSIDRDA
Oryzias_latipes|8883        ATTESYLPSSNTWQMRAPMEAPRCCHSSATLPSGDILVTGGYISCAYSRSASCYNVETDT
Gasterosteus_aculeatus|2623 ATTESYLPSSNAWQMRAPMEVPRCCHSSATLPSGDLLVTGGYINCAYSRSVACYNVDSDS
Fugu_rubripes|10391         ATTESYLPSSNTWQMRAPMEMPRCCHSSSTLPSGNILVTGGYINCAYSRSVACYQVESDT
                            ** *** **:*:**:*:**: *******:.****::******:.******.  *.:: *:

Danio_rerio|15770           WSEKGELETPRGWHCSALLAGKVYVVGGSQLGAGGVRIDVMTMEVYSSESQEWSRAANLP
Oryzias_latipes|8883        WSEKTPMDTPRGWHCSATLGGKVYVVGGSQLGPGGERIDVLSVEVFSPDSGAWSRAAPLP
Gasterosteus_aculeatus|2623 WSEKAPMETPRGWHCSAALGGKVYVVGGSQLGPGGERVDVLSVEVFSPEGSGWSRAAPLL
Fugu_rubripes|10391         WVDLAPMETPRGWHCSATLGGKVYVVGGSQLGPGGERVDVVSVEVFSPESGTWSRAAPLP
                            * :   ::********* *.************.** *:**:::**:*.:.  ***** * 

Danio_rerio|15770           IGVSTAGMSPIGSHLYILGGWNEAEKRYKSAVQRYDPGTDSWAAVEDLPEPIVGVSCCAL
Oryzias_latipes|8883        LGVSTAGLSLLGEKLYLLGGWNEAEKRYKAAVQKYDPATDSWSKGEDLPEPTVGVSCCAL
Gasterosteus_aculeatus|2623 LGVSTAGLSPLADKLYLLGGWNEAEKRYKAAVQKYDPATDSWSAAEDLPEPTVGVSCCTL
Fugu_rubripes|10391         LGVSTAGLAPLTDKLYLLGGWNEAEKRYKAAVQKYDPATDSWSMAEDLPEPTVGVSCCTL
                            :******:: : .:**:************:***:***.****:  ****** ******:*

Danio_rerio|15770           GLPPRHTSRR--HRNTPSHEDHSSVT
Oryzias_latipes|8883        ALPPRHAPRRQLHRNTPGHEEQSP--
Gasterosteus_aculeatus|2623 TLPPRHAPRRQQHRNTP---------
Fugu_rubripes|10391         TIPPRHSTRRQQQRRAPTNEE-----
                             :****:.**  :*.:*