Orthologs Set ID: EOG4006BJ


Orthology Database
OrthoDB4
Gene Symbol(s)
GM20784,AZ2,GH19813

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Drosophila grimshawi 7650 357, 441, 804
Drosophila melanogaster 4589 441, 804
Drosophila sechellia 15727 441, 804
Drosophila simulans 3285 441, 804
Drosophila yakuba 13109 441, 804

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Drosophila grimshawi 7650 FBtr0155227 6560359 FBgn0127277 GH19813 droGri2
Drosophila melanogaster 4589 FBtr0088980, NM_136445 35682 FBgn0025185 az2 dm3
Drosophila sechellia 15727 FBtr0203769 6608009 FBgn0175665 GM20784 droSec1
Drosophila simulans 3285 FBtr0210156 6733382 FBgn0182021 GD10246 droSim1
Drosophila yakuba 13109 FBtr0270422 6528435 FBgn0241052 GE23904 droYak2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Drosophila grimshawi 9626 FBpp0153719 6560359 FBgn0127277 GH19813 droGri2
Drosophila melanogaster 4213 FBpp0088053 35682 FBgn0025185 az2 dm3
Drosophila sechellia 10487 FBpp0202261 6608009 FBgn0175665 GM20784 droSec1
Drosophila simulans 698 FBpp0208648 6733382 FBgn0182021 GD10246 droSim1
Drosophila yakuba 13685 FBpp0268914 6528435 FBgn0241052 GE23904 droYak2

multiple sequence alignment in CLUSTALW format


Drosophila_grimshawi|7650    ATGGTGATTTGTGGTACAGTTCGGGTGCGGAACAATTACGAAGAGTTCTTATTAAGCTGC
Drosophila_yakuba|13109      ATGGTCGTTTGCGGAAACATTTTGGCCAGGAACAACTTTGGGCACTTTGTTCTTGCGTGT
Drosophila_sechellia|15727   ATGGTGGTTTGTGGGAACATTTTGGCCAGGAACAACTTTGAGCACTTTGTTCTGGCGTGT
Drosophila_melanogaster|4589 ATGGTGGTTTGCGGGAACATTTTGGCCAGGAACAACTTCGAGCACTTTGTTCTGGCGTGT
Drosophila_simulans|3285     ATGGTGGTTTGTGGGAACATTTTGGCCAGGAACAACTTTGAGCACTTTGTTCTGGCGTGT
                             ***** .**** ** *...**  **  .******* *: *.. * **  *: * .  ** 

Drosophila_grimshawi|7650    TCGCACTGCAAAAGCGGTTGCGACGTGGAAGTGAGTCTAGAAAGATGGCAAGAATTTGTC
Drosophila_yakuba|13109      GCTCAA---AAAAATGACTGCTACGTGGAGATGGAGTTCGAGAGGTGGCGGGAGTTTATC
Drosophila_sechellia|15727   GCTCAC---CAGAATGACTGCTACGTGGAGATGGAGTTCAAGCGGTGGCGGGAGTTCATC
Drosophila_melanogaster|4589 GCTCAC---CAAAATGACTGCTACGTGGAGATGGAGTTCAAGCGGTGGCGAGAGTTCATC
Drosophila_simulans|3285     GCTCAC---CAAAATGATTGCTACGTGGAGATGGAGTTCAAGCGGTGGCGGGAGTTCATC
                              * **.   .*.*. *. *** *******..**..  *..*..*.****..**.** .**

Drosophila_grimshawi|7650    TTGCACATAAGAAATGTACACAAACTGAATTTGGATGAGGAGAAAATATGCTGTGCTCGC
Drosophila_yakuba|13109      GTTCACGTCAAGGAGCACCTGGAAGCAAATCCAAACACGCAGCCAGAGCTCACTGCTTCC
Drosophila_sechellia|15727   GTGCATGTTAAAGAGCACCTGGAATCAAATCCAAGCTTGCAGCAAGAGCTGAATGCTTCC
Drosophila_melanogaster|4589 GTGCACGTCAAGGAGCACCTGGAAGCAAATCCAAGCATGCAGCAAGAGCTCACTACTTCC
Drosophila_simulans|3285     GTGCACGTCAAAGAGCACCTGGAAGCAAATCCAAGCCTGCAGCAAGAGCTGAATGCTTCC
                              * ** .* *...*  :.*: .**  .***  ...   * **..*.:.   : *.**  *

Drosophila_grimshawi|7650    AGCATCGATATAAAGGAAGAGCCAACGCCAACTTGCGATACAAGCGAAGATAGTGAAATC
Drosophila_yakuba|13109      GGAGTCATTTCGTCCGCCAAATGCAAGGAGAATGTATTGCCAGCAAAGGTGTTCATAGTG
Drosophila_sechellia|15727   GAAGTCATTTCGTCCGCCGAATGCGAGGAGGAGGTATCGCCAGCCAAGGTGTTCATAGTG
Drosophila_melanogaster|4589 GAAGTCATTTCGTCAGCCAAATGCGAGGAGGAGGTCTCGCCAGCCAAGGTGTTCATAGTG
Drosophila_simulans|3285     GAAGTCATTTCGTCCGCCGAATGCGAGGAGGAGGTATCGCCAGCCAAGGTGTTCATAGTG
                             ....**.:*: .:. *...*.  ...* ....   .   .**. ..*.*: :  .:*.* 

Drosophila_grimshawi|7650    GAAGAGGATGGTAAGGATTGTTTAGCTGAGGAAGCGTTTGTGGACCTGCCCACCGCATCG
Drosophila_yakuba|13109      GAGGAGCTGCCGGAAAATTGTCTGGCTGAAGATATGTTCGTTGACCTGCCAGCTTCCTCG
Drosophila_sechellia|15727   GAGAAACCGCCGGACAATTGCCTGGCTGAAGACATGTTCGTTGACGTGCCACCTTCCTCA
Drosophila_melanogaster|4589 GAGGAGCCTCCGGAAAATTGCCTGGCTGAAGACATGTTCGTTGACGTGCCACCTTCATCA
Drosophila_simulans|3285     GAGGAACCGCCGGACAATTGCCTGGCTGAAGACATGTTCGTTGACGTGCCACCTTCCTCA
                             **..*.      .* .****  *.*****.** . *** ** *** ****. *  *.**.

Drosophila_grimshawi|7650    ACCGACGAAGAAGAAGTCGATAAC---GATAGCGACTATGATTACGATGAAGATGAAATG
Drosophila_yakuba|13109      GAGAACGATGAGAGCACCAGCCCG---------------------GAGGAGGACGACCAG
Drosophila_sechellia|15727   GAGAACGAAGAAAGCACCAGCCAGGCGGAGGAAGAGGAGGATGAGGAAGAAGACGACGAT
Drosophila_melanogaster|4589 GAGAACGACGAGAGCACCAGCCCG------GTGGAGGAGGAGGAGGAAGAAGACGACGAG
Drosophila_simulans|3285     GAGAACGAAGAGAGCACCAGCCAGGCGGAGGAAGAGGAGGATGAGGAAGAAGACGACGAT
                             .. .**** **..... *.. ..                      ** **.** **. : 

Drosophila_grimshawi|7650    GCAGAAGAGAGCCAAATTGATGATGCTTCCCAGGCAGACGCTGACGCTGATGGAGAAAAG
Drosophila_yakuba|13109      GTGGACTCCCATTCGATG------ACAGTTGACAGCGAAATCGACACCAAAAACTCCACA
Drosophila_sechellia|15727   GTGGACTGCTCCTCGATG------ACAGTTGACAGCGAATCGGGCACCAGAAATTCCACA
Drosophila_melanogaster|4589 GTGGACTCCTCCTCGATG------ACAGTTGACTGCGAATTGGGCACCAGAAACTCCACA
Drosophila_simulans|3285     GTGGACTCCTCCTCGATG------ACAGTTGACAGCGAATTGGGCACCAGAAATTCCACA
                             * .**.       ..**       .*:    *   .**.   *.*.* ..:..  ..*..

Drosophila_grimshawi|7650    AGCTTTACACCAACAGTCAAATTTAATCCCACATTTTATCGACGCAATCCGCGCATCACA
Drosophila_yakuba|13109      AATTTTGCTCCTTTATCCAAATTCAATCCTACGTTTTACCGACGCAGTCCACGGATCACA
Drosophila_sechellia|15727   AACTTTGCTCCTTTAACCAAATTCAATCCGACGTTTTACCGACGCAGTCCACGGATCACA
Drosophila_melanogaster|4589 CACTTTGCTCCTTTAACCAAATTCAATCCTACGTTTTACCGACGCAGTCCTCGGATCACA
Drosophila_simulans|3285     AACTTTGCTCCTTTAACCAAATTCAATCCGACGTTTTACCGACGCAGTCCACGGATTACA
                             .. ***.*:**:: *  ****** ***** **.***** *******.*** ** ** ***

Drosophila_grimshawi|7650    CAATTCATAGAGCTGTACAAGGGCCAACCTTGCCTCTGGGATCCCAAAAGCTCGGATTTT
Drosophila_yakuba|13109      CAGTTTATCGAACTGTACAAGCAGCAGACATGCCTCTGGGATCCAGCGGATGAGTCGTAC
Drosophila_sechellia|15727   CAGTTCATTGAACTGTACAAGCAGCAGACATGCCTCTGGGATCCAGCGGATGAGTCGTAC
Drosophila_melanogaster|4589 CAGTTCATTGAACTGTATAAGCAGCAGACATGCCTCTGGGATCCAGCGGATGAGTCGTAC
Drosophila_simulans|3285     CAGTTCATTGAACTGTACAAGCAGCAGACATGCCTCTGGGATCCAGCGGATGAGTCGTAC
                             **.** ** **.***** *** . **..*:**************......  .* . *: 

Drosophila_grimshawi|7650    AAGGACAAGGTGAAACGCACTGCTGCCTACGTTACATTAATAGAACAGCTTAAGACTAGT
Drosophila_yakuba|13109      AAGGACAAGGAGAAACGCACAGCTGCATATGAAGAGTTTCTGGTGCAATTAAAGGCCACA
Drosophila_sechellia|15727   AGGGACAAGGAGAAACGCGCAGCTGCCTATGAGGAGTTACTGGATCAATTAAAGGCGACC
Drosophila_melanogaster|4589 AGGGACAAGGAGAAACGCGCAAATGCCTATGAGGAGTTGCTGGAGCAATTAAAGGCGACC
Drosophila_simulans|3285     AGGGACAAGGAGAAACGCGCAGCTGCCTATGAGGAGTTACTGGATCAATTAAAGGCGACC
                             *.********:*******.*:..***.** *: ...** .*.*: **. *:***.* *  

Drosophila_grimshawi|7650    ATTAACGTTCATCTCACCCAGTACAAGCTGAAAAAGTGCATAGCCAGTCTGCATAGTCAG
Drosophila_yakuba|13109      GTCAACCTTCACCTTACGGCCTACAAGCTGAAGAAGTGCATCACCAGCCTACACGAGCAA
Drosophila_sechellia|15727   GTCAACCTTAACCTAACGGCCTATAAGCTGAAGAAGTGCATCACCAGCCTACACGCGCAG
Drosophila_melanogaster|4589 GTCAATCTTCACCTAACGGCCTATAAGCTGAAGAAGTGCATCACCAGCCTACACGCGCAG
Drosophila_simulans|3285     GTCAACCTTAACCTAACGGCCTATAAGCTGAAGAAGTGCATCACCAGCCTACACGCTCAG
                             .* **  **.* ** **  . ** ********.********..**** **.** .  **.

Drosophila_grimshawi|7650    TATGCGACTATAAGCCGTCAGAAGCGTACCAAGAAATTAACAAAATTACCTTTGTATTAC
Drosophila_yakuba|13109      TATGCGGCGATTACGCGGCAGAAGAAAACCCAGAAATTGACTAAGGTTCCACTGTACTAC
Drosophila_sechellia|15727   TATGCGGCGATCTCGCGGCAGAAGAAAACCCAGAAACTGACCAAGGTTCCACTGTACTAC
Drosophila_melanogaster|4589 TATGCGTCGATCTCGCGGCAGAAGAAAACTCAGAAACTAACCAAGGTTCCACTGTACTAC
Drosophila_simulans|3285     TATGCGGCGATCTCGCGGCAGAAGAAAACCCAGAAACTGACCAAGGTTCCACTGTACTAC
                             ****** * ** :  ** ******..:** .***** *.** **. *:**: **** ***

Drosophila_grimshawi|7650    CATGAAATGTACAGTTTCCTTGGGAAACGCTCCGATGTGGATGAAGCGGAGACCGACGAG
Drosophila_yakuba|13109      CATGGAAAGTACAGCTTTCTTGCAGAGCGCGGTAGTTTGGAGGATGCGGACAGCGATGAT
Drosophila_sechellia|15727   CATGGGAAGTACAGCTTTCTGGCAGCGCGCGGTAGTCTGGAGGATGCGGACAGCGATGAT
Drosophila_melanogaster|4589 CATGGAAAGTACAGCTTTCTGGCAGAGCGCGGTAGTCTGGAGGATGCGGACAGCGATGAT
Drosophila_simulans|3285     CATGGGAAGTACAGCTTTCTGGCAGAGCGCGGTAGTCTGGAGGATGCGGACAGCGATGAT
                             ****..*:****** ** ** * ....***   ..* **** **:***** * *** ** 

Drosophila_grimshawi|7650    GAAAGTGGCGACAACAAAATTAAGTTGGTGTTCACTGAAACGAACCATCTGACATCTCAT
Drosophila_yakuba|13109      GACGACGGCGATGGCAAGATAAAGCTGGTGTTTACAGAGGAGAATCAACTAACCACTCAG
Drosophila_sechellia|15727   GACGACGCCGATGGCAAAATAAAGCTGGTGTTCACAGAGGAGAATCAACTGACCACTCAG
Drosophila_melanogaster|4589 GTCGACGGCGATGGCAAAATAAAGCTGGTGTTCACAGAGGAGAATCAACTGACCACACAG
Drosophila_simulans|3285     GACGACGGCGATGGCAAAATAAAGCTGGTGTTCACAGAGGAGAATCAACTGACCACTCAG
                             *:... * *** ..***.**:*** ******* **:**...*** **:**.**.:*:** 

Drosophila_grimshawi|7650    TTTATAGAGCTTTACTCAAAGTTTCCACAATTGTACGATCCTTCGCACAAGGACTTTGCA
Drosophila_yakuba|13109      TTTATCGACTTGTACTCCAAGTTTCCCCAGCTGTACGATCCCGCGCACAAGGACTTTTGC
Drosophila_sechellia|15727   TTCATTGATTTGTACTCCAAGTTTCCCCAACTGTACGATCCCGCGCACGAGCACTTCTGC
Drosophila_melanogaster|4589 TTCATTGATTTGTACTCCAAGTTTCCCCAACTGTACGATCCCGCGCACAAGCACTTCTGC
Drosophila_simulans|3285     TTCATTGATTTGTACTCCACGTTTCCCCAACTGTACGATCCCGCGCACGAGCACTTCTGC
                             ** ** **  * *****.*.******.**. **********  *****.** ****   .

Drosophila_grimshawi|7650    GTTCTGAATGAGCGCAAGAAAGCATACATTGGGATGTGTGATCTGCTCTGCAAAGACTTT
Drosophila_yakuba|13109      AATCTTAGTATACGAAAGTCTTCGCTTTTAGAGATCACTGACCTGCTGACTACGAAGTTT
Drosophila_sechellia|15727   AATCTAAACGTACGAAAGTCGTCGCTTATAGAGATCACAGACCTGCTGACTTCGGAGTTT
Drosophila_melanogaster|4589 AATCTAAACGTACGAAAGTCATCGCTCATAGAGATCACTGACCTGCTGACTTCGGAGTTT
Drosophila_simulans|3285     AATCTAAACGTACGAAAGTCGGCGCTTATAGAGATCACAGACCTGCTGACTTCCGAGTTT
                             .:*** *. .:.**.***:.  *. : :*:*.*** : :** ***** :  :. .* ***

Drosophila_grimshawi|7650    TCGCTGGACATCATTACATATTACGATGTGTATGACAGTGTTCTCTATCTGCGCCAATGG
Drosophila_yakuba|13109      TCGTTCGGCCTGATCACCCACTACGATGTGTACGACAGCATTCAGAGCATGCGTCAATGG
Drosophila_sechellia|15727   TCGTTGGGCCTGGTCACCCACTACGATGTGTACGACAGTATTCAGAGCATGCGCCAATGG
Drosophila_melanogaster|4589 TCGTTGGGCCTGGTCACCCACTACGATGTCTACGACAGTATTCAGAGCATGCGCCAATGG
Drosophila_simulans|3285     TCGTTGGGCCTGGTCACCCACTACGATGTGTACGACAGTATTCAGAGCATGCGCCAATGG
                             *** * *.*.* .* **. * ******** ** ***** .***: :. .**** ******

Drosophila_grimshawi|7650    TATTCCAGAAAAATCAAAGGTCTGACGGAGACCCAAACGATCGGTTTATTGAAGGCAGAG
Drosophila_yakuba|13109      TATTCCCGACGGATCAAAACCCTCACCGACGTCCAATCGGTGGGTCTCTCGCTGGCCGAG
Drosophila_sechellia|15727   TATTCGCGACGGATCAAAACCCTCACCGACGTCCAATCTGTGGGTCTCTCGCTGGCCGAG
Drosophila_melanogaster|4589 TATTCGCGACGGATCAAAACCCTCACAGACGTCCAATGTGTGGGTCTCTCGCTGGCCGAG
Drosophila_simulans|3285     TATTCGCGACGGATCAAAACCCTCACCGACGTCCAATCTGTGGGTCTCTCGCTGGCCGAG
                             ***** .**...******.  ** ** ** . ****:  .* *** *.* *.:***.***

Drosophila_grimshawi|7650    AAACATTACATTGAGGCATGCAAAAGTTTCTTGCGAACGAAAACATTCCGCCAGAAAATA
Drosophila_yakuba|13109      AAGCAGTACATTGAGCGATGCAAGCGTTTTATGTCCACCAAAACATTCCGGCAAAAGCTA
Drosophila_sechellia|15727   AAGCAGTACATCGAGCGCTGCAATAGCTTTATGCCCACTAAATCATTCCGACAGAAGCTT
Drosophila_melanogaster|4589 AAGCAGTACATCGAGCGCTGCAATAGCTTTATGCCCACTAAATCATTCCGACAGAAGCTT
Drosophila_simulans|3285     AAGCAGTACATCGAGCGCTGCAATAGCTTTATGCCCACTAAATCATTCCGGCAGAAGCTT
                             **.** ***** ***  .***** .* ** :**  .** ***:******* **.**..*:

Drosophila_grimshawi|7650    CCCTGTGACGTGTGTCATACTAGCTTCAGCACAGATCACGCGCTCCAGGCCCATCAGTAC
Drosophila_yakuba|13109      AAATGTGAAGTTTGCGAGCAAGCCTTTAGCACAGATCATGCCCTGCAAGCCCATCAGTTC
Drosophila_sechellia|15727   AAATGTGAAGTCTGCGAGCACTCCTTTAGCACAGATCACGCCCTGCAAGCCCATCAGTTC
Drosophila_melanogaster|4589 AAATGTGAAGTCTGCGAGCACTCCTTTAGCACAGATCACGCCCTGCAAGCACATCAGTTC
Drosophila_simulans|3285     AAATGTGAAGTCTGCGAGCACTCCTTTAGCACAGATCACGCCCTGCAAGCCCATCAGTTC
                             ...*****.** **  * ..   *** *********** ** ** **.**.*******:*

Drosophila_grimshawi|7650    AGAGCCCATAAGTTTGGTGACGGCGGCTGGTTCAAGTGTATCCTCTGCGAGAATCATTTC
Drosophila_yakuba|13109      CGTGATCACAAGATGGGTGAGGGAGGCTGGTTTCGTTGCACGCTTTGCGAGCTGAACTTC
Drosophila_sechellia|15727   CGGGATCACAAGATGGGCGAGGGAGGCTGGTTTCGCTGCACGCTTTGCGAGCTAAACTTC
Drosophila_melanogaster|4589 CGGGATCATAAGATGGGCGATGGAGGCTGGTTTCGCTGCACGCTTTGCGAGCTGAACTTC
Drosophila_simulans|3285     CGGGATCACAAGATGGGCGAGGGAGGCTGGTTTCGCTGCACGCTTTGCGAGCTGAACTTC
                             .* *. ** ***:* ** ** **.******** .. ** *  ** ******.: .* ***

Drosophila_grimshawi|7650    GAGCGGCGCTGCCATTTGCAGCAGCACAATCAGCGTGTCCACATGGGCAAGACTTTCAAC
Drosophila_yakuba|13109      GACCGAAGGTGCCACTTGCAGCAGCACATCCAGCGTGTGCACATGGACAAGAACTTTGTC
Drosophila_sechellia|15727   GACCGAAAGTGCCACCTGCAGCAGCACAGCCAGCGTGTGCACATGGACAAGAGCTTTGTC
Drosophila_melanogaster|4589 GACCGAAAGTGTCACCTGCAGCAGCACAGCCAGCGTGTGCACATGGACAAGAGCTTTGTC
Drosophila_simulans|3285     GACCGAAAGTGCCACCTGCAGCAGCACAGCCAGCGTGTGCACATGGACAAGAGCTTTGTC
                             ** **... ** **  ************  ******** *******.*****  ** .:*

Drosophila_grimshawi|7650    TGCGGCCTGTGCAAGCGCAGCTTTGCCTTTTCTAGCCAATTGAGCAGTCATATGCGCACC
Drosophila_yakuba|13109      TGCGACATCTGCAGCAGAAGTTTTGCCTTTGGCAATCAACTGGCTATCCACAAACGCACC
Drosophila_sechellia|15727   TGCGACATCTGCAGCAGGAGCTTTGCCTTTGGCAATCAACTGGCTATCCACAAACGCACC
Drosophila_melanogaster|4589 TGCGAGATCTGCAGCAGGAGCTTTGCCTTTGGAAATCAACTGGCTATCCACAAACGCACC
Drosophila_simulans|3285     TGCGACATCTGCAGCAGGAGCTTTGCCTTTGGCAATCAACTGGCTATCCACAAACGCACC
                             ****. .* ****. .* ** *********   *. *** **.  *  ** *:.******

Drosophila_grimshawi|7650    CACGACGAGAAGCATATAGCTAAACCATTTGTCTGTGAGTTCTGTGGCAAATCGTTCAAG
Drosophila_yakuba|13109      CATGACGAGAAGCACGTCGCCAAGCCCTTTGTTTGTGAGTTCTGCGGCAAGTGCTTTAAG
Drosophila_sechellia|15727   CATGACGCGAAGCACATCGCCAAGCCATTTGTCTGCGAGTTCTGCGGCAAATGTTTTAAG
Drosophila_melanogaster|4589 CATGACGAGAAGCACGTCGCCAAGCCATTTGTCTGCGAGTTCTGCGGCAAGTGTTTTAAG
Drosophila_simulans|3285     CATGACGAGAAGCACATCGCCAAGCCATTTGTCTGCGAGTTCTGCGGCAAATGTTTTAAG
                             ** ****.****** .*.** **.**.***** ** ******** *****.*  ** ***

Drosophila_grimshawi|7650    CAGAAAATTCAAATGAGCAATCATGTGACCGCTGTGCATACCAAAATTCGGGCATTTAAG
Drosophila_yakuba|13109      CAAAAAATCCAAATGACCACCCACGTAACTGCGGTTCACACCAAAGTCCGAGCCTTCAAA
Drosophila_sechellia|15727   CAAAAAATCCAAATGACCACCCACGTAACTGCGGTTCACACCAAGATCCGAGCCTTCAAG
Drosophila_melanogaster|4589 CAAAAAATCCAAATGACAACGCACGTAACTGCGGTTCACACCAAGATCCGAGCCTTCAAG
Drosophila_simulans|3285     CAAAAAATCCAAATGACCACCCACGTAACTGCGGTTCACACCAAGATCCGAGCCTTCAAG
                             **.***** ******* .*. ** **.** ** ** ** *****..* **.**.** **.

Drosophila_grimshawi|7650    TGCACCATGTGCCCCAAGGATTTTCTAACTAAACGCGATCTCAAGGATCACATCAAGGCG
Drosophila_yakuba|13109      TGTGACATGTGCCCCAAGGACTTCCTCACTAAGCGCGACCTTAAGGACCACGTAAAAGCG
Drosophila_sechellia|15727   TGCGACATGTGCCCCAAGGACTTCCTGACCAAGCGCGACCTTAAGGACCACGTAAAGGCC
Drosophila_melanogaster|4589 TGCGACATGTGCCCCAAGGACTTCCTGACCAAGCGCGACCTCAAGGACCACGTAAAGGCG
Drosophila_simulans|3285     TGCGACATGTGCCCCAAGGACTTCCTGACCAAGCGCGACCTTAAGGACCACATAAAGGCG
                             ** ..*************** ** ** ** **.***** ** ***** ***.*.**.** 

Drosophila_grimshawi|7650    CACCTCAACATACGCGACAAGGTCTGCGAAATCTGCCAGAAGGCATTCACCAATGCGAAT
Drosophila_yakuba|13109      CACCTGAACATCCGCGACAAGGTCTGCGAGGTCTGTCAGAAGGCCTTCACCAATGCCAAC
Drosophila_sechellia|15727   CACCTGAACATCCGCGACAAGGTCTGCGAGGTCTGTCAGAAGTCCTTCACCAATGCCAAC
Drosophila_melanogaster|4589 CACCTGAACATCCGCGACAAGGTCTGCGAGGTCTGTCAGAAGGCCTTCACCAATGCCAAC
Drosophila_simulans|3285     CACCTGAACATCCGCGACAAGGTCTGCGAGGTCTGTCAGAAGGCCTTCACCAATGCCAAC
                             ***** *****.*****************..**** ****** *.*********** ** 

Drosophila_grimshawi|7650    GCCCTGGTCAAGCATCGTCACATTCACAAAGAGAAGACTCTGCAGTGCAGCTTATGTAAT
Drosophila_yakuba|13109      GCCTTAGTCAAGCACCGCCACATCCACAAGGAGAAGACTCTGCAATGCTCGCTGTGCACG
Drosophila_sechellia|15727   GCCTTAGTCAAGCATCGCCACATCATCACAGAGAAGACCCTGCAATGCTCACTCTGCACG
Drosophila_melanogaster|4589 GCCTTAGTCAAGCATCGCCACATCCACAAGGAGAAGACCCTGCAATGTTCGCTCTGCACG
Drosophila_simulans|3285     GCCTTGGTCAAGCATCGCCACATTCACAAGGAGAAAACCCTGCAATGCTCGCTCTGCACG
                             *** *.******** ** ***** .:**..*****.** *****.** :   * ** *. 

Drosophila_grimshawi|7650    ACCAAGTTCTCTGAGCGCGTTAGCTTGGGTGTCCATATGAAACGCACGCATAAAATTATT
Drosophila_yakuba|13109      ACGCGCTTCTCGGAGCGAGTTAGTCTGGGCGTACACATGCGGCGCACGCACAAGATTATC
Drosophila_sechellia|15727   ACAGCTTCTCAGAGCGAGTTAGTCTGGGCGTCACATGCGACGCACCCA---CAGATCCTC
Drosophila_melanogaster|4589 ACGCGCTTCTCGGAGCGAGTTAGTCTTGGCGTCCACATGCGACGCACCCACAAGATCCTC
Drosophila_simulans|3285     ACGCGCTTCTCGGAGCGAGTTAGTCTGGGCGTCCACATGCGACGCACCCACAAGATCCTC
                             **    *   . ..  .  *:.     *    .** . *. .*.*.*    .*.** .* 

Drosophila_grimshawi|7650    CGTAATAGTGCAAAAGTTGCTGAGGTAACGGAATCCGCATTATATTCTCAAACATTTCCA
Drosophila_yakuba|13109      AAGAGCTCCCTGTCGACAAGCGAA------------GCGTTGTTTACACACACATTCCCC
Drosophila_sechellia|15727   AGAAGCTCTCTGTCGTCAAGCGAC------------GCACTCTTTACAAACACATTCCCT
Drosophila_melanogaster|4589 AAGAGCTCTCTGTCGTCAAGCGAC------------GCACTCTTTACAAAGACATTCCCT
Drosophila_simulans|3285     AAGAGCTCTCTGTCGTCAAGCGAC------------GCACTCTTTACAAACACATTCCCT
                             .. *. :    .:..  :.  **             **. * *:*:*:.* ***** ** 

Drosophila_grimshawi|7650    CAAGTT---------------------GAAGACATTTCAAATAAATAA
Drosophila_yakuba|13109      CAGCCT---------------------------------------TAA
Drosophila_sechellia|15727   CAGCCCTTAAGACATTTCCAAACAATAACAAGTATTTACATTTGTTAA
Drosophila_melanogaster|4589 CAGCCT---------------------------------------TGA
Drosophila_simulans|3285     CAGCCT---------------------------------------TAA
                             **.                                          *.*

multiple sequence alignment in CLUSTALW format


Drosophila_grimshawi|9626    MVICGTVRVRNNYEEFLLSCSHCKSGCDVEVSLERWQEFVLHIRNVHKLNLDEEKICCAR
Drosophila_yakuba|13685      MVVCGNILARNNFGHFVLACAQ-KNDCYVEMEFERWREFIVHVKEHLEANPNTQPELTAS
Drosophila_sechellia|10487   MVVCGNILARNNFEHFVLACAH-QNDCYVEMEFKRWREFIVHVKEHLESNPSLQQELNAS
Drosophila_melanogaster|4213 MVVCGNILARNNFEHFVLACAH-QNDCYVEMEFKRWREFIVHVKEHLEANPSMQQELTTS
Drosophila_simulans|698      MVVCGNILARNNFEHFVLACAH-QNDCYVEMEFKRWREFIVHVKEHLEANPSLQQELNAS
                             **:**.: .***: .*:*:*:: :..* **:.::**:**::*:::  : * . :    : 

Drosophila_grimshawi|9626    SIDIKEEPTPTCDTSEDSEIEEDGKDCLAEEAFVDLPTASTDEEEVDN-DSDYDYDEDEM
Drosophila_yakuba|13685      GVISSAKCKENVLPAKVFIVEELPENCLAEDMFVDLPASSENDESTSP-------EEDDQ
Drosophila_sechellia|10487   EVISSAECEEEVSPAKVFIVEKPPDNCLAEDMFVDVPPSSENEESTSQAEEEEDEEEDDD
Drosophila_melanogaster|4213 EVISSAKCEEEVSPAKVFIVEEPPENCLAEDMFVDVPPSSENDESTSP--VEEEEEEDDE
Drosophila_simulans|698      EVISSAECEEEVSPAKVFIVEEPPDNCLAEDMFVDVPPSSENEESTSQAEEEEDEEEDDD
                              :  . :      .::   :*:  .:****: ***:*.:* ::*...        :**: 

Drosophila_grimshawi|9626    AEESQIDDASQADADADGEKSFTPTVKFNPTFYRRNPRITQFIELYKGQPCLWDPKSSDF
Drosophila_yakuba|13685      VDSHSM--TVDSEIDTKNSTNFAPLSKFNPTFYRRSPRITQFIELYKQQTCLWDPADESY
Drosophila_sechellia|10487   VDCSSM--TVDSESGTRNSTNFAPLTKFNPTFYRRSPRITQFIELYKQQTCLWDPADESY
Drosophila_melanogaster|4213 VDSSSM--TVDCELGTRNSTHFAPLTKFNPTFYRRSPRITQFIELYKQQTCLWDPADESY
Drosophila_simulans|698      VDSSSM--TVDSELGTRNSTNFAPLTKFNPTFYRRSPRITQFIELYKQQTCLWDPADESY
                             .:  .:  : :.: .: ... *:*  *********.*********** *.***** ...:

Drosophila_grimshawi|9626    KDKVKRTAAYVTLIEQLKTSINVHLTQYKLKKCIASLHSQYATISRQKRTKKLTKLPLYY
Drosophila_yakuba|13685      KDKEKRTAAYEEFLVQLKATVNLHLTAYKLKKCITSLHEQYAAITRQKKTQKLTKVPLYY
Drosophila_sechellia|10487   RDKEKRAAAYEELLDQLKATVNLNLTAYKLKKCITSLHAQYAAISRQKKTQKLTKVPLYY
Drosophila_melanogaster|4213 RDKEKRANAYEELLEQLKATVNLHLTAYKLKKCITSLHAQYASISRQKKTQKLTKVPLYY
Drosophila_simulans|698      RDKEKRAAAYEELLDQLKATVNLNLTAYKLKKCITSLHAQYAAISRQKKTQKLTKVPLYY
                             :** **: **  :: ***:::*::** *******:*** ***:*:***:*:****:****

Drosophila_grimshawi|9626    HEMYSFLGKRSDVDEAETDEESGDNKIKLVFTETNHLTSHFIELYSKFPQLYDPSHKDFA
Drosophila_yakuba|13685      HGKYSFLAERGSLEDADSDDDDGDGKIKLVFTEENQLTTQFIDLYSKFPQLYDPAHKDFC
Drosophila_sechellia|10487   HGKYSFLAARGSLEDADSDDDDADGKIKLVFTEENQLTTQFIDLYSKFPQLYDPAHEHFC
Drosophila_melanogaster|4213 HGKYSFLAERGSLEDADSDDVDGDGKIKLVFTEENQLTTQFIDLYSKFPQLYDPAHKHFC
Drosophila_simulans|698      HGKYSFLAERGSLEDADSDDDDGDGKIKLVFTEENQLTTQFIDLYSTFPQLYDPAHEHFC
                             *  ****. *..:::*::*: ..*.******** *:**::**:***.*******:*:.*.

Drosophila_grimshawi|9626    VLNERKKAYIGMCDLLCKDFSLDIITYYDVYDSVLYLRQWYSRKIKGLTETQTIGLLKAE
Drosophila_yakuba|13685      NLSIRKSSLLEITDLLTTKFSFGLITHYDVYDSIQSMRQWYSRRIKTLTDVQSVGLSLAE
Drosophila_sechellia|10487   NLNVRKSSLIEITDLLTSEFSLGLVTHYDVYDSIQSMRQWYSRRIKTLTDVQSVGLSLAE
Drosophila_melanogaster|4213 NLNVRKSSLIEITDLLTSEFSLGLVTHYDVYDSIQSMRQWYSRRIKTLTDVQCVGLSLAE
Drosophila_simulans|698      NLNVRKSALIEITDLLTSEFSLGLVTHYDVYDSIQSMRQWYSRRIKTLTDVQSVGLSLAE
                              *. **.: : : *** ..**:.::*:******:  :******:** **:.* :**  **

Drosophila_grimshawi|9626    KHYIEACKSFLRTKTFRQKIPCDVCHTSFSTDHALQAHQYRAHKFGDGGWFKCILCENHF
Drosophila_yakuba|13685      KQYIERCKRFMSTKTFRQKLKCEVCEQAFSTDHALQAHQFRDHKMGEGGWFRCTLCELNF
Drosophila_sechellia|10487   KQYIERCNSFMPTKSFRQKLKCEVCEHSFSTDHALQAHQFRDHKMGEGGWFRCTLCELNF
Drosophila_melanogaster|4213 KQYIERCNSFMPTKSFRQKLKCEVCEHSFSTDHALQAHQFRDHKMGDGGWFRCTLCELNF
Drosophila_simulans|698      KQYIERCNSFMPTKSFRQKLKCEVCEHSFSTDHALQAHQFRDHKMGEGGWFRCTLCELNF
                             *:*** *: *: **:****: *:**. :***********:* **:*:****:* *** :*

Drosophila_grimshawi|9626    ERRCHLQQHNQRVHMGKTFNCGLCKRSFAFSSQLSSHMRTHDEKHIAKPFVCEFCGKSFK
Drosophila_yakuba|13685      DRRCHLQQHIQRVHMDKNFVCDICSRSFAFGNQLAIHKRTHDEKHVAKPFVCEFCGKCFK
Drosophila_sechellia|10487   DRKCHLQQHSQRVHMDKSFVCDICSRSFAFGNQLAIHKRTHDAKHIAKPFVCEFCGKCFK
Drosophila_melanogaster|4213 DRKCHLQQHSQRVHMDKSFVCEICSRSFAFGNQLAIHKRTHDEKHVAKPFVCEFCGKCFK
Drosophila_simulans|698      DRKCHLQQHSQRVHMDKSFVCDICSRSFAFGNQLAIHKRTHDEKHIAKPFVCEFCGKCFK
                             :*:****** *****.*.* * :*.*****..**: * **** **:***********.**

Drosophila_grimshawi|9626    QKIQMSNHVTAVHTKIRAFKCTMCPKDFLTKRDLKDHIKAHLNIRDKVCEICQKAFTNAN
Drosophila_yakuba|13685      QKIQMTTHVTAVHTKVRAFKCDMCPKDFLTKRDLKDHVKAHLNIRDKVCEVCQKAFTNAN
Drosophila_sechellia|10487   QKIQMTTHVTAVHTKIRAFKCDMCPKDFLTKRDLKDHVKAHLNIRDKVCEVCQKSFTNAN
Drosophila_melanogaster|4213 QKIQMTTHVTAVHTKIRAFKCDMCPKDFLTKRDLKDHVKAHLNIRDKVCEVCQKAFTNAN
Drosophila_simulans|698      QKIQMTTHVTAVHTKIRAFKCDMCPKDFLTKRDLKDHIKAHLNIRDKVCEVCQKAFTNAN
                             *****:.********:***** ***************:************:***:*****

Drosophila_grimshawi|9626    ALVKHRHIHKEKTLQCSLCNTKFSERVSLGVHMKRTHKIIRNSAKVAEVTESALYSQTFP
Drosophila_yakuba|13685      ALVKHRHIHKEKTLQCSLCTTRFSERVSLGVHMRRTHKIIKSSLSTSE----ALFTHTFP
Drosophila_sechellia|10487   ALVKHRHIITEKTLQCSLCTTASQSELVWASHATHP-QILRSSLSSSD----ALFTNTFP
Drosophila_melanogaster|4213 ALVKHRHIHKEKTLQCSLCTTRFSERVSLGVHMRRTHKILKSSLSSSD----ALFTKTFP
Drosophila_simulans|698      ALVKHRHIHKEKTLQCSLCTTRFSERVSLGVHMRRTHKILKSSLSSSD----ALFTNTFP
                             ******** .*********.*  ...:  . *  :. :*::.* . ::    **:::***

Drosophila_grimshawi|9626    QV-------EDISNK
Drosophila_yakuba|13685      QP-------------
Drosophila_sechellia|10487   QPLRHFQTITSIYIC
Drosophila_melanogaster|4213 QP-------------
Drosophila_simulans|698      QP-------------
                             *