Orthologs Set ID: EOG4006BH


Orthology Database
OrthoDB4
Gene Symbol(s)
LOC103094714

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Canis familiaris 17609 413, 420, 584, 1057, 1434, 1947, 1969
Equus caballus 1024 402, 533, 557, 590, 651, 735, 751, 784, 1401, 1489, 1750, 1783, 1803, 1816, 1960
Monodelphis domestica 1117 479, 610, 690, 784, 1383, 1454, 1969

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Canis familiaris 17609 ENSCAFT00000020420 ENSCAFG00000023242 canFam2
Equus caballus 1024 ENSECAT00000012865 ENSECAG00000012271 equCab2
Monodelphis domestica 1117 ENSMODT00000024583 103094714 ENSMODG00000019359 LOC103094714 monDom5

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Canis familiaris 22176 ENSCAFP00000018948 ENSCAFG00000023242 canFam2
Equus caballus 10126 ENSECAP00000010167 ENSECAG00000012271 equCab2
Monodelphis domestica 9505 ENSMODP00000024155 103094714 ENSMODG00000019359 LOC103094714 monDom5

multiple sequence alignment in CLUSTALW format


Canis_familiaris|17609     ------------------------------------------------------------
Equus_caballus|1024        ATGGCTGTGTCTGTGGACCGACAAATTCCGGCTTCTCAAGTACAAGAAGAGCTTCGAATA
Monodelphis_domestica|1117 ATGGCTGTAGTTTTGGACCCCCAGGTTCAGGCTCCTCGAGCACAAGATGGGTTTCTAATA
                                                                                       

Canis_familiaris|17609     ---------------------------GAGCAGGAGATTTCCCTTCAGGAGAGTGACCGT
Equus_caballus|1024        GTGAAGCTGGAAGAAGATTCGGCCTGGGTGCAGGAAACTTCCCTTCAACGGAGTAACCCC
Monodelphis_domestica|1117 GTGAAATTGGAAGATGATTCCCACTGGCATCAGGAATCTTTCCTTCATAGAAATGTCCAT
                                                       : *****.: ** ******  ..*.*.:**  

Canis_familiaris|17609     GGACCAGAGACCTCCTGCCAGCGTTTCTGGCATTTCTGCTATCAGGAAGCATCAGGACCC
Equus_caballus|1024        GGACCAGAGACCTCCTGCCAGCGCTTTTGGCATTTCCGCTATCAAGAAGCATCTGGACCC
Monodelphis_domestica|1117 AGTCCTGAGGCTTCCTGTCAGCGGTTCTGGCAGTTCCACTACCAGGAGGCAGCAGGACCA
                           .*:**:***.* ***** ***** ** ***** *** .*** **.**.*** *:*****.

Canis_familiaris|17609     CGGGAGGCCCTTATCCAACTCCGGAAGCTCTGTCGTCAGTGGCTGAGACCAGAGGAGTGT
Equus_caballus|1024        CGGGAGGCCCTCATCCAACTCCGGACGCTCTGCCGTCAGTGGCTGAGACCAGAGAAGTGT
Monodelphis_domestica|1117 CGTGAAGCTTTGAACCAACTCCGTGAACTCTGTCGACAGTGGTTGCGACCAGAGAAGTGC
                           ** **.**  * *:********* ...***** **:****** **.********.**** 

Canis_familiaris|17609     ACAAAAGACCAGATCCTGGAGTTGCTGGTGCTGGAACAGTTCCTGACTGTCCTTCCTCAG
Equus_caballus|1024        ACAAAAGAGCAGATCTTGGAGTTGCTAGTCCTGGAGCAGTTCCTGACTGTCCTTCCCCAG
Monodelphis_domestica|1117 ACAAAAGAGCAGATTCTGGAGCTGCTGGTGCTTGAGCAGTTCCTGACTGTTCTGCCTAGA
                           ******** *****  ***** ****.** ** **.************** ** ** ...

Canis_familiaris|17609     GAGATCCAGATCTGGGTTAGACAGAAGCATCCAGAGAGTGGAGAGGCGGCCGTGGCCCTG
Equus_caballus|1024        GAGCTCCAGATCTGGGTTAGACAAAAGCATCCAGAAAGTGGAGAGGAGGCAGTGGGCCTG
Monodelphis_domestica|1117 GAAATCCAGACCTGGGTTAGAGAACAGCATCCAGAGAATGGAGAGGAGGCAGTGACTCTG
                           **..****** ********** *..**********.*.********.***.***.  ***

Canis_familiaris|17609     GTGGAAGACTTGCAGAAAGGACCTGGACGATATGGGCTCCAGGTGAGAAACAGGGGGAAT
Equus_caballus|1024        GTGGAAGACTTGCAGAAAGAACCTGGAAGACAGGGGCTACAG------------------
Monodelphis_domestica|1117 GTGGAAAATATGCAAAGAGAACCTGGCAGATCAGCGATGAAGGTGAGAATG---------
                           ******.* :****.*.**.******..** . * *.* .**                  

Canis_familiaris|17609     GGACAGAAGGTACACTCAGAGGAGTTGGGACCCTTGGGATCAGCGCCAGGTTCCCTAAGC
Equus_caballus|1024        GGGCAGGAGTTGCTCTCAGTGGAGAAGGAACCCTCAGGACCAGAACTGGGTTCCCTAAAC
Monodelphis_domestica|1117 GGGATACCTTTGTTTCATGAAAATAGAGCT---------------------------TAT
                           **..:. .  *. :  .:*:..* : .* :                           :. 

Canis_familiaris|17609     ATCTATCTGAAGCAAGTGCAGACAGAATCCATGTGTCTGTTACAGGTGATGGTGAGAAAC
Equus_caballus|1024        ATCCATCTGAAGCAA---------------------GCATACCCAGAATCCACTGGTAAG
Monodelphis_domestica|1117 ATCCACCTGAAGCAAACACAGACAAAATCCAAATGTACATTCCAGGAGAACGCAGAGAGA
                           *** * *********                       .*:.*..*:.:  .  .. *. 

Canis_familiaris|17609     TCACAGCCAGAACCAGAAGAACAGTTGAATCACAACCCAAAAGTTCTTCCTGCAAAT---
Equus_caballus|1024        ---------AAGCGGCAGGTTAAACTCAAGTGCAGTAATTTTCACAACAGCACCACGGCT
Monodelphis_domestica|1117 TTACACCTAGAACCAGAGAAAGAGCTGAGCTGTGATCCTAAGATAGAGCCCCATTCCCTT
                                    .*.* . *..:: *. * *.  . .. ..:::  :  : .   . :.    

Canis_familiaris|17609     ------------------------------------------------------------
Equus_caballus|1024        GAGGTAGTGAGGGGTCATATTAAAGTCATTCTTTTCCTTCACCCTGAGACTTTGGTGACG
Monodelphis_domestica|1117 CAGGAGAGTGCTCTGTCTGCTTCTCAGGTCCTTGATCTT---CCTGTGGAGGCAAGTAGT
                                                                                       

Canis_familiaris|17609     ------------------------------------------------------------
Equus_caballus|1024        TTTGGTGATGTGACTGTGTATGTCTCCCAGGAGGCACAGAGGCAACTGGAATCTGGACAG
Monodelphis_domestica|1117 GGTAACCAAGAGATGGTGGGCAAGTCCCAGGAGGCTCAAGGGCAGTTGGATTCAGCTCCA
                                                                                       

Canis_familiaris|17609     ------------------------------------------------------------
Equus_caballus|1024        AGGAGCCACCGGGAAATGAATATGGATATAATGGGAGTTAGACTCACTAAGCCATCATGT
Monodelphis_domestica|1117 CAGGACTTCTGCCAAGATCAAACTCAGGAGAATGAGAATGGTGTCTCACAG---------
                                                                                       

Canis_familiaris|17609     ---AGATTTGCCAACCCACGACCTAGGGTCAACTGCCACAGGGAG---GAGGAAAACCCA
Equus_caballus|1024        CTTCATTTCCCAGCCCACAGACCCAGTGTGAGCTCCCACGTGGAGCAGGAGGAAAGCCCA
Monodelphis_domestica|1117 ---AGGTTTCCAATTCCCAGAACCAGCATGATCTCCCAAATAGAGCAAGGGGAGAAACTG
                              .. **  *..  *...**.* ** .* * ** ***.. .***   *.***.*..* .

Canis_familiaris|17609     CAGAGCCCAGATCATCAGGGTCTCGGAGAG---GAGGGCACCAGAGACTCTCCAGCGAGT
Equus_caballus|1024        GAGAGCCCAGATCTTCAGCACTCCAGAGAT---GAGAGTGTGAGAGACACCCTGGTGGCG
Monodelphis_domestica|1117 CAGAACCTAGATCTTCAAGGCTGTAAAGAGAAGGAAAATTCAAGAGATTCTCGAATGGTT
                            ***.** *****:***. .    ..***    **...    ***** :* * .. *.  

Canis_familiaris|17609     GGGAGAAGAGTCAAGCCCAGCTACTTGCCCATCCTGAGAAAACCCAAGACCTGGGAGGAG
Equus_caballus|1024        GCGGGAAGAGTCAAGCCTGGCCAGGGGCCCATCTTGAGAAAAGCCAAGACCTGGGACGAG
Monodelphis_domestica|1117 GGAGAACGAACAAAAATTGGTCAGGCACCAGTGATGAAAAAAGTCAAACACTGGGAAGAG
                           * ...*.**. .**..  .*  *   .**..*  ***.****  ***...****** ***

Canis_familiaris|17609     CTGGAGTGGCAGGGCCTGGAGGATGAGAAGGTGGCAGGGGTGCACTGGGGCTATGAGGAG
Equus_caballus|1024        CTGGAGTGGCAGGGTCTGGAGGATGAGAAGGTGGCAGGGGTGCACTGGGGCTATGAGGAA
Monodelphis_domestica|1117 CTGGAGCGTCAGGGCTTGGATGATGAAAAGGTGGCTGGTGTACACTGGGGCTATGAGGAA
                           ****** * *****  **** *****.********:** **.*****************.

Canis_familiaris|17609     ACCAAGATCTTTTTGGAAATTCTC------------ATCCATGAGAAGCTGCGCACCTGC
Equus_caballus|1024        ACGAAGACTTTTCTGGATATTCTCAGTGAGTCCTGGATCCACAAGAAACTCCGCACATGC
Monodelphis_domestica|1117 ACCAAAATTTTCCTAGGGATTCTCAGTGAGTCTTGGATTTATGAAAAACTCCGAACTTGT
                           ** **.*  **  *.*. ******            **  * .*.**.** **.** ** 

Canis_familiaris|17609     CATCGGAATCGCCAGGTGTACCGGCTGGTGGCTGCGCGGCTGCGGGAGCGCGGCTTCCTA
Equus_caballus|1024        CATCGGAACCGCCAAGTCTACCGGCTTGTGGCCGAGCGGCTGCGAGAGCGCGGCTTCCTG
Monodelphis_domestica|1117 CACAGGAACCGTCAGGTATACCGGATTGTAGCTGAGCGACTACGTGAGCGAGGCTTCCTC
                           ** .**** ** **.** ******.* **.** *.***.**.** *****.******** 

Canis_familiaris|17609     CGGACCCTGGAACGGTGTCGCTACCGGTTCAAAAACCTCCAGACCCACTATCGCAAAGCC
Equus_caballus|1024        CGGACCCTGGAGCAGTGTCGCTACCGGTTCAAAAACCTCCAGACCAACTACCGCAAAGCC
Monodelphis_domestica|1117 CGTACTCTGGAACAATGTCGATATAGATTTAAAAACCTTCAAACAAACTACCGTAAAGCA
                           ** ** *****.*..*****.** .*.** ******** **.**..**** ** *****.

Canis_familiaris|17609     AGGAGCAGCCGCACTCCAGGCACTTGCCCCTTCTATCAGGAGATGGATGCCCTGATGTGC
Equus_caballus|1024        AGGAGCACTCATATGCCAGACACCTGCCCCTTCTATGATGAGATGGATGCCCTCATGTGC
Monodelphis_domestica|1117 AGAAGCACCCACACCCCAGGAACCTGCCCCTTCTATGAGGAAATGGATGCTCTAATGAGC
                           **.****  *. *  ****..** ************ * **.******** ** ***:**

Canis_familiaris|17609     CCACAGGCTGCCATCCCCATTCCAGATGTGGCAGGGGCTCTGCTTAGCCAGAGCGACCCT
Equus_caballus|1024        CCACGGGCTGCCACCTCCGTTCTAGAGGTGGCAGGGGGTGTGCTTGGGCAGAGGGACCAT
Monodelphis_domestica|1117 CCTCGTGTTGCTGTCACTGCTCCAGAGGTGGAAGGGGAT---CTTGGGCAGGGAGACCAT
                           **:*. * *** . * * . ** *** ****.***** *   ***.* ***.* ****.*

Canis_familiaris|17609     GATGTGGAGCAGGAAGAGCTGCAGGAGGGTTACTGGGGAGAGGAGGAGGCGGTGCTGGCT
Equus_caballus|1024        GACACAGAGCAGGAAGAGCTGCAGAGTGGTTGCTGGGACCAGGAGGCGGCAGCGCTGGCC
Monodelphis_domestica|1117 GATATTGAAAGTGAAGAACTGGAGAGGGATAATTGGGAACATGAAGATATAGCAATGGCA
                           ** .  **... *****.*** **.. *.*:. ****.. * **.*. . .* ..**** 

Canis_familiaris|17609     GAGGCTGTGCTGGAACGCGAGTCAGAGGAGCCGGGGCAGAACACGGGCCACACACCTCAG
Equus_caballus|1024        ---------------AAGGCTGGGGAAGAACTGGGTGCTGAAGAAGGGTCTGCAAGCCCT
Monodelphis_domestica|1117 GGG---------GATTCTGACGGTGAGGAATTGGGCAATGATGAACCATCTGAAAGCCCT
                                             *.    **.**.  ***  . .* ...    . ..*.  *. 

Canis_familiaris|17609     GACACAAACAGCTGCGGCATCTTAGCTTTCCTCTCTTCCTTTCCTCCAGGGGTGCACTGG
Equus_caballus|1024        GGT---------CTCCCAGCCCTG------TTTCGG---AGCCCTACTGGTGTGCACTGG
Monodelphis_domestica|1117 GGTACCCAAACCCTACCTTGTTTGATAGGTCTCAAC---TTTTCTCTAGGAGTACACTGG
                           *.            .       *.       *       :   **. :** **.******

Canis_familiaris|17609     GGCTATGAGGAAACGAAAACCTTCCTGGGGATTCTTGGGGAGCCCTACATCCATGAGAAG
Equus_caballus|1024        GGCTACGAAGAAACTAAAATTTTCCTGGGAATTCTCGGTGAGCCCTACATTCATGAGAAA
Monodelphis_domestica|1117 GGTTATGAAGAAACCAAGATTTTTCTGGGGATTCTCGGTGAACCTCGTATTTATGAAAAA
                           ** ** **.***** **.*  ** *****.***** ** **.**  . **  ****.**.

Canis_familiaris|17609     CTGCGCACCTGCCATCGGAACCGCCAGGTGTACCGGCTGGTAGCTGCGCGGCTGCGGGAG
Equus_caballus|1024        CTCCGCACCTGCCATCGGAACCGCCAAGTGTATCGGCTTGTGGCCGAGCGGCTGCGGGCA
Monodelphis_domestica|1117 CTTCGGACCTGTCATCGGAACCGTCAAGTGTATAGGATTGTAGCTGAGCGACTTCGTGAA
                           ** ** ***** *********** **.***** .**.* **.** *.***.** ** *..

Canis_familiaris|17609     CACGGCTTCCTGCGGACCCTGGAACAGTGTCGCTACCGGTTCAAAAACCTCCAGACCCAC
Equus_caballus|1024        TGTGGTTTCTTACGGACCCTGGAGCAGTGTCGCTACCGGTTCAAAAACCTCCAGACCAAC
Monodelphis_domestica|1117 TGTGGCTTCCTCCGGACTCTGGAACAATGTCGTTACAGATTCAAAAACCTTCAGACACAC
                            . ** *** * ***** *****.**.***** ***.*.*********** *****..**

Canis_familiaris|17609     TACCGAAAAGCCAGGAGCAGCCGTGCTCCAGCCACCTGCCCCTTCTATCAGGAGATGGAT
Equus_caballus|1024        TACCGCAAAGCCAGGAGCATCCACGCTCCAGGCACCTGCCCCTTCTATGACGAGATGGAC
Monodelphis_domestica|1117 TACCGAAAAGCAAGAAGTGGCCACACCCCAGAGACCTGCCCCTTCTATGAGGAGATGGAT
                           *****.*****.**.** . **. .* ****  *************** * ******** 

Canis_familiaris|17609     GCCCTGATGAGCCCCTGGACCCTCACTGGCACCGTTGATGCCCTAGAGGTGGCGGGAGGC
Equus_caballus|1024        GCCCTGCTGGAGAGGTCAGCGTCACGTAAAGTTTTAGTTGTTTCCCAGGCCCTTGGCCTT
Monodelphis_domestica|1117 GCCTTGATGAGTCCATGGACAGCCATTACACCACTTGATGTCCTAGAAATGGCAGGGGGT
                           *** **.**.. .  * ..*   .. *. .    *:*:**    . *..     **    

Canis_familiaris|17609     CTGTTGTGGAACAGGGGGGACTCTGAAGAGAACCAGAAGGCCACGCTGGAGGATGTGACA
Equus_caballus|1024        CCCATGTGCGGCCACACCAAGCTTGGGGGCAGA---------------GCCTCTGGGGAG
Monodelphis_domestica|1117 CTCCTA------AAGGGGAAAGTTGAGTCCAAA---------------GAGAACACTAAC
                           *   *.      .. .  .*   **..   *..               *.  . .  .. 

Canis_familiaris|17609     TGGGATGGTAGTGAACTGGCCGAG------------------GAACCCCAGGAGGAGCCC
Equus_caballus|1024        TGGGGAGGGGCTGTGACTGAAGAA------------------------------------
Monodelphis_domestica|1117 TGGGAGAACCCAGAGACAGTGACAGAAGTTGGCAACCATGTGGAAGTGGAGGAACCTCCA
                           ****. ..   :*:..  *  ...                                    

Canis_familiaris|17609     AGGAGCCTTGGCCCTCAGGCCTGGAAGcTCCCACTTAAGTTTCAATCTGATCGTGACATG
Equus_caballus|1024        ---------GGAGAATGGGCCTGGACCTGTCTCCCTCCTTATCCT---------GAAACA
Monodelphis_domestica|1117 AAAGAGGTCAAAAACTTTAAGTTAGAGGCTGTCTTTCAGAATTCCAGTGATTTTGAAATG
                                    ... .    .. * ...      .  *.. ::* .          **.* .

Canis_familiaris|17609     AGGACAGAGGACAAGGAGAATTCAAGCCAGGACATCTCAGTGGAAGCAGAGCTACAGGGA
Equus_caballus|1024        AGGACAGAGAATGAGGAGAACTTGAGCCAGGACATTTCAGAGGAAGTAGGACTCCCCGGG
Monodelphis_domestica|1117 ACTGGTAAGCATGAGAAGAATCCAAGCCAGGAAATTTCTGAGGGAGTAGAACTACATGCA
                           *  . :.** * .**.****   .********.** **:*:**.** **..**.*. * .

Canis_familiaris|17609     GCACAGTTAGAGAGACCCCAAATAGATGCTTCCCAGGCCCCTGATTGGAGGAAAAACTGG
Equus_caballus|1024        GCGTTGTTAGAAAGATCCAAAATGGATGTCTCCCAGTCCTTTAATTGGAAGAAAGACCAG
Monodelphis_domestica|1117 ACATCACTAGGGAGCTCCAAAGGAAATGCTTCTCATTATCTTAATTGGAAGAAAGCCCAA
                           .*.  . ***..**. **.**. ..***  ** **  .   *.******.****..* ..

Canis_familiaris|17609     GCAGGCGAATGTGGAGTGGAAAAGCAGTGGGAAACACCCTCAGAAGACAGACAAAAAGCA
Equus_caballus|1024        GAAAGTGAATATGAGGCAGAAAAGCAATGGGAAATACCCTTAGAAGATGGACAAGGGTGG
Monodelphis_domestica|1117 GAAGGTGAATACAGAACTGAAAGGCAATGGGAAATGCTTCCAGGAGAAGAACAAGGACCA
                           *.*.* ****. ....  ****.***.******* .*    **.*** ..****...  .

Canis_familiaris|17609     CTCTTCCCTCCAGAAAGAGATGTAGGTAAACTCCTAGATCCTCAG---------------
Equus_caballus|1024        CTCTCTCCTCCAGAAAGAGACTTAGGTAAATTCATAGGTCCTCAGGGAACCTATGTAGAA
Monodelphis_domestica|1117 CCATCTCCTCAGGAAAGAAATTTAGGCAATTTTATAGGACTTCAAGGAACCTACATAGGA
                           * .*  ****..******.*  **** **: * .***.:* ***.               

Canis_familiaris|17609     ------------------------------------------------------------
Equus_caballus|1024        GAAAAATCCAACATACACTGTGAATGTGGAAAACATTCCAGCCAGAGCTCACACTCAGCT
Monodelphis_domestica|1117 GAAAACCCAAACACATGTTCTGAATGTGGAAAAAACTTCAGCCAGAGCTCACACCTTGCT
                                                                                       

Canis_familiaris|17609     ------------------------------------------------------------
Equus_caballus|1024        GCCCACAGGTTCGCCCACAGTGGAGAGAAGAGGCCTTACAAATGTGGCTGCTGTGGGAGG
Monodelphis_domestica|1117 GTACATCGATTAGCTCACATTGGGGAGAAGAAATTACATGATTGTGAGGAGTGTGGCAAG
                                                                                       

Canis_familiaris|17609     ------------------------------------------------------------
Equus_caballus|1024        AGCTGTGCCCGGAGCCGCCGTCTGGTTTGCCAGCAGAGGATGCACACCGGGGGGAAGCCC
Monodelphis_domestica|1117 ACCTTTAGTCGAAGTTCACATCTCATTTGCCACCAGAGAATCCACACAGGAGAGAAGCCT
                                                                                       

Canis_familiaris|17609     ------------------------------------------------------------
Equus_caballus|1024        TGCGCGTGCCCCGCCTGTGGGAAAGGCTTCAGCGATCACCCTAACCTCACGGCTCACCAG
Monodelphis_domestica|1117 TACAAATGTCCTGAATGTAGAAAAGGCTTCAGTGATCACTCTAACCTTACAGCCCACCAA
                                                                                       

Canis_familiaris|17609     ------------------------------------------------------------
Equus_caballus|1024        ACAATCCACACTGTAGAAAAGCCCTATAAATGTGGAGAGTGCTGGAAAAGCTTCAACCAG
Monodelphis_domestica|1117 AGAATTCATACAGGAGAAAAACCCTATAAATGTAGTGAGTGCTGGAAAAGCTTCAATCAG
                                                                                       

Canis_familiaris|17609     ------------------------------------------------------------
Equus_caballus|1024        AGCTCAAGCCTTATCATGCACCAGAGAATCCACACAGGAGAGAAACCCCATAAGTGTAGT
Monodelphis_domestica|1117 AGCTCAAGCCTTATTATGCATCAGAGAATTCACACAGGAGAGAAACCTCATAAATGCAGT
                                                                                       

Canis_familiaris|17609     ------------------------------------------------------------
Equus_caballus|1024        GAGTGTGGAAAAAGTTTCACCAGTAGCTCGCACTTCAGCGCCCACTGGCGAACGCACACT
Monodelphis_domestica|1117 GAATGTGGAAAAAGTTTTACCAATAGCTCACATTTCAATGCTCACTGGCGGACTCATACA
                                                                                       

Canis_familiaris|17609     ------------------------------------------------------------
Equus_caballus|1024        GGCGACAAACCCTACCAGTGCCCTGAGTGCGGGAAAAAGTTCAGTAAGAGCTCCACTCTC
Monodelphis_domestica|1117 GGTGAAAAACCCTACCAGTGTCCTGAATGTGGGAAAAGATTCAGTAAAAGTTCTACTCTC
                                                                                       

Canis_familiaris|17609     ------------------------------------------------------------
Equus_caballus|1024        ACCAGCCACCAGAGGATCCACACAGGAGAGAAACCCTACGAGTGTCTTGAATGCGGGAAG
Monodelphis_domestica|1117 ACTAGCCATCAGAGAATACATACAGGAGAAAAACCCTATGAATGTCTTGAATGTGGGAAA
                                                                                       

Canis_familiaris|17609     ------------------------------------------------------------
Equus_caballus|1024        AGTTTCAGCGACCGCTCAAACCTTATTACCCACCGGCGCATTCACACTGGAGAGAGACCC
Monodelphis_domestica|1117 AGTTTCAGCGATCGCTCAAATCTCATTACACATCGACGAATTCATACAGGAGAAAGACCT
                                                                                       

Canis_familiaris|17609     ------------------------------------------------------------
Equus_caballus|1024        TACAAATGCGGAGAGTGTGGGAAGAGCTTCAATCAGAGCTCAAGTCTTATTATCCACCAG
Monodelphis_domestica|1117 TATAAGTGTGGTGAGTGTGGGAAAAGCTTCAATCAGAGTTCAAGCCTTATTATACACCAG
                                                                                       

Canis_familiaris|17609     ------------------------------------------------------------
Equus_caballus|1024        AGGATCCACACGGGAGAGAAGCCCTATGCGTGTGCTGACTGTGGAAGGCGATTCAACAAC
Monodelphis_domestica|1117 AGAATACACACAGGAGAAAAACCCTATGAATGTAATGAATGTGGGAGAAGGTTTAATAAC
                                                                                       

Canis_familiaris|17609     ---------------------------------------------
Equus_caballus|1024        AGCTCACACTTTAGTGCCCATCGGAGGACCCACGTGGGAGAGAGG
Monodelphis_domestica|1117 AGCTCACACTTTAGTGCACACCGGAGAACTCATGTTGGAGAGAAA
                                                                        

multiple sequence alignment in CLUSTALW format


Canis_familiaris|22176     -----------------------------EQEISLQESDRGPETSCQRFWHFCYQEASGP
Equus_caballus|10126       MAVSVDRQIPASQVQEELRIVKLEEDSAWVQETSLQRSNPGPETSCQRFWHFRYQEASGP
Monodelphis_domestica|9505 MAVVLDPQVQAPRAQDGFLIVKLEDDSHWHQESFLHRNVHSPEASCQRFWQFHYQEAAGP
                                                         **  *:..  .**:******:* ****:**

Canis_familiaris|22176     REALIQLRKLCRQWLRPEECTKDQILELLVLEQFLTVLPQEIQIWVRQKHPESGEAAVAL
Equus_caballus|10126       REALIQLRTLCRQWLRPEKCTKEQILELLVLEQFLTVLPQELQIWVRQKHPESGEEAVGL
Monodelphis_domestica|9505 REALNQLRELCRQWLRPEKCTKEQILELLVLEQFLTVLPREIQTWVREQHPENGEEAVTL
                           **** *** *********:***:****************:*:* ***::***.** ** *

Canis_familiaris|22176     VEDLQKGPGRYGLQVRNRGNGQKVHSEELGPLGSAPGSLSIYLKQVQTESMCLLQVMVRN
Equus_caballus|10126       VEDLQKEPGRQGLQ------GQELLSVEKEPSGPELGSLNIHLKQ-------AYPESTGK
Monodelphis_domestica|9505 VENMQREPGRSAMKVRM---GIPLFHENRA---------YIHLKQTQTKSKCTFQENAER
                           **::*: *** .::      *  :   :            *:***            . .

Canis_familiaris|22176     SQPEPEEQLNHNPKVLPAN-----------------------------------------
Equus_caballus|10126       ---KRQVKLKCSNFHNSTTAEVVRGHIKVILFLHPETLVTFGDVTVYVSQEAQRQLESGQ
Monodelphis_domestica|9505 LHLEPEKELSCDPKIEPHSLQESALSASQVLDL-PVEASSGNQEMVGKSQEAQGQLDSAP
                              : : :*. .    . .                                         

Canis_familiaris|22176     ---------------------RFANPRPRVNCHRE-EENPQSPDHQGLGE-EGTRDSPAS
Equus_caballus|10126       RSHREMNMDIMGVRLTKPSCLHFPAHRPSVSSHVEQEESPESPDLQHSRD-ESVRDTLVA
Monodelphis_domestica|9505 QDFCQDQTQENENGVSQ----RFPIPRTSMISQIEQGEKLQNLDLQGCKEKENSRDSRMV
                                                :*.  *. : .: *  *. :. * *   : *. **:   

Canis_familiaris|22176     GRRVKPSYLPILRKPKTWEELEWQGLEDEKVAGVHWGYEETKIFLEIL----IHEKLRTC
Equus_caballus|10126       AGRVKPGQGPILRKAKTWDELEWQGLEDEKVAGVHWGYEETKTFLDILSESWIHKKLRTC
Monodelphis_domestica|9505 GERTKIGQAPVMKKVKHWEELERQGLDDEKVAGVHWGYEETKIFLGILSESWIYEKLRTC
                           . *.* .  *:::* * *:*** ***:*************** ** **    *::*****

Canis_familiaris|22176     HRNRQVYRLVAARLRERGFLRTLERCRYRFKNLQTHYRKARSSRTPGTCPFYQEMDALMC
Equus_caballus|10126       HRNRQVYRLVAERLRERGFLRTLEQCRYRFKNLQTNYRKARSTHMPDTCPFYDEMDALMC
Monodelphis_domestica|9505 HRNRQVYRIVAERLRERGFLRTLEQCRYRFKNLQTNYRKARSTHTPGTCPFYEEMDALMS
                           ********:** ************:**********:******:: *.*****:******.

Canis_familiaris|22176     PQAAIPIPDVAGALLSQSDPDVEQEELQEGYWGEEEAVLAEAVLERESEEPGQNTGHTPQ
Equus_caballus|10126       PRAATSVLEVAGGVLGQRDHDTEQEELQSGCWDQEAAALA-----KAGEELGAEEGSASP
Monodelphis_domestica|9505 PRVAVTAPEVEGD-LGQGDHDIESEELERDNWEHEDIAMAG---DSDGEELGNDEPSESP
                           *:.* .  :* *  *.* * * *.***: . * .*  .:*       .** * :    . 

Canis_familiaris|22176     DTNSCGILAFLSSFPPGVHWGYEETKTFLGILGEPYIHEKLRTCHRNRQVYRLVAARLRE
Equus_caballus|10126       G---LPAL--FR-SPTGVHWGYEETKIFLGILGEPYIHEKLRTCHRNRQVYRLVAERLRA
Monodelphis_domestica|9505 GTQTLPCLIGLN-FSLGVHWGYEETKIFLGILGEPRIYEKLRTCHRNRQVYRIVAERLRE
                           .      *  :   . ********** ******** *:**************:** *** 

Canis_familiaris|22176     HGFLRTLEQCRYRFKNLQTHYRKARSSRAPATCPFYQEMDALMSPWTLTGTVDALEVAGG
Equus_caballus|10126       CGFLRTLEQCRYRFKNLQTNYRKARSIHAPGTCPFYDEMDALLERSASRKVLVVSQALGL
Monodelphis_domestica|9505 CGFLRTLEQCRYRFKNLQTHYRKARSGHTPETCPFYEEMDALMSPWTAITPLDVLEMAGG
                            ******************:****** ::* *****:*****:.  :    : . :  * 

Canis_familiaris|22176     LLWNRGDSEENQKATLEDVTWDGSELAE------EPQEEPRSLGPQAWKLPLKFQSDRDM
Equus_caballus|10126       PMCGHTKLGGR-----ASGEWGGAVTEE---------------GEWAWTCLPPYP---ET
Monodelphis_domestica|9505 LL--KGKVESK-----ENTNWENPETVTEVGNHVEVEEPPKEVKNFKLEAVFQNSSDFEM
                            :  : .   .      .  * ..                                  : 

Canis_familiaris|22176     RTEDKENSSQDISVEAELQGAQLERPQIDASQAPDWRKNWAGECGVEKQWETPSEDRQKA
Equus_caballus|10126       RTENEENLSQDISEEVGLPGALLERSKMDVSQSFNWKKDQESEYEAEKQWEIPLEDGQGW
Monodelphis_domestica|9505 TGKHEKNPSQEISEGVELHATSLGSSKGNASHYLNWKKAQEGEYRTERQWEMLPGEEQGP
                             :.::* **:**  . * .: *  .: :.*:  :*:*   .*  .*:***    : *  

Canis_familiaris|22176     LFPPERDVGKLLDPQ---------------------------------------------
Equus_caballus|10126       LSPPERDLGKFIGPQGTYVEEKSNIHCECGKHSSQSSHSAAHRFAHSGEKRPYKCGCCGR
Monodelphis_domestica|9505 PSPQERNLGNFIGLQGTYIGENPNTCSECGKNFSQSSHLAVHRLAHIGEKKLHDCEECGK
                             * **::*:::. *                                             

Canis_familiaris|22176     ------------------------------------------------------------
Equus_caballus|10126       SCARSRRLVCQQRMHTGGKPCACPACGKGFSDHPNLTAHQTIHTVEKPYKCGECWKSFNQ
Monodelphis_domestica|9505 TFSRSSHLICHQRIHTGEKPYKCPECRKGFSDHSNLTAHQRIHTGEKPYKCSECWKSFNQ
                                                                                       

Canis_familiaris|22176     ------------------------------------------------------------
Equus_caballus|10126       SSSLIMHQRIHTGEKPHKCSECGKSFTSSSHFSAHWRTHTGDKPYQCPECGKKFSKSSTL
Monodelphis_domestica|9505 SSSLIMHQRIHTGEKPHKCSECGKSFTNSSHFNAHWRTHTGEKPYQCPECGKRFSKSSTL
                                                                                       

Canis_familiaris|22176     ------------------------------------------------------------
Equus_caballus|10126       TSHQRIHTGEKPYECLECGKSFSDRSNLITHRRIHTGERPYKCGECGKSFNQSSSLIIHQ
Monodelphis_domestica|9505 TSHQRIHTGEKPYECLECGKSFSDRSNLITHRRIHTGERPYKCGECGKSFNQSSSLIIHQ
                                                                                       

Canis_familiaris|22176     -----------------------------------
Equus_caballus|10126       RIHTGEKPYACADCGRRFNNSSHFSAHRRTHVGER
Monodelphis_domestica|9505 RIHTGEKPYECNECGRRFNNSSHFSAHRRTHVGEK