Orthologs Set ID: EOG4006BM


Orthology Database
OrthoDB4
Gene Symbol(s)
ITPRIPL2

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Callithrix jacchus 54056
Canis familiaris 24098
Cavia porcellus 15737
Choloepus hoffmanni 5843 748
Danio rerio 715
Felis catus 43153 864, 891, 1016, 1203
Gorilla gorilla 4978 2
Homo sapiens 31007
Monodelphis domestica 25682
Myotis lucifugus 15553
Ochotona princeps 1056 582, 597, 606, 650, 1074, 1122, 1133, 1174
Ornithorhynchus anatinus 27395 222, 616, 1042, 1570, 1593
Pan troglodytes 14038
Pongo abelii 10380
Procavia capensis 5693
Rattus norvegicus 3004
Rhesus macaque 24571
Tarsius syrichta 9904 1365

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 54056 ENSCJAT00000042760 100411458 ENSCJAG00000021775 ITPRIPL2 calJac3
Canis familiaris 24098 ENSCAFT00000036391 100683434 ENSCAFG00000023604 ITPRIPL2 canFam2
Cavia porcellus 15737 ENSCPOT00000027961 100732710 ENSCPOG00000026266 ITPRIPL2 cavPor3
Choloepus hoffmanni 5843 ENSCHOT00000005841 ENSCHOG00000005828 ITPRIPL2 choHof1
Danio rerio 715 ENSDART00000076925 555628 ENSDARG00000054688 itpripl2 danRer6
Felis catus 43153 ENSFCAT00000013854 ENSFCAG00000013851 ITPRIPL2 felCat3
Gorilla gorilla 4978 ENSGGOT00000006713 101140875 ENSGGOG00000006687 ITPRIPL2 gorGor3
Homo sapiens 31007 ENST00000381440 162073 ENSG00000205730 ITPRIPL2 hg19,GRCh37
Monodelphis domestica 25682 ENSMODT00000038514 100018710 ENSMODG00000025107 ITPRIPL2 monDom5
Myotis lucifugus 15553 ENSMLUT00000015338 102419491 ENSMLUG00000015343 ITPRIPL2 myoLuc1
Ochotona princeps 1056 ENSOPRT00000001698 ENSOPRG00000001698 ITPRIPL2 OchPri2.0
Ornithorhynchus anatinus 27395 ENSOANT00000005115 ENSOANG00000003222 ITPRIPL2 ornAna1
Pan troglodytes 14038 ENSPTRT00000060369 ENSPTRG00000031279 ITPRIPL2 panTro2
Pongo abelii 10380 ENSPPYT00000008410 100437957 ENSPPYG00000007144 ITPRIPL2 ponAbe2
Procavia capensis 5693 ENSPCAT00000005320 ENSPCAG00000005397 ITPRIPL2 proCap1
Rattus norvegicus 3004 ENSRNOT00000055106 499253 ENSRNOG00000036762 Itpripl2 rn4
Rhesus macaque 24571 ENSMMUT00000039511 694060 ENSMMUG00000029211 ITPRIPL2 rheMac2
Tarsius syrichta 9904 ENSTSYT00000009568 103249302 ENSTSYG00000009583 ITPRIPL2 tarSyr1

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Callithrix jacchus 45007 ENSCJAP00000040480 100411458 ENSCJAG00000021775 ITPRIPL2 calJac3
Canis familiaris 15250 ENSCAFP00000031761 100683434 ENSCAFG00000023604 ITPRIPL2 canFam2
Cavia porcellus 12368 ENSCPOP00000016144 100732710 ENSCPOG00000026266 ITPRIPL2 cavPor3
Choloepus hoffmanni 5159 ENSCHOP00000005155 ENSCHOG00000005828 ITPRIPL2 choHof1
Danio rerio 27774 ENSDARP00000071393 555628 ENSDARG00000054688 itpripl2 danRer6
Felis catus 9093 ENSFCAP00000012843 ENSFCAG00000013851 ITPRIPL2 felCat3
Gorilla gorilla 4724 ENSGGOP00000006541 101140875 ENSGGOG00000006687 ITPRIPL2 gorGor3
Homo sapiens 16937 ENSP00000370849 162073 ENSG00000205730 ITPRIPL2 hg19,GRCh37
Monodelphis domestica 5706 ENSMODP00000036918 100018710 ENSMODG00000025107 ITPRIPL2 monDom5
Myotis lucifugus 13980 ENSMLUP00000013975 102419491 ENSMLUG00000015343 ITPRIPL2 myoLuc1
Ochotona princeps 916 ENSOPRP00000001568 ENSOPRG00000001698 ITPRIPL2 OchPri2.0
Ornithorhynchus anatinus 23532 ENSOANP00000005114 ENSOANG00000003222 ITPRIPL2 ornAna1
Pan troglodytes 33285 ENSPTRP00000053734 ENSPTRG00000031279 ITPRIPL2 panTro2
Pongo abelii 7671 ENSPPYP00000008075 100437957 ENSPPYG00000007144 ITPRIPL2 ponAbe2
Procavia capensis 5342 ENSPCAP00000004980 ENSPCAG00000005397 ITPRIPL2 proCap1
Rattus norvegicus 30106 ENSRNOP00000062067 499253 ENSRNOG00000036762 Itpripl2 rn4
Rhesus macaque 31778 ENSMMUP00000032589 694060 ENSMMUG00000029211 ITPRIPL2 rheMac2
Tarsius syrichta 9077 ENSTSYP00000008773 103249302 ENSTSYG00000009583 ITPRIPL2 tarSyr1

multiple sequence alignment in CLUSTALW format


Danio_rerio|715                ATGAGTGTT---TACACCCTCAACCTCAGGTTTTTCTGGCCTTTGGTCACTTGCATCCTC
Ochotona_princeps|1056         ATGTCAGTTCACTACACCCTGAATCTGCGCGTCTTCTGGCCTCTGGTGACCGGCCTGTGC
Ornithorhynchus_anatinus|27395 ------------------------------------------------------------
Monodelphis_domestica|25682    ATGTCGGTGCACTACACCCTCAACCTGCGCGTCTTTTGGCCACTGGTGACCGGCTTCTGC
Felis_catus|43153              ATGTCAGTGCACTACACCCTCAATTTGCACGTCTTATGGCCCCTGGTGACCGGCCTGTGC
Cavia_porcellus|15737          ATGTCGGTGCACTACACCCTCAATCTGCGCGTCTTCTGGCCCTTGGTGACCGGCCTGTGC
Rattus_norvegicus|3004         ATGTCCGTGCGGTACACGCTCAACCTGAGGGTCTTCTGGCCCTTGGTGACCGGGCTGTGC
Canis_familiaris|24098         ATGTCGGTGCACTACACCCTCAACCTGCGCGTCTTCTGGCCCCTGGTGACCGGCCTCTGC
Myotis_lucifugus|15553         ATGTCGGTGCATTACACCCTCAACCTGCGAGTCTTCTGGCCCCTGGTGACTGGCCTGTGC
Tarsius_syrichta|9904          ------------------------------------------------------------
Callithrix_jacchus|54056       ATGTCGGTGCACTACACCCTCAATCTACGCGTCTTCTGGCCCCTGGTGACCGGCCTCTGC
Rhesus_macaque|24571           ATGTCGGTGCACTACACCCTCAATCTACGCGTCTTCTGGCCCCTGGTGACCGGTCTGTGC
Gorilla_gorilla|4978           ATGTCGGTGCACTACACCCTCAATCTACGCGTCTTCTGGCCCCTGGTGACCGGCCTGTGC
Homo_sapiens|31007             ATGTCGGTGCACTACACCCTCAATCTACGCGTCTTCTGGCCCCTGGTGACCGGCCTGTGC
Pan_troglodytes|14038          ATGTCGGTGCACTACACCCTCAATCTACGCGTCTTCTGGCCCCTGGTGACCGGCCTGTGC
Pongo_abelii|10380             ATGTCGGTGCACTACACCCTCAATATACGCATCTTATGGCCTCTGGTGACCGGCCTGTGC
Choloepus_hoffmanni|5843       ------------------------------------------------------------
Procavia_capensis|5693         ------------------------------------------------------------
                                                                                           

Danio_rerio|715                ACTGCTCTGCTGCTACTGCATCAGTACATCTTTAGAGGATTGGAGGACCAAGGAAGCGAC
Ochotona_princeps|1056         ACGGCTCTCGTGTGCCTCTAC---CATGTCCTTCGTGGTAGCGGGGAAGCCCCGGCCGAG
Ornithorhynchus_anatinus|27395 ------------------------------------------------------------
Monodelphis_domestica|25682    ACCGCCCTAGTATGCCTCTAC---CACGTCTTGAGCGGAAGGGGAGGCCCC---GCCGCG
Felis_catus|43153              ACTGCCCTTGTGTGCCTCTAC---CATGTCCTCCGGGGAAGCGGGGACGACCGGGCTGAG
Cavia_porcellus|15737          ACCGCCCTCGTGTGTCTCTAC---CATGTCCTGCGGGGAGACGGGGCCACCAAGACCGAG
Rattus_norvegicus|3004         ACGGCGCTAGTGTGCCTCTAC---CATGCCCTACGCAGCAGCGAGGGTGCCCGGGCCGAG
Canis_familiaris|24098         ACGGCCCTGGTGTGCCTGTAC---CATGCCCTCCGGGGAAgcgggggcgcccgcgcgcag
Myotis_lucifugus|15553         ACTGCTTTCGTGTGCCTATAC---CATGTCCTGCGAGGGAGTGGGGGCGCCCGGGCCGAG
Tarsius_syrichta|9904          ------------------------------------------------------------
Callithrix_jacchus|54056       ACCGCTCTGGTGTGCCTCTAC---CATGTCCTGTGGGGAAGCTGGGGCGCCCGGGCCGAG
Rhesus_macaque|24571           ACCGCCCTGGTGTGCCTCTAC---CATGTCCTGCGGGGAAGCGGGGGCGCCCGGGCTGAG
Gorilla_gorilla|4978           ACCGCCCTGGTGTGCCTCTAC---CATGTCCTGCGGGGAAGCGGGGGCGCCCGGGCCGAG
Homo_sapiens|31007             ACCGCCCTGGTGTGCCTCTAC---CATGTCCTGCGGGGAAGCGGGGGCGCCCGGGCCGAG
Pan_troglodytes|14038          ACCGCCCTGGTGTGCCTCTAC---CATGTCCTGCGGGGAAGCGGGGGCGCCCGGGCCGAG
Pongo_abelii|10380             ACCGCCCTGGTGTGCCTCTAC---CATGTCCTGCGGGGAAGCGGGGGCGCCCGGGCCGAG
Choloepus_hoffmanni|5843       ------------------------------------------------------------
Procavia_capensis|5693         ------------------------------------------------------------
                                                                                           

Danio_rerio|715                TGTGCTGACCAGGGACCAGGAGTTGTTACACTTTTCAAGTACATTCTGGCATTTATTCTG
Ochotona_princeps|1056         CCCCCAGACGGTGCAGCCAGCGGTTTCCCGCTGCTCAAGGCCATCGTGCTGCTGCTGCTG
Ornithorhynchus_anatinus|27395 ------------------------TTCCCGGTGTTCAAGGCCGCGCTGCTGCTGCTGCTC
Monodelphis_domestica|25682    TCCCAGGACACCGAGGACACCGGCTTCCCGCTGCTCAAAGCCATCTTCTTGCTGCTCTTG
Felis_catus|43153              CCCCCCGACGGTGCGGACGGCGGCTTCCCGCTGCTCAAGGTGGCCGTCCTGCTCCTCCTG
Cavia_porcellus|15737          TCCCCCGACGGTGCGGACGGTGGCTTCTCGCTGCTCAAAGTGGTCATCCTGCTCCTGCTC
Rattus_norvegicus|3004         CCCCCCGACGGCGCAGACAGCGGCTTCCCGCTGCTCAAGGTGGCTATCCTTCTTCTCCTC
Canis_familiaris|24098         ccccccgacggcgcggacggcggcTTCCCGCTGCTCAAGGTGGCCGTGCTGCTCCTCCTC
Myotis_lucifugus|15553         CCCCCCGACGGCGCGGACGGCGGCTTCCCGCTGCTCAAGATATCTGTCCTGCTGCTCCTC
Tarsius_syrichta|9904          ------------------------------------------------------------
Callithrix_jacchus|54056       CCCCCCGACGGCGTGGACGGCGGCTTCCCACTGCTCAAGGTGGCGGTTCTGCTCCTCCTC
Rhesus_macaque|24571           CCACCCGACGGCGTGGACGGCGGCTTCCCGCTGCTCAAGGTGGCCGTCCTGCTCCTCCTC
Gorilla_gorilla|4978           CCCGCCGACGGCGTGGATGGCGGCTTCCCGTTGCTCAAGGTGGCCGTCCTGCTCCTCCTC
Homo_sapiens|31007             CCCGCCGACGGCGTGGATGGCGGCTTCCCGTTGCTTAAGGTGGCCGTCCTGCTCCTCCTC
Pan_troglodytes|14038          CCCGCCGACGGCGTGGATGGCGGCTTCCCGTTGCTCAAGGTGGCCGTCCTGCTCCTCCTC
Pongo_abelii|10380             CCCGCCGACGGCGTGGACGGCGGCTTCCCGTTGCTCAAGGTGGCCGTCCTGCTCCTCCTC
Choloepus_hoffmanni|5843       ------------------------------------------------------------
Procavia_capensis|5693         ------------------------------------------------------------
                                                                                           

Danio_rerio|715                TGTTACTTCTTTATAAGATACTGCTCAGGT---------------CAGCCTGGCTCTGTA
Ochotona_princeps|1056         GGCTACGTCCTCCTGCGCTGTCGCCACGCTGTCCGGCAGCGCTTCCTGCCCGGGGCCTCG
Ornithorhynchus_anatinus|27395 GGCTACCTGGTCCTGCGCTGCCGCCACGCCGCCCGCCAGCGC------------------
Monodelphis_domestica|25682    GGCTACCTCCTCTTGCGCTTTCGCCACGCTGCCCGGCAGCGCTTCCTGCGCCGCGCTCCC
Felis_catus|43153              GGCTACATCCTCCTGCGCTGTCGCCACGCCGTCCGGCAGCGCTTCCTGCCAGGGTCTCCC
Cavia_porcellus|15737          GGCTATGTCCTCCTGCGCTGTCGCCACGCTGTCCGGCAGCGCTTTCTGCCTGTCTCTTCC
Rattus_norvegicus|3004         TGCTACATCCTCCTACGATGTCGCCACACCATCCGCCAGCGCCTCTTGCCAGGCTCTTCC
Canis_familiaris|24098         GGCTACGTCCTCCTGCGCTGTCGCCACGCCGTCCGGCAGCGCTTCCTGCCAGGGGCTCCT
Myotis_lucifugus|15553         GGCTACATCCTCCTCCGCTGTCGCCACGCTGTCCGGCAGCGTTTCCTGCCCGGGTCTCCC
Tarsius_syrichta|9904          ---------------------------------CGGCAGCGCTTCCTGCCCGGAGCTTCT
Callithrix_jacchus|54056       AGCTATGTCCTCCTGCGCTGTCGCCACGCTGTCCGGCAGCGCTTCTTACCGGGATCTCCC
Rhesus_macaque|24571           AGCTACGTCCTCCTGCGCTGTCGCCACGCTGTCCGGCAGCGCTTCCTGCCCGGGTCTCCC
Gorilla_gorilla|4978           AGCTATGTCCTCCTGCGCTGTCGCCACGCTGTCCGGCAGCGCTTCCTGCCCGGGTCTCCC
Homo_sapiens|31007             AGCTATGTCCTCCTGCGCTGTCGCCACGCTGTCCGGCAGCGCTTCCTGCCCGGGTCTCCC
Pan_troglodytes|14038          AGCTATGTCCTCCTGCGCTGTCGCCACGCTGTCCGGCAGCGCTTCCTGCCCGGGTCTCCC
Pongo_abelii|10380             AGCTATGTCCTCCTGCGCTGTCGCCACGCTGTCCGGCAGCGCTTCCTGCCCGGGTCTCCC
Choloepus_hoffmanni|5843       ------------------------------------------------------------
Procavia_capensis|5693         ------------------------------GTCCGTCAGCGCTTCCTACCCCGGGCCCCC
                                                                                           

Danio_rerio|715                AGAAGGGGTTTCCACAAAGTCCTAGAGGTGCATGGAAAGTCGGGAGTCTCCAAGCGAGAG
Ochotona_princeps|1056         CGCGTTGGGGGCCACTCCACCTTCTCCCCGAGGCCCTTCGAAGAGCCGGGCCTCGGGGTC
Ornithorhynchus_anatinus|27395 ---------------------------------------------------cTGCGGGTC
Monodelphis_domestica|25682    CACCAGGGG---CTCGCAACATCTTCTAAGAGACTCCTCCGCGAGCCCGGCCTCGATGTT
Felis_catus|43153              CGCCTGGGGAGACACTCCACCTTCTCTCCTAGACACTTCCGAGAGCCGAGCCAAGGCATC
Cavia_porcellus|15737          CGCGTGGTGGGCCACTCCGCCTTCTCTCCTAGAAACGTCTCAGAGCCGGGACTTAGCATC
Rattus_norvegicus|3004         CGCCCATGTGGCCATGCCAACTTCTCAGCCAGATCCTTGCAAGAGCCAGGCCTGAGCATC
Canis_familiaris|24098         CGCCTGGGGAGCCACTCCACCTTCTCGCCGAGGCACTTCCGAGAGCCGAGCCTGGGCATC
Myotis_lucifugus|15553         CGCCTGGGGGGTCACTCCACCTTCTCTCCAAGACACTTCCAAGAGCCCAGCCTCGACATC
Tarsius_syrichta|9904          CGCCTAGGGGGTCACTCCGCCTTCTCCCGGAGACACTTACCAGAGCCGGGCCTCAGCATC
Callithrix_jacchus|54056       CGTCTGGGGGGCCACGCCGCCTTCTCG---AGACACTTCCGAGAGCCTGGCCTCAGCATC
Rhesus_macaque|24571           CGTCTGGGGAGTCACGCCGCCTTCTCCTCGAGACACTTCCGAGAGCCGGGCCTCAGCATC
Gorilla_gorilla|4978           CGTCTGGAGGGTCACGCCGCCTTCTCCTCGAGACACTTCCGAGAGCCGGGCCTCAGCATC
Homo_sapiens|31007             CGTCTGGAGGGTCACGCCGCCTTCTCCTCGAGACACTTCCGAGAGCCGGGCCTCAGCATC
Pan_troglodytes|14038          CGTCTGGAGGGTCACGCCGCCTTCTCCTCGAGACACTTCCGAGAGCCGGGCCTCAGCATC
Pongo_abelii|10380             CGTCTGGAGGGTCACGCCGCCTTCTCCTCGAGACACTTCCGAGAGCCGGGCCTCAGCATC
Choloepus_hoffmanni|5843       ------------------------------------------------------------
Procavia_capensis|5693         TGCCTTGGGAGCCACTCAGCGTTGTCCCCAAAGCCTTTTGGAGAGCCAGGCCTTGGCATC
                                                                                           

Danio_rerio|715                CTACTGGACGATCACTATGAGAGGCATGTGCGCCTCTCTCCACATGTTCTAGGCCACAGC
Ochotona_princeps|1056         TTGCTGGGGAGTTACTACGAGCACGAGGTGCGCCTGTCACCGCACGTGCTGGGCCACAGT
Ornithorhynchus_anatinus|27395 CTGCTGGAGAGCTTCTACGAGCACGAGGTGCGCCTGTCCCCCCACGTGCTGGGCCACAGC
Monodelphis_domestica|25682    TTACTGGAGAGTTACTATGAGCACGAAGTTCGCCTGTCCCCTCACGTACTGGGCCACAGC
Felis_catus|43153              TTGCTGGAGAGTTACTACGAGCACGAGGTGCGCCTCTCTCCGCACGTGCTGGGCCACAGC
Cavia_porcellus|15737          TTGCTGGAGAGTTACTACGAGCACGAGGTGCGCCTGTCGCCTCACGTGTTGGGCCACAGT
Rattus_norvegicus|3004         TTGCTGGAGAGTTACTATGAGCACGAAGTGCGCCTATCGCCACATGTGCTAGGTCACAGC
Canis_familiaris|24098         TTGCTGGAGAGCTACTACGAGCACGAGGTGCGCCTGTCCCCGCACGTGCTGGGCCACAGC
Myotis_lucifugus|15553         TTGCTGGAGAGTTACTACGAGCATGAGGTGCGCCTGTCACCGCACGTGCTGGGCCACAGT
Tarsius_syrichta|9904          CTGCTGGAGAGTTACTACGAGCACGAGGTGCGCCTGTCTCCGCACGTGCTGGGTCACAGC
Callithrix_jacchus|54056       TTGCTGGAGAGTTATTACGAGCACGAGGTGCGCCTGTCTCCGCACGTGTTGGGCCACAGC
Rhesus_macaque|24571           CTGCTGGAGAGTTACTACGAGCACGAGGTGCGTCTGTCTCCGCACGTGTTGGGCCACAGC
Gorilla_gorilla|4978           CTGCTGGAGAGTTACTACGAGCATGAGGTGCGCCTGTCTCCGCACGTGTTGGGCCACAGC
Homo_sapiens|31007             CTGCTGGAGAGTTACTACGAGCATGAGGTGCGCCTGTCTCCGCACGTGTTGGGCCACAGC
Pan_troglodytes|14038          CTGCTGGAGAGTTACTACGAGCATGAGGTGCGCCTGTCTCCGCACGTGTTGGGCCACAGC
Pongo_abelii|10380             CTGCTGGAGAGTTACTACGAGCACGAGGTGCGCCTGTCTCCGCACGTGTTGGGCCACAGC
Choloepus_hoffmanni|5843       ------------------------------------------------------------
Procavia_capensis|5693         TTGCTGGAGAGTTACTATGAGCACGAGGTGCGCCTGTCGCCGCACGTGCTGGGCCACAGC
                                                                                           

Danio_rerio|715                AAAGCCCATGTTGCCAAATTGGTCAGTGAACTTGTCAGGGTGGGCCGTACTGACGTCCCA
Ochotona_princeps|1056         AAGGCGCACGTGAGCCGGATTGTGGGCGAGCTGGTGCAGGCTGGCCGTGTCCAGGGGTCT
Ornithorhynchus_anatinus|27395 AAGGCGCACGTCAGCCGCATCGTGGGCGAGCTGGTGCGGGCCGGCCGGGCCCAGGGTCCC
Monodelphis_domestica|25682    AAGGCGCACGTGAGCCGCATCGTGGGGGAACTTGTCCGTGCCGGCCGGGCCCGGGGGTCT
Felis_catus|43153              AAGGCGCACGTGAGCCGGATCGTGGGCGAGCTGGTGCGGGCTGGCCGCGCCCGGGGGTCC
Cavia_porcellus|15737          AAGGCGCACGTGAGTCGGATCGTGGGCGAGCTGGTGCGGGCTGGCCGTATCAGGGGCACC
Rattus_norvegicus|3004         AAGGCGCATGTGAGCCGGATCGTAGGGGAACTGGTGCAAGCTGGCCGAGCCCGAGGGTCT
Canis_familiaris|24098         AAGGCGCACGTGAGCCGAATCGTGGGCGAGCTGGTgcgcgccggccgcgcccgggggtcc
Myotis_lucifugus|15553         AAGGCACACGTGAGCCGGATCGTGGGCGAGCTGGTGCGGGCTGGCCGCGCCCAGGGGTCC
Tarsius_syrichta|9904          AAGGCGCACGTGAGCCGGATCGTGGGTGAACTGGTGCGGGCCGGCCGCGCCCGGGGGTCC
Callithrix_jacchus|54056       AAGGCGCACGTGAGCCAGATCGTGGGCGAGCTGGTGCGGGCTGGCCGCTCCCGGGGGTCC
Rhesus_macaque|24571           AAGGCGCACGTGAGCCGGATCGTGGGCGAGCTGGTGCGGGCTGGCCGCGCCCGGGGGTCC
Gorilla_gorilla|4978           AAGGCGCACGTGAGCCGGATCGTGGGCGAGCTGGTGCGGGCTGGCCGCGCCCGGGGGTCC
Homo_sapiens|31007             AAGGCGCACGTGAGCCGGATCGTGGGCGAGCTGGTGCGGGCTGGCCGCGCCCGGGGGTCC
Pan_troglodytes|14038          AAGGCGCACGTGAGCCGGATCGTGGGCGAGCTGGTGCGGGCTGGCCGCGCCCGGGGGTCC
Pongo_abelii|10380             AAGGCGCACGTGAGCCGGATCGTGGGCGAGCTGGTGCGGGCTGGCCGCGCCCGGGGCTCC
Choloepus_hoffmanni|5843       ------------------------------------------------------------
Procavia_capensis|5693         AAGGCGCACGTGAGCCGGATCGTGGGCGAACTGGTGCGGGCTGGCCGTGCCCGGACGTCC
                                                                                           

Danio_rerio|715                CCAGAGTCT------------------TCTCTAGCCTTCAGGGGAGACTTCATCCAGATT
Ochotona_princeps|1056         CCAGGCACCATCCCCAGAGGAGCCCTGGCCTTAGCCTTCCGCGGAGACTTCATCCAAGTG
Ornithorhynchus_anatinus|27395 CAGGAT------CCCCAGGGTCGCCTGGCGCTGGCCTTCCGCGGGGACTTCGTCCGGGTG
Monodelphis_domestica|25682    CCAGGCCCATCCCCGGGGGGAGCCCTAGCTCTGGCCTTTCGGGGGGACTTTGTGCAGGTG
Felis_catus|43153              CCGGGCCCCATCCCCGGCGGGGCGCTGGCGTTGGCCTTCCGCGGAGACTTCATCCAGGTG
Cavia_porcellus|15737          CCATGCCCCATCTCTGGGGGAACTTTGGCCTTGGCCTTCCGCGGGGACTTCATCCAAGTG
Rattus_norvegicus|3004         CCGGGCCCCATCACCGGTGGAGCGCTGGCTTTGGCCTTCCGGGGAGACTTCATCCAGGTG
Canis_familiaris|24098         ccgggccccatccccggcggggcgcTGGCCCTGGCCTTCCGCGGAGACTTCATCCAGGTG
Myotis_lucifugus|15553         CCAGGCCTTATTCCTGGGGGCACATTGGCCTTGGCCTTCCGCGGAGACTTCATCCAGGTG
Tarsius_syrichta|9904          CCAGGCCCCATCCCCGGGGGGGCGTTGGCCTTGGCCTTCCGCGGAGACTTCATCCAAGTG
Callithrix_jacchus|54056       CCCGGCCTCATCCCCGGGGGAGCGCTGGCGTTGGCCTTCCGCGGAGACTTCATCCAGGTG
Rhesus_macaque|24571           CCCGGTCTCATTCCCGGTGGAGCGCTGGCCTTGGCCTTCCGCGGAGACTTCATCCAGGTG
Gorilla_gorilla|4978           CCCGGTCTCATTCCTGGGGGAGCGCTGGCCTTGGCCTTCCGCGGAGACTTCATCCAGGTG
Homo_sapiens|31007             CCCGGTCTCATTCCTGGGGGAGCGCTGGCCTTGGCCTTCCGCGGAGACTTCATCCAGGTG
Pan_troglodytes|14038          CCCGGTCTCATTCCTGGGGGAGCGCTGGCCTTGGCCTTCCGCGGAGACTTCATCCAGGTG
Pongo_abelii|10380             CCCGGTCTCATTCCTGGGGGAGCGCTGGCCTTGGCCTTCCGCGGAGACTTCATCCAGGTG
Choloepus_hoffmanni|5843       ------------------------------------------------------------
Procavia_capensis|5693         CCAGGCCCCATCCCCGCGGGGCCTCTGGCCTTGGCCTTCCGCGGAGACTTCATTCAAGTG
                                                                                           

Danio_rerio|715                GGCAGCTCCTATGAGGAGCACAAGGTGGGCTCACCTGATTGCTTTGACATCCTCGTACCT
Ochotona_princeps|1056         GGCAGCGCCTACGAGCAGCATAAAATCCGCCGGCCAGACAGCTTCGACGTGCTGGTGCCG
Ornithorhynchus_anatinus|27395 GGCAGCGCCTACGAGCGCCACAAGATCGGGCGGCCCGACGCCTTCGACGTGCTGGTGCCC
Monodelphis_domestica|25682    GGCAGCGCCTACGAGCAGCACAAGATCCGCCGTCCTGATGGCTTCGACGTGCTCGTTCCC
Felis_catus|43153              GGCAGCGCCTACGAGCAGCATAAAATCCGGCGGCCCGACGGCTTCGACGTGCTGGTGCCA
Cavia_porcellus|15737          GGTAGTGCCTATGAGCAGCACAAGATCCGCCGGCCAGACAGCTTCGACGTGCTGGTACCC
Rattus_norvegicus|3004         GGCAGCGCCTACGAACAGCATAAAATCCGGCGACCCGACAGCTTCGACGTGCTGGTGCCA
Canis_familiaris|24098         GGCAGCGCCTACGAGCAGCATAAAATCCGGCGGCCCGACGGTTTCGACGTGCTGGTGCCG
Myotis_lucifugus|15553         GGCAGCGCGTATGAGCAGCATAAAATCCGCCGGCCGGACGCCTTCGACGTTCTGGTGCCA
Tarsius_syrichta|9904          GGCAGCGCCTACGAGCAGCATAAGATCCGCCGGCCCGACGGCTTCGACGTGCTGGTGCCG
Callithrix_jacchus|54056       GGCAGCGCCTACGAGCAACATAAAATCCGCCGGCCCGACAGCTTCGATGTGCTGGTGCCA
Rhesus_macaque|24571           GGCAGCGCCTACGAGCAGCATAAAATCCGCCGGCCCGACAGCTTCGACGTGCTGGTGCCA
Gorilla_gorilla|4978           GGCAGCGCCTACGAGCAACATAAAATCCGCCGGCCCGACAGCTTCGACGTGCTGGTGCCA
Homo_sapiens|31007             GGCAGCGCCTACGAGCAACATAAAATCCGCCGGCCCGACAGCTTCGACGTGCTGGTGCCA
Pan_troglodytes|14038          GGCAGCGCCTACGAGCAACATAAAATCCGCCGACCCGACAGCTTCGACGTGCTGGTGCCA
Pongo_abelii|10380             GGCAGCGCCTACGAGCAACATAAAATCCGCCGGCCCGACAGCTTCGACGTGCTGGTGCCA
Choloepus_hoffmanni|5843       ------------------------------------------------------------
Procavia_capensis|5693         GGCAGCGCCTACGAGCAGCATAAAATCCGAAGGCCCGACGGCTTCGACGTGCTGGTGCCG
                                                                                           

Danio_rerio|715                CTGCGAGCTCCTCGTGGGCTGAAACTGGAGACAAGCGCTTGCACTGACAAACATGGAGGA
Ochotona_princeps|1056         CTGCGCCTGCCCCCGCTCGTGGCTCTGGAGCCCCGGAGCCTG------GAGGTGCCACTC
Ornithorhynchus_anatinus|27395 CTGCGCCTGCCGCCCCTCGTGGCGCTG---------------------------------
Monodelphis_domestica|25682    TTGCGCCTCCCTCCTCTAGTGGCGCTGGAGCCTAGGGGTCTGGGGGCGGAGCCCGAGTTG
Felis_catus|43153              CTGCGCCTCCCGCCGCTGGTGGCGCTGGAGCCTCGGAGCCTGGGCGCCGAGCCCGCGCTG
Cavia_porcellus|15737          CTGCGCCTGCCGCCGCTGGTGGCGCTGGAGCCGCGGAGCCTGGGCGCAGAGCCCACTCTG
Rattus_norvegicus|3004         CTGAGACTCCCGCCGCAGGTGGCGCTGGAGCCACGGAGCCTAGGGACTGAACCTGCTCTG
Canis_familiaris|24098         CTGCGTCTGCCGCCGCCGGTGGCGCTGGAGCCGCGGAGCCTGGGCGCGGAGGCGGCGCTC
Myotis_lucifugus|15553         TTGCGCCTGCCGCCGCTGGTGGCGCTGGAACCGCGGAGCCTGGGCGCGCAGCCCGCTTTG
Tarsius_syrichta|9904          CTGCGCCTCCCGCCGATGGTGGCGCTGGAGCCACGGAGCCTGGGTGCGGAGCCGGCGCTG
Callithrix_jacchus|54056       CTGCGCCTCCCACCGCTGGTGGCGCTGGACCCACGGAGCCTGGGCGAGGAGCTAGCGCTG
Rhesus_macaque|24571           CTGCGCCTGCCGCCGCTTGTGGCGCTGGAGCCACGGAGCCTGGGCGAGGAGCCAGTGCTG
Gorilla_gorilla|4978           CTGCGCCTCCCGCCGCTTGTGGCGCTGGAGCCACGGAGCCTGGGCGAGGAGCCAGCGCTG
Homo_sapiens|31007             CTGCGCCTCCCGCCGCTTGTGGCGCTGGAGCCACGGAGCCTGGGCGAGGAGCCAGCGCTG
Pan_troglodytes|14038          CTGCGCCTCCCGCCGCTTGTGGCGCTGGAGCCACGGAGCCTGGGCGAGGAGCCAGCGCTG
Pongo_abelii|10380             CTGCGCCTCCCGCCGCTTGTGGCGCTGGAGCCACGGAGCCTGGGCGAGGAGCCAGCGCTG
Choloepus_hoffmanni|5843       ------------------------------------------------------------
Procavia_capensis|5693         CTGCGCCTCCCCCCGCTTGTGGCGCTGGAGCCGCGGAGCCTGGGCGCTGAGCCGGTGCTG
                                                                                           

Danio_rerio|715                CCACCG------------------CTGTGCACACTGAACACA---CCTCGC---------
Ochotona_princeps|1056         GCAGCGTCCTTCCGAAGAACCCTCTTGGATGACCTCTATTCT---TCACCNNNNNNNNNN
Ornithorhynchus_anatinus|27395 ---------------GcTTGCTTCGTGTGCGCCCTGAGGGCC---CCGAGG---------
Monodelphis_domestica|25682    CCCTTGGCTCTTCGTGGCTGCTTCCTGTGCGCCCTCAAGGCCTCACCATCCTCCCCTTCC
Felis_catus|43153              GCCCCAGCCTTCCACGGCTGTTTCGTGTGCGCGCTCAAGGCG---CCGCCG---------
Cavia_porcellus|15737          GCCCCCGCCTTCCGCAACTGCTTCGTGTGCGCCCTCAAGGCT---CCGCCCTCACCGTCG
Rattus_norvegicus|3004         ACCCCGGCCTTCCGCAGCTGCTTCGTGTGCACCCTCAAGGCA---CCGCCCTCGCCATCG
Canis_familiaris|24098         GCCCCGGCCTTTCTCGGCTGCTTCGTGTGCGCGCTCAAggcg---ccgccg---------
Myotis_lucifugus|15553         GCTCCAGCCTTTCACGGCTGCTTCGTGTGCGCACTCAAGGCG---CCGCCG---------
Tarsius_syrichta|9904          GCCCCAGCCTTCCGGGCTTGCTTCGTGTGCGCCCTCAAGGCA---CCGCCCTCGCCATCT
Callithrix_jacchus|54056       GCCCCGGCCTTCCGCAGCTGCTTCGTGTGCGCCCTTAAGGCA---CCACCCTCACCTTCT
Rhesus_macaque|24571           GCCCCAGCCTTCCGCGGCTGCTTCGTATGCGCCCTCAAGGCA---CCACCCTCACCATTG
Gorilla_gorilla|4978           GCCCCGGCCTTCCGCGGTTGCTTTTTGTGCGCCCTCAAGGCA---CCACCCTCACCATCG
Homo_sapiens|31007             GCCCCGGCCTTCCGCGGCTGCTTCTTGTGCGCCCTCAAGGCA---CCACCCTCACCATCG
Pan_troglodytes|14038          GCCCCGGCCTTCCGCGGCTGCTTCTTGTGCGCCCTCAAGGCA---CCACCCTCACCATCG
Pongo_abelii|10380             GCCCCGGCCTTCCGCGGATGCTTCTTGTGCGCCCTCAAGGCA---CCACCCTCACCATCG
Choloepus_hoffmanni|5843       ------------------------------------------------------------
Procavia_capensis|5693         GCTCCGGCTTTCCGTGGTTGCTTCTTATGCGCCCTCAAGGCG---CCGCCTGCGCCATCA
                                                                                           

Danio_rerio|715                ---------AAGGCAGAGTGGACACGCCGTCACAAGGCCTTTACTGACACATTCATGCAC
Ochotona_princeps|1056         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|27395 ---GCGGCCGGGGGCCAGTGGGCCCGCGACTGCAAGCCCTTCGCCGACCAGTTCTGCGCG
Monodelphis_domestica|25682    GGTGGGGTTGGAAGCCAGTGGCAGCGGGACTCCAAACCCTTCTCCGACGGCTTCTGCGTG
Felis_catus|43153              GGGGCCTCCGGGGGCCACTGGCTCCGGGACTGCAAACCCTTTGCCGACGGCTTCTGCGTG
Cavia_porcellus|15737          GGAACCTCAGGGGGCCACTGGCTCCGGAACTGCAAACCCTTCACGGACAGCTTCTGCGTG
Rattus_norvegicus|3004         GGGACCTCGACGGGCCAGTGGCATCGCGACTGCAAGCCCTTCGCTGAAGGCTTCTGTGTG
Canis_familiaris|24098         ggggcccccgcgAGCCGGTGGCTCCGGGACTGCAGGCCCTTCGCCGACGGCTTCTGCGTG
Myotis_lucifugus|15553         GGGGCTTCTGGGGGTCACTGGCTCCGGGACTGCAAACCCTTCGCCGAGGGCTTCTGTGTG
Tarsius_syrichta|9904          GGGGCCTCTGGGGGCCACTGGCTTCGGGACTGCAAACCCTTCGCTGATGGCTTCTGCGTG
Callithrix_jacchus|54056       GGGGCCTCGGGGGGCCACTGGCTTCGGGACTGCAAACCCTTTGCTGATGGCTTCTGCGTG
Rhesus_macaque|24571           GGGGCCTCGGGGGGCCACTGGCTTCGGGACTGCAAACCCTTTGCTGATGCCTTCTGCGTG
Gorilla_gorilla|4978           GGGGCCTCGGGGGGCCACTGGCTTCGGGACTGCAAACCCTTTGCTGATGCCTTCTGCGTG
Homo_sapiens|31007             GGGGCCTCGGGGGGCCACTGGCTTCGGGACTGCAAACCCTTTGCTGATGCCTTCTGCGTG
Pan_troglodytes|14038          GGGGCCTCGGGGGGCCACTGGCTTCGGGACTGCAAACCCTTTGCTGATGCCTTCTGCGTG
Pongo_abelii|10380             GGGGCCTCGGGGGGCCACTGGCTTCGGGACTGCAAACCCTTTGCTGATGCCTTCTGCGTG
Choloepus_hoffmanni|5843       ------------------------------------------------------------
Procavia_capensis|5693         GGGGCCCCCTCGGGCAACTGGCTCCGGGACTGTAAACCCTTCGCTGACGGCTTCTGCGTG
                                                                                           

Danio_rerio|715                AGTTCTCAAAATGTCTATAAGATGAGTCCAGATTCTGTCCAGCGCTGGTTTTACACAGCC
Ochotona_princeps|1056         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|27395 GACCTGCGGGGCCGGCCCCATCTGTCGTCCGGCCTGGTGCTGCGCTGGTTCCAGGCGCGG
Monodelphis_domestica|25682    GACCTGCGCGGTCGGCGCCACCTCTCTGCGGCGCTAGTGTCGCGCTGGTTCCAGGCGCAC
Felis_catus|43153              GACGTGCTCGGGCGGCGTCACCTCTCCGCCACTATGGTGCTTCGCTGGTTCCAGTCGCAC
Cavia_porcellus|15737          GATGTGCGTGGTCAGCGCCACCTCTCTGCCACTTTGGTGTTGCGCTGGTTCCAGTCGCAC
Rattus_norvegicus|3004         GATGTGCAGGGCCGTCGCCACCTCTCAGCTACCCTGGTGCTGCGCTGGTTCCAGGCGCAC
Canis_familiaris|24098         GACGTGCTCGGGCGGCGGCACCTCTCCGCCTCGCTGGTGCTGCGCTGGTTCCAGGCGCAC
Myotis_lucifugus|15553         GACGTGCGCGGGCGGCGCCACCTCTCGGCCACCCTGGTGCTGCGCTGGTTCCAGTCGCAT
Tarsius_syrichta|9904          GATGTACACGGACGGCGCCACCTATCCGCGGCGCTGGTGCTGCGCTGGTTCCAGTCGCAC
Callithrix_jacchus|54056       GATGTGCGCGGGCGGCGCCACCTTTCTGCTGCTCTGGTGCTGCGCTGGTTCCAGTCGCAT
Rhesus_macaque|24571           GATGTGCGCGGGCGGCGTCACCTCTCTGCTACTTTGGTGCTGCGCTGGTTCCAGTCTCAT
Gorilla_gorilla|4978           GATGTGCGCGGGCGGCGTCACCTCTCTGCTACTCTGGTGCTGCGCTGGTTCCAGTCGCAT
Homo_sapiens|31007             GATGTGCGCGGGCGGCGTCACCTCTCTGCTACTCTGGTGCTGCGCTGGTTCCAGTCGCAT
Pan_troglodytes|14038          GATGTGCGCGGGCGGCGTCACCTCTCTGCTACTCTGGTGCTGCGCTGGTTCCAGTCGCAT
Pongo_abelii|10380             GATGTGCGCGGGCGGCGTCACCTCTCTGCTACTCTGGTGCTGCGCTGGTTCCAGTCGCAT
Choloepus_hoffmanni|5843       ---------------------CTCTCGACCACGCTGATAATGCGCTGGTTCCAATCGCAC
Procavia_capensis|5693         GACGTGCGCGGGCGGCGCCACCTCTCCGCCACACTGGTGCTGCGCTGGTTTCAGTCGCAC
                                                     .              .     . .....          

Danio_rerio|715                ACTCAGCGCTGCCTTGCTGCCGTACGTTACCCTTTTGACCAGCGCTGCTCCCTCAGTCTC
Ochotona_princeps|1056         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|27395 CTGCAGCGCTGCCTGGGCACCGTGCGCTACCGGCTGGAGGAGCGCTGCCGGGTCAGCCTG
Monodelphis_domestica|25682    TTGCAGCGATGCCTAGCCACGGTGCGGTACAGCTTGGAGGAACGCTGCCGGGTCAGCCTG
Felis_catus|43153              CTGCAGCGTTCCCTGGCCACCGTGCGCTACAGCCTGGAGGGGCGTTGTCGGGTCAGCCTG
Cavia_porcellus|15737          CTGCAGCGCTCCCTGGCCACCGTGCGCTACAAACTGGAAGAGTGCTGTCGGGTCAGCTTG
Rattus_norvegicus|3004         CTACAGCGCTCCTTGGCCACCGTGCGCTACAGTTTGGAGGGTCGCTGTCGCGTCAGCCTG
Canis_familiaris|24098         CTGCAGCGCTCCCTGGCCACTGTGCGCTACAGCCTGGAGGGGCGTTGTCGGGTCAGCCTG
Myotis_lucifugus|15553         CTGCAGCGTTCCCTGGCCACCGTGCGCTACAGCCTGGAGGAGCGCTGTCGGGTCACCCTG
Tarsius_syrichta|9904          CTGCAGCGCTCCCTGGCCACGGTGCGCTACAGCCTGGAGGGGCGCTGTCGGGTCACCCTG
Callithrix_jacchus|54056       CTGCAGCGCTCCTTGGCCACTGTGCGTTACAGCCTGGAGGGGCGCTGTCGGGTCACCTTG
Rhesus_macaque|24571           CTGCAGCGCTCCTTGGCCACTGTGCGTTACAGCCTGGAGGGGCGCTGTCGGGTCACCTTG
Gorilla_gorilla|4978           CTGCAGCGCTCCTTGGCCACTGTGCGTTACAGCCTGGAGGGGCGCTGTCGGGTCACCTTG
Homo_sapiens|31007             CTGCAGCGCTCCTTGGCCACTGTGCGTTACAGCCTGGAGGGGCGCTGTCGGGTCACCTTG
Pan_troglodytes|14038          CTGCAGCGCTCCTTGGCCACTGTGCGTTACAGCCTGGAGGGGCGCTGTCGGGTCACCTTG
Pongo_abelii|10380             CTGCAGCGCTCCTTGGCCACTGTGCGTTACAGCCTGGAGGGGCGCTGTCGGGTCACCTTG
Choloepus_hoffmanni|5843       CTGCAGCGCTCCCTGGCCACCGTGCGCTACAGCCTGGAGGGGCGCTGTCGGGTCAGCCTG
Procavia_capensis|5693         CTGCAGCGTTCTCTGGCTACCGTACGCTACAGTCTAGAGGGGCGCTGTCGGGTCAGCCTG
                                    . . .   . .     ..  . .      . .      . ..     .     . 

Danio_rerio|715                TCTCTCAGT------GAAGAGCAGCAGGTTCTCCTCCGTATGACCCCCCGCTCTGATTAC
Ochotona_princeps|1056         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|27395 GCCCCGGGCGGCCAGGACCGGCCGCCCACCCTCCACGTCCTGCCCCGCCGCACCGACTAC
Monodelphis_domestica|25682    TCTCCCGGGGGTCTTGACCAGCCGCCCACTCTGCACATCCTACCTTGCCGCACCGACTAC
Felis_catus|43153              ACCCCCGGCGGCCTGGAGCAACCCCTTACCCTGCTCATCCTGCCGTGCCACNNNNNNNNN
Cavia_porcellus|15737          ACCTCTGGTGGTCTGGAGCAGCCTCCTATCCTACACATTCTGCCATGTCGCACGGATTAT
Rattus_norvegicus|3004         ACCCCAGGGGGTCTGGAGCAGCCTCCCACCCTTCACATCCTTCCCTGCCGCACGGACTAT
Canis_familiaris|24098         ACCCCCGGCGGCCTGGAGCAGCCTCCCACCCTGCACATCCTGCCTTGCCGCACCGACTAC
Myotis_lucifugus|15553         ACTCCGAGAGGCCTGGAGCAACCTCCCACCCTGCACATCCTGCCCTGCCGCACCGATTAT
Tarsius_syrichta|9904          ACTCCGGGCGGCCTGGAACAGTCCCCTACTTTACACATCCTGCCCTGCCGCACGGACTAT
Callithrix_jacchus|54056       ACCCCGGGTGGCCTGGAACAACCTCCCACGTTACACATCCTGCCCTGCCGCACTGACTAC
Rhesus_macaque|24571           ACTCCAGGTGGCCTGGAACAGCCCCCCACCTTACACATCCTGCCCTGCCGCACTGACTAC
Gorilla_gorilla|4978           ACCCCAGGTGGCCTGGAACAGCCCCCCACCTTACACATCTTGCCCTGCCGCACTGACTAC
Homo_sapiens|31007             ACCCCAGGTGGCCTGGAACAGCCCCCCACCTTACACATCTTGCCCTGCCGCACTGACTAC
Pan_troglodytes|14038          ACCCCAGGTGGCCTGGAACAGCCCCCCACCTTACACATCTTGCCCTGCCGCACTGACTAC
Pongo_abelii|10380             ACCCCAGGTGGCCTGGAACAGCCCCCCACCTTACACATCTTGCCCTGCCGCACTGACTAC
Choloepus_hoffmanni|5843       ACCCCCAGCGACCTGGAGCAGCCGCCCGTCCTGCACATCCTGCCCTGCCGCACCGACTAC
Procavia_capensis|5693         ACCCCGGGCGGTCTGGAGCAGCCACCCACCCTGCACATCCTGCCCTGCCGCACAGACTAC
                                      .       .               .        .             .  .  

Danio_rerio|715                GTCTGCTGTCACATATCAATGGGCATTCGGCTGATCCCAGCATTTCCTCTCAGTGATGGA
Ochotona_princeps|1056         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|27395 GGCTGCTGCCGCCTCTCCATGGCCGTGCGGCTCATCCCCGCCGTGCACCTGGGCGACGGG
Monodelphis_domestica|25682    GGCTGCTGCCGGCTTTCCATGGCAGTGCGCCTCATCCCCGCTGTACACCTGGGCGATGGT
Felis_catus|43153              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|15737          GGGTGCTGCCGCCTTTCCATGGCTGTGCGTCTCATCCCTGCGGTCCATCTTGGGGACAGC
Rattus_norvegicus|3004         GGCTGCTGCCGCCTTTCCATGGCCGTGCGCCTCATCCCGGCTGTCCACCTGGGTGAAGGC
Canis_familiaris|24098         GGCTGCTGCCGCCTCTCCATGGCAGTGCGTCTCATCCCCGCTGTGCACGTGGGCGATGGC
Myotis_lucifugus|15553         GGCTGCTGCAGACTTTCCATGGCCGTGCGACTCATTCCCGCCATCCATTTGGGCGACGGT
Tarsius_syrichta|9904          GGCTGCTGCCGCCTTTCCATGGCCGTGCGCCTCATCCCCGCAGTCCATGTGGGAGATGGG
Callithrix_jacchus|54056       GGCTGCTGCCGCCTTTCCATGGCTGTGCGCCTCATTCCCGCTGTCCATCTGGGAGATGGC
Rhesus_macaque|24571           GGCTGCTGTCGCCTTTCCATGGCTGTGCGTCTCATCCCCGCAGTCCATCTGGGAGATGGG
Gorilla_gorilla|4978           GGCTGCTGCCGCCTTTCTATGGCTGTGCGTCTCATCCCCGCTGTCCATCTGGGAGATGGG
Homo_sapiens|31007             GGCTGCTGCCGCCTTTCTATGGCTGTGCGTCTCATCCCCGCTGTCCATCTGGGAGATGGG
Pan_troglodytes|14038          GGCTGCTGCCGCCTTTCCATGGCTGTGCGTCTCATCCCCGCTGTCCATCTGGGAGATGGG
Pongo_abelii|10380             GGCTGCTGCCGCCTTTCCATGGCTGTGCGTCTCATCCCCGCTGTCCATCTGGGAGATGGA
Choloepus_hoffmanni|5843       GGCTGCTGCCGCCTTTCCATGGCCGTGCGTCTTATCCCCGCCGTCCATTTGGGCGAGGGT
Procavia_capensis|5693         GGCTGCTGCCGCCTTTCCATGGCAGTACGTCTCATCCCTGCCGTCCATCTGGGAGATGGC
                               .  .. ..     . .   ...   .  .  .  .    .   .     .  . .   . 

Danio_rerio|715                GGATTTTTGGTGGCATCCCAG---------------------------------------
Ochotona_princeps|1056         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|27395 GTCTTCCTG---------------------------------------------------
Monodelphis_domestica|25682    GTCTTCCTAGTTGCACCGCCACTATCTCCCCTA------------GGGCTCCCGTCAGAG
Felis_catus|43153              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNNNNNNNNNNGGAG
Cavia_porcellus|15737          GTCTTCCTTGTGGCACCACCTCCACCACCCTCCCCTGTT------GGGCTCTTCTCGGAG
Rattus_norvegicus|3004         GTCTTCCTTGTGGCACCGCCGCCACCACCCTCGCCTAGC------GGGGCTCTGTCAGAG
Canis_familiaris|24098         GTTTTCCTGGTGGCGCCACCACCGTCACCGTCCCCCTCGCTCGTCGGGCCCCTGCCGGAG
Myotis_lucifugus|15553         GTCTTCCTCGTGGCTCCACCACCGCCATCCTCACCCGTT------GGGCCCCTGTCGGAG
Tarsius_syrichta|9904          GTCTTCCTTGTGGCACCGCCACCGCCACCCTTGCCTGGC------GGGCCCCTGTCAGAG
Callithrix_jacchus|54056       GTCTTCCTTGTGGCGCCACCACCGCCACCCTTGTCCAGC------GGGCTCCTGTTGGAG
Rhesus_macaque|24571           GTCTTCCTTGTGGCGCCACCACCGCCACCCCTGCCCAGC------GCGCCCCTGTTGGAG
Gorilla_gorilla|4978           GTCTTCCTTGTGGCGCCACCACCGCCACCCTTGCCCAGC------GCGCCCCTGTTGGAG
Homo_sapiens|31007             GTCTTCCTTGTGGCGCCACCACCGCCACCCTTGCCCAGC------GCGCCCCTGTTGGAG
Pan_troglodytes|14038          GTCTTCCTTGTGGCGCCACCACCGCCACCCTTGCCCAGC------GCGCCCCTGTTGGAG
Pongo_abelii|10380             GTCTTCCTTGTGGCGCCACCACCGCCACCCTTGCCCAGC------GCGCCCCTGTTGGAG
Choloepus_hoffmanni|5843       GTCTTCCTCGTGGCGCCACCCCCGCCAGCCTTGCCCGCT------GGGACCCTGTCGGAG
Procavia_capensis|5693         GTGTTCCTTGTGGCACCACCTCCACCACCCACGTCCGCA------GGATCCCTGTCGGAG
                               .  ..  .                                                    

Danio_rerio|715                ---------------CAAGGAAAGGACCTTTGGACTGTGTATTTTCCTAGACAGGAGCAG
Ochotona_princeps|1056         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGCAG
Ornithorhynchus_anatinus|27395 ---------------------GAGGCGCTCTGGGGGGTCAACACGGCCCGTCACGAGCAG
Monodelphis_domestica|25682    CTTCCTGGAGGGCTCCGGGCCGAGGCACTGTGGGGATTGAACACGGCCCGCCAGGAGCAG
Felis_catus|43153              CTCCCGGGAGGCCTGCGCACATATGCACTGGGGGGTGTGAATACATCGCGTCAGGAGCAG
Cavia_porcellus|15737          CTCCCGGGAGGCCTGCGCTCTGAGGCACTGTGGGGTGTGAACACAGCTCGCCAGGAACAA
Rattus_norvegicus|3004         CTCCCAGGTGGCCTGCGTGCTGAGGCACTGTGGGGTGTGAACACAGCACGTCAGGAGCAG
Canis_familiaris|24098         CTCCCGGGAGGCCTGCGCACGGACGCGCTGTGGGGCGTGAACACCGCTCGCCAGGAGCAG
Myotis_lucifugus|15553         CTCCCGGAAGGCCTGCGTGCAGATGCACTTTGGGGCGTGAACACCGCCCGCCAGGAGCAG
Tarsius_syrichta|9904          CTCCCGGGGGGCCTGCGCGCCGAGGCACTGTGGGGTGTGAACACAGCTCGCCAGGAGCAG
Callithrix_jacchus|54056       CTCCCTGGGGGCCTGCGCTCGGAGGCACTGTGGGGTGTGAATACAGCACGCCAGGAGCAG
Rhesus_macaque|24571           CTCCCTGAGGGCCTGCGCGCGGAGGCACTGTGGGGTGTGAACACGGCACGCCAGGAGCAG
Gorilla_gorilla|4978           CTCCCTGAGGGCCTGCGTGCGGAGGCACTGTGGGGTGTGAACACAGCACGCCAGGAGCAG
Homo_sapiens|31007             CTCCCTGAGGGCCTGCGTGCGGAGGCACTGTGGGGTGTGAACACAGCACGCCAGGAGCAG
Pan_troglodytes|14038          CTCCCTGAGGGCCTGCGTGCGGAGGCACTGTGGGGTGTGAACACAGCACGCCAGGAGCAG
Pongo_abelii|10380             CTCCCTGAGGGCCTGCGTGCGGAGGCACTGTGGGGTGTGAACACAGCACGCCAGGAGCAG
Choloepus_hoffmanni|5843       CTCCCGGGAGGCCTGCGCGCAGAGGCGCTGTGGGGTGTCAACACAGCGCGCCAGGAGCTA
Procavia_capensis|5693         CTCCCCGGAGGTCTGCGCCCCGAGGCGCTGTGGGGCGTGAACACAGCGCGCCAGGAGCAG
                                                       .   .  ..    .           .    **.*:.

Danio_rerio|715                AGACTGCTGACATGCCTGAAAGGTAGACTGCCTTCCAACTCCTGCCATCTGAAGTGCCTT
Ochotona_princeps|1056         AAGCTGCTGAGCTGGCTGCAGGAACGGGCTCCTCCAGGGGCCTGCTACCTCAAGTGCCTG
Ornithorhynchus_anatinus|27395 CGCCTGCTGGCCTGGCTGCAGGACCGGGCCCCGCCCCAGGCCTGCCACCTCAAGTGCCTG
Monodelphis_domestica|25682    CGACTGCTGGCCTGGCTGCAAGAACGAGCCCCACCTGGGGCCTGCCACCTTAAATGCCTG
Felis_catus|43153              AAGCTGATGAGCTGGATGCAGGAACGGTCCCCTCCAGATGCGAGCTACATCAAGTGCCTG
Cavia_porcellus|15737          AAGTTGCTGGTCTGGCTTCAGGAACGGGCTGCTCCAGGTGCCTGCTACCTCAAGTGCCTA
Rattus_norvegicus|3004         AAACTGCTGGGCTGGCTTCAGGAACGGGCGCCTCCAGGTGCCTGCTACCTCAAGTGCCTG
Canis_familiaris|24098         AAGCTGCTGAGCTGGCTGCAGGAACGGGCCCCTCCAGGTGCCTGCTACCTCAAGTGCCTG
Myotis_lucifugus|15553         AAGCTGCTGGGCTGGCTGCAGGAACGGGCCCCTCCAGGTGCCTGCTACCTCAAGTGCCTG
Tarsius_syrichta|9904          AAGTTGCTGGGCTGGCTGCAGGAACGGGCCCCTCCAGGCGCCTGCTACCTCAAGTGCCTG
Callithrix_jacchus|54056       AAGCTGCTGAGTTGGCTGCAGGAACGGGCAGCTCCAGGTGCCTGCTACCTCAAGTGCCTG
Rhesus_macaque|24571           AAGCTGCTGAGTTGGCTGCAGGAACGGGCAGCTCCAGGTGCCTGCTACCTCAAGTGCCTG
Gorilla_gorilla|4978           AAGCTGTTGAGTTGGCTGCAGGAACGGGCAGCTCCAGGTGCCTGCTACCTCAAGTGCCTG
Homo_sapiens|31007             AAGCTGCTGAGTTGGCTGCAGGAACGGGCAGCTCCAGGTGCCTGCTACCTCAAGTGCCTG
Pan_troglodytes|14038          AAGCTGCTGAGTTGGCTGCAGGAACGGGCAGCTCCAGGTGCCTGCTACCTCAAGTGCCTG
Pongo_abelii|10380             AAGCTGCTGAGTTGGCTGCAGGAACGGGCAGCTCCAGGTGCCTGCTACCTCAAGTGCCTG
Choloepus_hoffmanni|5843       AAGCTGCTGAGCTGGCTGCAGGAACGGGCTCCTCCAGGTGCGTGCTACCTCAAGTGCCTG
Procavia_capensis|5693         AAGCTTCTGAGCACGCTGCAGGAACGGGCCTCTCCAGGCGCCTGCTACCTCAAGTGCCTG
                               ..  *  **.  :  .* .*.*. .*.    *  *  .  * :** * .* **.***** 

Danio_rerio|715                CAGCTCCTCAAGGAGATCCGTAACCTCAGTGGAGAGGTGCTGGACCAGCAGTCTGGAGCA
Ochotona_princeps|1056         CAGTTGCTGAAGGCTGTGCGAGACCTGGGCGCCCGCGGGCTGGACCCCATGGCTGCCGCT
Ornithorhynchus_anatinus|27395 CGGCTGCTCAAGGCCCTGCGGGACCTGGGGGCCCGGGGGCTGGAGGCCGAGGCCGCCGCC
Monodelphis_domestica|25682    CAGCTGCTAAAGGCACTGAGGGATCTGGGCGCCCGAGGGCTGGACCCTGTGGCCTCATCC
Felis_catus|43153              CAGTTGATTAAAGCTCTGCGAGACATGGGCGCCTGCGGGCTGGACCCGGCGGATGCCACC
Cavia_porcellus|15737          CAGTTGCTGAAAGCTTTGCGAGATCTGGGTGCCCGTGGGCTGGACCCAATGGCTGCCACC
Rattus_norvegicus|3004         CAGCTGCTTAAGGCCCTTCGAGACTTGGGTGCCCGCGGGCTGGACCCGATGGCTGCTACA
Canis_familiaris|24098         CAGCTGCTTAAAGCCCTGCGAGACCTGGGCGCCCGCGGGCTGGACCCGACGGCCGCCACC
Myotis_lucifugus|15553         CAGTTGCTTAAAGCCCTCCGAGACCTGGGCGCCCGCGGGCTGGACCCAAGGGCTGCCGCC
Tarsius_syrichta|9904          CAGTTGCTGAAGGCTCTGCGCGACCTGGGTGCCCGTGGGCTGGACTCAGCGGCTGCCACC
Callithrix_jacchus|54056       CAGTTGCTTAAGGCTCTGCGAGATCTGGGTGCCCGTGGGCTGGACTCAGCGGCCGCCACC
Rhesus_macaque|24571           CAGTTGCTTAAGGCTCTGCGAGATCTGGGCGCCCGTGGGCTGGACTCAGCGGCTGCCACC
Gorilla_gorilla|4978           CAGTTGCTTAAGGCTCTGCGCGATCTGGGGGCCCGTGGGCTGGACTCAGCGGCCGCCACC
Homo_sapiens|31007             CAGTTGCTTAAGGCTCTGCGCGATCTGGGGGCCCGTGGGCTGGACTCAGCGGCCGCCACC
Pan_troglodytes|14038          CAGTTGCTTAAGGCTCTGCGCGATCTGGGGGCCCGTGGGCTGGACTCAGCGGCCGCCACC
Pongo_abelii|10380             CAGTTGCTTAAGGCTCTGCGCGATCTGGGCGCCCGTGGGCTGGACTCAGCGGCCGCCACC
Choloepus_hoffmanni|5843       CAGTTGCTTAAGGCCCTGCGAGATCTGGGCGCCCGCGGGCTGGACCCCACGGCCGCCACC
Procavia_capensis|5693         CAGTTGCTAAAGGCCATTCGAGACCTGGGCGCCCGCGGGCTGGACCCCACGGCTGCAACC
                               *.* * .* **.*.  * .* .*  * .* * . . * ******  .   * .     * 

Danio_rerio|715                GAATGGGGAACGGTGCTTTCGTCTTATGCTCTGAAGACCGCCTGGATTCGTCTGCTGCTC
Ochotona_princeps|1056         CAGTGGAGACGCATCCTGTCCTCCTATGTGCTCAAGACGGTGCTGCTGGCAGCGCTGCTG
Ornithorhynchus_anatinus|27395 CGCTGGGGGCGGGTCCTCTCCTCCTTCGGCCTCAAGATGGCCTGGCTGGCCCTGCTGCTG
Monodelphis_domestica|25682    CAGTGGGGGCGCATCCTGTCGTCTTATACGCTCAAGACTGCGCTTCTGACGCTGCTGCTG
Felis_catus|43153              CAG---GGACGCATTCTGTCCTCGTACATGCTCAAGACAGTACTGCTGGCGGTGCTGCTG
Cavia_porcellus|15737          CAGTGGGGACAAGTCCTATCCTCATACGTGCTCAAGACGGTGCTGCTGACAGTGTTGCTG
Rattus_norvegicus|3004         CACTGGGGACGCATCCTGTCCTCCTACATGCTCAAAACAGCGGTGCTCGAGGTGCTTCTG
Canis_familiaris|24098         CAGTGGGGACGCATCCTGTCCTCGTACGTGCTCAAGACGGCGCTGCTGGCGGTGTTGTTG
Myotis_lucifugus|15553         CAGTGGGGACGCATCCTGTCCTCATACGTGCTCAAGACAGTGCTGCTGGCGGTGCTGCTG
Tarsius_syrichta|9904          CAGTGGGGACGCATCCTGTCTTCATACGTGCTCAAGACAGCGCTGCTGGCGGTGCTGCTG
Callithrix_jacchus|54056       CAGTGGGGACGCATCCTGTCCTCCTATGTGCTCAAGACAGTGCTGCTGGCAGTGCTGCTA
Rhesus_macaque|24571           CAGTGGGGACGCATCCTGTCCTCATATGTGCTCAAGACAGTGCTGCTGGCAGTGCTGCTG
Gorilla_gorilla|4978           CAGTGGGGACGCATCCTATCCTCATATGTGCTCAAGACAGTGCTGCTGGCAGTGCTGCTG
Homo_sapiens|31007             CAGTGGGGACGCATCCTATCCTCATATGTGCTCAAGACAGTGCTGCTGGCAGTGCTGCTG
Pan_troglodytes|14038          CAGTGGGGACGCATCCTATCCTCATATGTGCTCAAGACAGTGCTGCTGGCAGTGCTGCTG
Pongo_abelii|10380             CAGTGGGGACGCATCCTGTCCTCATATGTGCTCAAGACAGTGCTGCTGGCAGTGCTGCTG
Choloepus_hoffmanni|5843       CAGTGGGGACGCATCCTGTCCTCGTATGTGCTCAAGTCGGCGCTGCTGGCAGTGCTGCTG
Procavia_capensis|5693         CAGTGGGGGCGCATCCTATCCTCCTACGTGCTCAAGACAGCGCTGCTGGCGGTGCTGTTG
                                .    .*..  .* ** ** ** *: .  ** **.:  *     .*      * *  * 

Danio_rerio|715                ------AGTACACCCCCTGAGGCCTGGGACGAGTGCAACCTTGTGGACCGGTTAGATGAT
Ochotona_princeps|1056         CGCGACAGTGGTCCTGTAAAAGACTGGGACGATGCGCACCTAGGAGAGTGCTTGGAGCAG
Ornithorhynchus_anatinus|27395 CGC------GGGCCGCTGCAGGGCTGGGAGGAGGATCGCCTGCCGGAGCGCCTGGAGGAG
Monodelphis_domestica|25682    CGT---GGGGACCCTCTGCACTGTTGGGAAGAGGTCCGCTTGAGAGAGCGGCTGGAGGAG
Felis_catus|43153              CGTGAGGGGGCTCCGGTTCAAGGCTGGGACGAGGCACACCTGGGTGAGCGGTTGGAAGAA
Cavia_porcellus|15737          CATGAGGGGACTTCGGGGCAAGGCTGGGATGAGGCACACTTGAGTGAATGCTTGGAGGAG
Rattus_norvegicus|3004         AATGAGGGGGGCCCAACACCTAGCTGGGACGAGGCATACCTGAGTGAGTGCTTGGAGAAG
Canis_familiaris|24098         CGTGAGGGGGCTCCGGGTCAAGGCTGGGACGAGGCACACCTGTGCGAGCGGTTGGGAGAA
Myotis_lucifugus|15553         TGCGAGAGGGCGCCCGAGCAAGGCTGGGATGAGGCTCACCTG------------------
Tarsius_syrichta|9904          CGCAAGGGGTCCCTTGCACAAAGCTGGGATGAGACGCACCTAAACGAGTGTTTAGAGGAG
Callithrix_jacchus|54056       CGCAAGGGGGCCCCTGGACAAAGCTGGGATGAGGAGCATCTGGGAAAGTGTTTGGAGGAG
Rhesus_macaque|24571           CGCAAGGGGGCCCCTGGGCAAGGCTGGGATGAGGAGCACCTGGGGAAGTGTTTGGAGGAG
Gorilla_gorilla|4978           CGCAAGGGGGCCCCTGGGCAAGGCTGGGACGAGGAGCACCTGGGAAGGTGTTTGGAGGAG
Homo_sapiens|31007             CGCAAGGGGGCCCCTGGGCAAGGCTGGGACGAGGAGCACCTGGGAAGGTGTTTGGAGGAG
Pan_troglodytes|14038          CGCAAGGGGGCCCCTGGGCAAGGCTGGGACGAGGAGCACCTGGGAAGGTGTTTGGAGGAG
Pongo_abelii|10380             CGCAAGGGGGCCCCTGGGCAAGGCTGGGACGAGGAGCACCTGGGAAAGTGTTTGGAGGAG
Choloepus_hoffmanni|5843       CGTGATGGAGCCCCTGCGCAGGGATGGGATGAGACACGCCTGGGCGAGCGCTTGGAGGAG
Procavia_capensis|5693         CGCGAGGGGGCCTCAGCTCAGGTCTGGGATGAGGTACACCTGGGCGAACGCTTGGAGGAG
                                                  .    ***** **     .  *                   

Danio_rerio|715                CTTCTCCGCAGTCTAAGGGACAGCCTACAGTCTCGGGCTCTC---------TGCCATTTA
Ochotona_princeps|1056         TTGATTCAGTTCCTGAGAGGCTGCCTGCTGCGACGCCACACGCTGTTCCACTGCGTCCTG
Ornithorhynchus_anatinus|27395 CTGGTGCTGCACCTCAGGGACTGCCTGCTGCGACGCCGCCCGCTCCTGCACTGCCTCCTG
Monodelphis_domestica|25682    TTGGTGCTCTACCTTCGGGACTGCTTGCTCCGCCACCGCCCACTTTTCCATTGTCTTCTG
Felis_catus|43153              TTAGTGCAGTTCCTTAGGGACTGCCTGCTGCGACGCCATACGCTCTTCCACTGCGTCCTG
Cavia_porcellus|15737          CTGGTGCAGTTCCTTAAGGCCTGCCTGCTGGGACGCCAGACGCTCTTCCATTGCATCTTG
Rattus_norvegicus|3004         TTGGTGAAGTTCCTTAGGGACTGCCTGCTGCGACGCCGAGACCTCTTCCATTGTGTCCTA
Canis_familiaris|24098         TTAGTACAGTTCCTCCGGGACTGCCTGCTGCGGCGCCACACGCTCTTCCACTGCGTCCTG
Myotis_lucifugus|15553         ------------------------------------------------------------
Tarsius_syrichta|9904          CTGGTGCAGTACCTTACGGACTGCCTGCTGCGACGCTACAGGCTCTTCCACTGCGTCCTG
Callithrix_jacchus|54056       TTGGTGCAGTTCCTTAGGGACTGCCTGCTGCGACGCCATACGCTCTTCCACTGTGTCCTG
Rhesus_macaque|24571           TTGGTGCAGTTCCTTAGGGACTGCCTGCTGCGACGCCATACGCTCTTCCACTGTGTCCTG
Gorilla_gorilla|4978           TTGGTGCAGTTCCTTAGGGACTGCCTGCTGCGACGCCATACGCTCTTCCACTGCGTCCTG
Homo_sapiens|31007             TTGGTGCAGTTCCTTAGGGACTGCCTGCTGCGACGCCATACGCTCTTCCACTGCGTCCTG
Pan_troglodytes|14038          TTGGTGCAGTTCCTTAGGGACTGCCTGCTGCGACGCCATACGCTCTTCCACTGCGTCCTG
Pongo_abelii|10380             TTGGTGCAGTTCCTTAGGGACTGCCTGCTGCGACGCCATACGCTCTTCCACTGCGTCCTG
Choloepus_hoffmanni|5843       TTGGTGCAGTTCCTTAGGGACTGCCTGCTGCGACGCCGTGTGCTTTTCCACTGCGTCCTG
Procavia_capensis|5693         TTGGTGCAGTTCCTTAGGGACTGCCTGCTGCAACGCCGGGCGCTTTTCCACTGCGTCCTT
                                                                                           

Danio_rerio|715                CTCCTCGGAGGTGTTAATGGCCTTTTGCCAGACTCTGTTGCTCTGCCCAAGCTTGTTAAG
Ochotona_princeps|1056         GGCCCTGGAGGCACGGCCGCC---------GAGGTGGGTCCCTTGCCAAAGGTGCTGCGC
Ornithorhynchus_anatinus|27395 GGCGCCGGGGTCGCCGGGGTC---------GAGGCCCTGTCCCTGCCCCAGCTGCTCCGC
Monodelphis_domestica|25682    GGCCCAGACAGGGCTGTGGGACTCACCCTCGAAATGGGCCAGTTGCCCAAAGTTTTGCGT
Felis_catus|43153              GGCCCTGGTGGGGCCGCTGCC---------GAGGTGGGCCCACTGCCCAAGGTTCTGCGT
Cavia_porcellus|15737          GGGCCTGGTAGGGCGGCTGCC---------GAAGTGGGCCCTCTGCCCAAGGTACTTCGA
Rattus_norvegicus|3004         GGTCCGGCTGGGGCAGCTGCC---------GAAGTTGGACCCCTGCCCAAGGTGCTGCGT
Canis_familiaris|24098         GGCCCTGGAGGGGCAGCTGCC---------GAGGTCGGCCCGCTGCCCAAGGTGCTGCGG
Myotis_lucifugus|15553         ------------------------------------------------------------
Tarsius_syrichta|9904          GGT---------------------------------------------------------
Callithrix_jacchus|54056       GGCCCTGGGGGGGCGGCCGCC---------GAGGTGGGCCCCCTGCCCAAGGTACTACGG
Rhesus_macaque|24571           GGCCCTGGTGGGGCGGCTGCT---------GAGGTGGGTCCCCTGCCCAAGGCACTGCGG
Gorilla_gorilla|4978           GGCCCTGGTGGGGCGGCTGCC---------GAGGTGGGTCCCCTGCCCAAGGCACTGAGG
Homo_sapiens|31007             GGCCCTGGTGGGGCGGCTGCC---------GAGGTGGGTCCCCTGCCCAAGGCACTGAGG
Pan_troglodytes|14038          GGCCCTGGTGGGGCGGCTGCC---------GAGGTGGGTCCCCTGCCCAAGGCACTGAGG
Pongo_abelii|10380             GGCCCTGGTGGGGCGGCTGCC---------GAGGTGGGTCCTCTGCCCAAGGCACTGAGG
Choloepus_hoffmanni|5843       GGCCCTGGTGGGGCGGCTGCC---------GAGGTGGGCCCCCTGCCCAAGGTACTGCGC
Procavia_capensis|5693         GGTCCTGGTGGGGCGGCAGCC---------GAGGTGGGCCCACTGCCCAAGGTGCTGCGT
                                                                                           

Danio_rerio|715                GAGATGGTACCCTCAAACCTGTGGGCAGAATTCAGTGACGTCACCCTCGATATGGTCTCC
Ochotona_princeps|1056         GAAGCCGCCCCTGTGGACCTCCTGGCAGCCTTCGACAGTCACACCCGGGAGCTGACCGCA
Ornithorhynchus_anatinus|27395 GAGGCGCCCCCGGTCGACCTGCTGGCCGGCTTCGACGGGCGCTGCCGGGAGCGGGTGGCC
Monodelphis_domestica|25682    GAAGCCGCCCCAGTTGACCTATTGGCCTCCTTCGACGGGCGCACCCGGGAGTTCGTGGCT
Felis_catus|43153              GAAGCTGCCCCGGTTGACCTCCTGGCCGCGTTCGACAGACATGCCCGGGAACTCGCGGCT
Cavia_porcellus|15737          GAAGCTGCCCCAGTGGACCTCCTGGCCGCTTTCGACATGCATGCCCGAGAGCAAGCAGCA
Rattus_norvegicus|3004         GAGGCCCCTCCAGTTGACCTCCTGGCACCCTTCGACCAGCATGCCCGGGAGCTTGCAGCA
Canis_familiaris|24098         GAAGCTGCCCCAGTCGACCTCCTGGCAGCGTTCGACAGGCACGCCCGGGAACTTGCGGCG
Myotis_lucifugus|15553         ------------------------------------------------------------
Tarsius_syrichta|9904          ------------------------------------------------------------
Callithrix_jacchus|54056       GAAGCCGCTCCAGTTGACCTCCTGGCCGCTTTCGACGGGCACGCCCGGGAACTTGCAGCA
Rhesus_macaque|24571           GAAGCCGCCCCAGTTGACCTCCTGGCCGCTTTCGACGGGCAGGCCCGGGAACTTGCAGCG
Gorilla_gorilla|4978           GAAGCCGCCCCAGTTGACCTCCTGGCCGCTTTCGACGGGCACGCCCGGGAACTTGCAGCA
Homo_sapiens|31007             GAAGCCGCCCCAGTTGACCTCCTGGCCGCTTTCGACGGGCACGCCCGGGAACTTGCAGCA
Pan_troglodytes|14038          GAAGCCGCCCCAGTTGACCTCCTGGCCGCTTTCGACGGGCACGCCCGGGAACTTGCAGCA
Pongo_abelii|10380             GAAGCCGCCCCAGTTGACCTCCTGGCCGCTTTCGATGGGCACGCCCGGGAACTTGCAGCA
Choloepus_hoffmanni|5843       GAAGCTGCACCGGTGGACCTCCTGGCCGCTTTCGATGGGCGTGCCCGGGAACTCGTGGCA
Procavia_capensis|5693         GAAGCCGCCCCAGTTGATCTCTTGGCGGCTTTCGACCAGCGCGCCCGGGAACTGGCAGCG
                                                                                           

Danio_rerio|715                GCCCGACTGACCTACTCCTGGAACCACCTCCCTCGCCTTATTCGCCTC------------
Ochotona_princeps|1056         GCACGCTTGCTGTCCACGTGGCGAAGGTTGCCCCAGCTTCTCCGGGCCTACGGGGGTCCC
Ornithorhynchus_anatinus|27395 GCCCGGCTGCTGCGCACGTGGCTCCACCTGCCGGAGCTCCTCGCCGCCTACGGAGGCCCC
Monodelphis_domestica|25682    GCTCGTCTGGTGTCCACGTGGCGCCGGTTACCCCAACTTCTCCGAGCCTACGGGGGACCC
Felis_catus|43153              GCGAGGTTGCTGTCCACGTGGCGAAGGCTGCCCCAGCTTCTCCGGGTCTATGGGGGTCCT
Cavia_porcellus|15737          GTGAGATTGCTGTCCACTTGGCGAAGCCTGCCCCAGCTTCTCCGGGCTTATGGGGGTCCC
Rattus_norvegicus|3004         GCGCGGTTACTGTCCACCTGGCGAAGGTTGCCCCAGCTTCTCCAGGTCTATGGTGGTCCC
Canis_familiaris|24098         GCGCGATTGCTGTCCACATGGCGAAGGCTGCCCCAGCTTCTCCGGGTCTACGGGGGTCCT
Myotis_lucifugus|15553         ------------------------------------------------------------
Tarsius_syrichta|9904          ------------------------------------------------------------
Callithrix_jacchus|54056       GCGCGGTTACTGTCCACGTGGCAAAGGCTGCCCCAGCTTCTCCGGGCCTACGGGGGTCCC
Rhesus_macaque|24571           GCGCGTTTGCTGTCCACGTGGCAAAGGCTGCCCCAGCTTCTCCGGGCCTACGGGGGTCCC
Gorilla_gorilla|4978           GCGCGGTTGCTGTCCACGTGGCAAAGGCTGCCCCAGCTTCTCCGGGCCTACGGGGGTCCC
Homo_sapiens|31007             GCGCGGTTGCTGTCCACGTGGCAAAGGCTGCCCCAGCTTCTCCGGGCCTACGGGGGTCCC
Pan_troglodytes|14038          GCGCGGTTGCTGTCCACGTGGCAAAGGCTGCCCCAGCTTCTCCGGGCCTACGGGGGTCCC
Pongo_abelii|10380             GCGCGGTTGCTGTCCACGTGGCAAAGGCTGCCCCAGCTTCTCCGGGCCTACGGGGGTCCC
Choloepus_hoffmanni|5843       GCGCGTTTGTTATCCACCTGGCGAAGGCTTCCCCGGCTTCTCCGGGCCTACGGGGGTCCC
Procavia_capensis|5693         GCGCGGCTGCTGTCCACGTGGCGAAGGCTGCCCCAGCTTCTCCGGGTCTACGGGGGTCCC
                                                                                           

Danio_rerio|715                ------------------------------------------------------------
Ochotona_princeps|1056         CGCTACCTTGCCAGGTGCCCTCCACCCCGGAGTCAGCGTACCCTGGGGTTCCCGGAA---
Ornithorhynchus_anatinus|27395 CGCTACCTGCCCCTGGGACCTGCCGCCCGCTTAGGGAGGAGGCAGGGGAGCGGCGAAAGG
Monodelphis_domestica|25682    CGATACCTGGCGAGGTGCCCCCAGCCCCGGAGCCCGAGGGCCCAAGGTTTCCCGGAG---
Felis_catus|43153              CGCTACCTTGCCAGGTGCCCCCCACCCCGGAGTCAGCGCACCCAGGGCTTCCCTGAA---
Cavia_porcellus|15737          CGCTACCTTGCCAGATGCCCCCACCCTGGAGTCAGCGCACTTAAGGGTCCCCTGAAC---
Rattus_norvegicus|3004         CGTTACCTTGCCAGGTGTCCTGCACCCCGGAGTCAACGCATCCAGGGCTTCCCGGAA---
Canis_familiaris|24098         CGCTACCTGGACATGTGCCCTCAACCCGGGAGTCAGCGCACGCAGGGGTTCCCTGAA---
Myotis_lucifugus|15553         ------------------------------------------------------------
Tarsius_syrichta|9904          ------------------------------------------------------------
Callithrix_jacchus|54056       CGCTACCTTGCCAGGTGCCCCCCACCCCGGAGTCAGCGCACCCAGGGCTTCCTTGAA---
Rhesus_macaque|24571           CGCTACCTTGCCAGGTGTCCCCCGCCCCGGAGTCAGCGCACCCAGGGCTTCCTTGAA---
Gorilla_gorilla|4978           CGCTACCTTGCCAGGTGCCCCCCACCCCGGAGTCAGCGCACCCAGGGCTTCCTTGAA---
Homo_sapiens|31007             CGCTACCTTGCCAGGTGCCCCCCACCCCGGAGTCAGCGCACCCAGGGCTTCCTTGAA---
Pan_troglodytes|14038          CGCTACCTTGCCAGGTGCCCCCCACCCCGGAGTCAGCGCACCCAGGGCTTCCTTGAA---
Pongo_abelii|10380             CGCTACCTTGCCAGGTGCCCCCCACCCCGGAGTCAGCGCACCCAGGGCTTCCTTGAA---
Choloepus_hoffmanni|5843       CGCTACCTTGCCAGGTGCTCTCCACCTCGGAGTCAGCGTGCCCAGGGTTTCCCTGAA---
Procavia_capensis|5693         CGCTACCTTGTCAGGTGCCCTCCACCTCGGAGTCAGCGCACCCAGGGATGCCCTGAA---
                                                                                           

Danio_rerio|715                ------------
Ochotona_princeps|1056         GGTGAACCCTAA
Ornithorhynchus_anatinus|27395 CCTCAACCC---
Monodelphis_domestica|25682    CACGATCCCTAA
Felis_catus|43153              GATGAACCATAA
Cavia_porcellus|15737          ATGAATCAT---
Rattus_norvegicus|3004         GATGAACCATGA
Canis_familiaris|24098         GATCAGCCC---
Myotis_lucifugus|15553         ------------
Tarsius_syrichta|9904          ------------
Callithrix_jacchus|54056       GGTGAACCGTAA
Rhesus_macaque|24571           GGTGAACCGTAA
Gorilla_gorilla|4978           GGTGAACCGTAA
Homo_sapiens|31007             GGTGAACCGTAA
Pan_troglodytes|14038          GGTGAACCGTAA
Pongo_abelii|10380             GGTGACCCATAA
Choloepus_hoffmanni|5843       GATGAACCATAA
Procavia_capensis|5693         GATGAACCGTAA
                                           

multiple sequence alignment in CLUSTALW format


Danio_rerio|27774              MSV-YTLNLRFFWPLVTCILTALLLLHQYIFRGLEDQGSDCADQGPGVVTLFKYILAFIL
Ochotona_princeps|916          MSVHYTLNLRVFWPLVTGLCTALVCLY-HVLRGSGEAPAEPPDGAASGFPLLKAIVLLLL
Ornithorhynchus_anatinus|23532 ------------------------------------------------FPVFKAALLLLL
Monodelphis_domestica|5706     MSVHYTLNLRVFWPLVTGFCTALVCLY-HVLSGRGGP-AASQDTEDTGFPLLKAIFLLLL
Felis_catus|9093               MSVHYTLNLHVLWPLVTGLCTALVCLY-HVLRGSGDDRAEPPDGADGGFPLLKVAVLLLL
Cavia_porcellus|12368          MSVHYTLNLRVFWPLVTGLCTALVCLY-HVLRGDGATKTESPDGADGGFSLLKVVILLLL
Rattus_norvegicus|30106        MSVRYTLNLRVFWPLVTGLCTALVCLY-HALRSSEGARAEPPDGADSGFPLLKVAILLLL
Canis_familiaris|15250         MSVHYTLNLRVFWPLVTGLCTALVCLY-HALRGSGGARAQPPDGADGGFPLLKVAVLLLL
Myotis_lucifugus|13980         MSVHYTLNLRVFWPLVTGLCTAFVCLY-HVLRGSGGARAEPPDGADGGFPLLKISVLLLL
Tarsius_syrichta|9077          ------------------------------------------------------------
Callithrix_jacchus|45007       MSVHYTLNLRVFWPLVTGLCTALVCLY-HVLWGSWGARAEPPDGVDGGFPLLKVAVLLLL
Rhesus_macaque|31778           MSVHYTLNLRVFWPLVTGLCTALVCLY-HVLRGSGGARAEPPDGVDGGFPLLKVAVLLLL
Gorilla_gorilla|4724           MSVHYTLNLRVFWPLVTGLCTALVCLY-HVLRGSGGARAEPADGVDGGFPLLKVAVLLLL
Homo_sapiens|16937             MSVHYTLNLRVFWPLVTGLCTALVCLY-HVLRGSGGARAEPADGVDGGFPLLKVAVLLLL
Pan_troglodytes|33285          MSVHYTLNLRVFWPLVTGLCTALVCLY-HVLRGSGGARAEPADGVDGGFPLLKVAVLLLL
Pongo_abelii|7671              MSVHYTLNIRILWPLVTGLCTALVCLY-HVLRGSGGARAEPADGVDGGFPLLKVAVLLLL
Choloepus_hoffmanni|5159       ------------------------------------------------------------
Procavia_capensis|5342         ------------------------------------------------------------
                                                                                           

Danio_rerio|27774              CYFFIRYCSG-----QPGSVRRGFHKVLEVHGKSGVSKRELLDDHYERHVRLSPHVLGHS
Ochotona_princeps|916          GYVLLRCRHAVRQRFLPGASRVGGHSTFSPRPFEEPGLGVLLGSYYEHEVRLSPHVLGHS
Ornithorhynchus_anatinus|23532 GYLVLRCRHAARQR-----------------------LRVLLESFYEHEVRLSPHVLGHS
Monodelphis_domestica|5706     GYLLLRFRHAARQRFLRRAPHQG-LATSSKRLLREPGLDVLLESYYEHEVRLSPHVLGHS
Felis_catus|9093               GYILLRCRHAVRQRFLPGSPRLGRHSTFSPRHFREPSQGILLESYYEHEVRLSPHVLGHS
Cavia_porcellus|12368          GYVLLRCRHAVRQRFLPVSSRVVGHSAFSPRNVSEPGLSILLESYYEHEVRLSPHVLGHS
Rattus_norvegicus|30106        CYILLRCRHTIRQRLLPGSSRPCGHANFSARSLQEPGLSILLESYYEHEVRLSPHVLGHS
Canis_familiaris|15250         GYVLLRCRHAVRQRFLPGAPRLGSHSTFSPRHFREPSLGILLESYYEHEVRLSPHVLGHS
Myotis_lucifugus|13980         GYILLRCRHAVRQRFLPGSPRLGGHSTFSPRHFQEPSLDILLESYYEHEVRLSPHVLGHS
Tarsius_syrichta|9077          -----------RQRFLPGASRLGGHSAFSRRHLPEPGLSILLESYYEHEVRLSPHVLGHS
Callithrix_jacchus|45007       SYVLLRCRHAVRQRFLPGSPRLGGHAAFS-RHFREPGLSILLESYYEHEVRLSPHVLGHS
Rhesus_macaque|31778           SYVLLRCRHAVRQRFLPGSPRLGSHAAFSSRHFREPGLSILLESYYEHEVRLSPHVLGHS
Gorilla_gorilla|4724           SYVLLRCRHAVRQRFLPGSPRLEGHAAFSSRHFREPGLSILLESYYEHEVRLSPHVLGHS
Homo_sapiens|16937             SYVLLRCRHAVRQRFLPGSPRLEGHAAFSSRHFREPGLSILLESYYEHEVRLSPHVLGHS
Pan_troglodytes|33285          SYVLLRCRHAVRQRFLPGSPRLEGHAAFSSRHFREPGLSILLESYYEHEVRLSPHVLGHS
Pongo_abelii|7671              SYVLLRCRHAVRQRFLPGSPRLEGHAAFSSRHFREPGLSILLESYYEHEVRLSPHVLGHS
Choloepus_hoffmanni|5159       ------------------------------------------------------------
Procavia_capensis|5342         ----------VRQRFLPRAPCLGSHSALSPKPFGEPGLGILLESYYEHEVRLSPHVLGHS
                                                                                           

Danio_rerio|27774              KAHVAKLVSELVRVGRTDVPPES------SLAFRGDFIQIGSSYEEHKVGSPDCFDILVP
Ochotona_princeps|916          KAHVSRIVGELVQAGRVQGSPGTIPRGALALAFRGDFIQVGSAYEQHKIRRPDSFDVLVP
Ornithorhynchus_anatinus|23532 KAHVSRIVGELVRAGRAQGPQD--PQGRLALAFRGDFVRVGSAYERHKIGRPDAFDVLVP
Monodelphis_domestica|5706     KAHVSRIVGELVRAGRARGSPGPSPGGALALAFRGDFVQVGSAYEQHKIRRPDGFDVLVP
Felis_catus|9093               KAHVSRIVGELVRAGRARGSPGPIPGGALALAFRGDFIQVGSAYEQHKIRRPDGFDVLVP
Cavia_porcellus|12368          KAHVSRIVGELVRAGRIRGTPCPISGGTLALAFRGDFIQVGSAYEQHKIRRPDSFDVLVP
Rattus_norvegicus|30106        KAHVSRIVGELVQAGRARGSPGPITGGALALAFRGDFIQVGSAYEQHKIRRPDSFDVLVP
Canis_familiaris|15250         KAHVSRIVGELVRAGRARGSPGPIPGGALALAFRGDFIQVGSAYEQHKIRRPDGFDVLVP
Myotis_lucifugus|13980         KAHVSRIVGELVRAGRAQGSPGLIPGGTLALAFRGDFIQVGSAYEQHKIRRPDAFDVLVP
Tarsius_syrichta|9077          KAHVSRIVGELVRAGRARGSPGPIPGGALALAFRGDFIQVGSAYEQHKIRRPDGFDVLVP
Callithrix_jacchus|45007       KAHVSQIVGELVRAGRSRGSPGLIPGGALALAFRGDFIQVGSAYEQHKIRRPDSFDVLVP
Rhesus_macaque|31778           KAHVSRIVGELVRAGRARGSPGLIPGGALALAFRGDFIQVGSAYEQHKIRRPDSFDVLVP
Gorilla_gorilla|4724           KAHVSRIVGELVRAGRARGSPGLIPGGALALAFRGDFIQVGSAYEQHKIRRPDSFDVLVP
Homo_sapiens|16937             KAHVSRIVGELVRAGRARGSPGLIPGGALALAFRGDFIQVGSAYEQHKIRRPDSFDVLVP
Pan_troglodytes|33285          KAHVSRIVGELVRAGRARGSPGLIPGGALALAFRGDFIQVGSAYEQHKIRRPDSFDVLVP
Pongo_abelii|7671              KAHVSRIVGELVRAGRARGSPGLIPGGALALAFRGDFIQVGSAYEQHKIRRPDSFDVLVP
Choloepus_hoffmanni|5159       ------------------------------------------------------------
Procavia_capensis|5342         KAHVSRIVGELVRAGRARTSPGPIPAGPLALAFRGDFIQVGSAYEQHKIRRPDGFDVLVP
                                                                                           

Danio_rerio|27774              LRAPRGLKLETSACTDKHGGPP------LCTLNT-PR------KAEWTRRHKAFTDTFMH
Ochotona_princeps|916          LRLPPLVALEPRSL--EVPLAASFRRTLLDDLYS-SPXXXXXXXXXXXXXXXXXXXXXXX
Ornithorhynchus_anatinus|23532 LRLPPLVAL----------------ACFVCALRA-PR----AAGGQWARDCKPFADQFCA
Monodelphis_domestica|5706     LRLPPLVALEPRGLGAEPELPLALRGCFLCALKASPSSPSGGVGSQWQRDSKPFSDGFCV
Felis_catus|9093               LRLPPLVALEPRSLGAEPALAPAFHGCFVCALKA-PP---GASGGHWLRDCKPFADGFCV
Cavia_porcellus|12368          LRLPPLVALEPRSLGAEPTLAPAFRNCFVCALKA-PPSPSGTSGGHWLRNCKPFTDSFCV
Rattus_norvegicus|30106        LRLPPQVALEPRSLGTEPALTPAFRSCFVCTLKA-PPSPSGTSTGQWHRDCKPFAEGFCV
Canis_familiaris|15250         LRLPPPVALEPRSLGAEAALAPAFLGCFVCALKA-PP---GAPASRWLRDCRPFADGFCV
Myotis_lucifugus|13980         LRLPPLVALEPRSLGAQPALAPAFHGCFVCALKA-PP---GASGGHWLRDCKPFAEGFCV
Tarsius_syrichta|9077          LRLPPMVALEPRSLGAEPALAPAFRACFVCALKA-PPSPSGASGGHWLRDCKPFADGFCV
Callithrix_jacchus|45007       LRLPPLVALDPRSLGEELALAPAFRSCFVCALKA-PPSPSGASGGHWLRDCKPFADGFCV
Rhesus_macaque|31778           LRLPPLVALEPRSLGEEPVLAPAFRGCFVCALKA-PPSPLGASGGHWLRDCKPFADAFCV
Gorilla_gorilla|4724           LRLPPLVALEPRSLGEEPALAPAFRGCFLCALKA-PPSPSGASGGHWLRDCKPFADAFCV
Homo_sapiens|16937             LRLPPLVALEPRSLGEEPALAPAFRGCFLCALKA-PPSPSGASGGHWLRDCKPFADAFCV
Pan_troglodytes|33285          LRLPPLVALEPRSLGEEPALAPAFRGCFLCALKA-PPSPSGASGGHWLRDCKPFADAFCV
Pongo_abelii|7671              LRLPPLVALEPRSLGEEPALAPAFRGCFLCALKA-PPSPSGASGGHWLRDCKPFADAFCV
Choloepus_hoffmanni|5159       ------------------------------------------------------------
Procavia_capensis|5342         LRLPPLVALEPRSLGAEPVLAPAFRGCFLCALKA-PPAPSGAPSGNWLRDCKPFADGFCV
                                                                                           

Danio_rerio|27774              SSQNVYKMSPDSVQRWFYTATQRCLAAVRYPFDQRCSLSLSLS--EEQQVLLRMTPRSDY
Ochotona_princeps|916          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Ornithorhynchus_anatinus|23532 DLRGRPHLSSGLVLRWFQARLQRCLGTVRYRLEERCRVSLAPGGQDRPPTLHVLPRRTDY
Monodelphis_domestica|5706     DLRGRRHLSAALVSRWFQAHLQRCLATVRYSLEERCRVSLSPGGLDQPPTLHILPCRTDY
Felis_catus|9093               DVLGRRHLSATMVLRWFQSHLQRSLATVRYSLEGRCRVSLTPGGLEQPLTLLILPCHXXX
Cavia_porcellus|12368          DVRGQRHLSATLVLRWFQSHLQRSLATVRYKLEECCRVSLTSGGLEQPPILHILPCRTDY
Rattus_norvegicus|30106        DVQGRRHLSATLVLRWFQAHLQRSLATVRYSLEGRCRVSLTPGGLEQPPTLHILPCRTDY
Canis_familiaris|15250         DVLGRRHLSASLVLRWFQAHLQRSLATVRYSLEGRCRVSLTPGGLEQPPTLHILPCRTDY
Myotis_lucifugus|13980         DVRGRRHLSATLVLRWFQSHLQRSLATVRYSLEERCRVTLTPRGLEQPPTLHILPCRTDY
Tarsius_syrichta|9077          DVHGRRHLSAALVLRWFQSHLQRSLATVRYSLEGRCRVTLTPGGLEQSPTLHILPCRTDY
Callithrix_jacchus|45007       DVRGRRHLSAALVLRWFQSHLQRSLATVRYSLEGRCRVTLTPGGLEQPPTLHILPCRTDY
Rhesus_macaque|31778           DVRGRRHLSATLVLRWFQSHLQRSLATVRYSLEGRCRVTLTPGGLEQPPTLHILPCRTDY
Gorilla_gorilla|4724           DVRGRRHLSATLVLRWFQSHLQRSLATVRYSLEGRCRVTLTPGGLEQPPTLHILPCRTDY
Homo_sapiens|16937             DVRGRRHLSATLVLRWFQSHLQRSLATVRYSLEGRCRVTLTPGGLEQPPTLHILPCRTDY
Pan_troglodytes|33285          DVRGRRHLSATLVLRWFQSHLQRSLATVRYSLEGRCRVTLTPGGLEQPPTLHILPCRTDY
Pongo_abelii|7671              DVRGRRHLSATLVLRWFQSHLQRSLATVRYSLEGRCRVTLTPGGLEQPPTLHILPCRTDY
Choloepus_hoffmanni|5159       -------LSTTLIMRWFQSHLQRSLATVRYSLEGRCRVSLTPSDLEQPPVLHILPCRTDY
Procavia_capensis|5342         DVRGRRHLSATLVLRWFQSHLQRSLATVRYSLEGRCRVSLTPGGLEQPPTLHILPCRTDY
                                                                                           

Danio_rerio|27774              VCCHISMGIRLIPAFPLSDGGFLVASQ------------------QGKDLWTVYFPRQEQ
Ochotona_princeps|916          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXEQ
Ornithorhynchus_anatinus|23532 GCCRLSMAVRLIPAVHLGDGVFL------------------------EALWGVNTARHEQ
Monodelphis_domestica|5706     GCCRLSMAVRLIPAVHLGDGVFLVAPPLSPL----GLPSELPGGLRAEALWGLNTARQEQ
Felis_catus|9093               XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXELPGGLRTYALGGVNTSRQEQ
Cavia_porcellus|12368          GCCRLSMAVRLIPAVHLGDSVFLVAPPPPPSPV--GLFSELPGGLRSEALWGVNTARQEQ
Rattus_norvegicus|30106        GCCRLSMAVRLIPAVHLGEGVFLVAPPPPPSPS--GALSELPGGLRAEALWGVNTARQEQ
Canis_familiaris|15250         GCCRLSMAVRLIPAVHVGDGVFLVAPPPSPSPSLVGPLPELPGGLRTDALWGVNTARQEQ
Myotis_lucifugus|13980         GCCRLSMAVRLIPAIHLGDGVFLVAPPPPSSPV--GPLSELPEGLRADALWGVNTARQEQ
Tarsius_syrichta|9077          GCCRLSMAVRLIPAVHVGDGVFLVAPPPPPLPG--GPLSELPGGLRAEALWGVNTARQEQ
Callithrix_jacchus|45007       GCCRLSMAVRLIPAVHLGDGVFLVAPPPPPLSS--GLLLELPGGLRSEALWGVNTARQEQ
Rhesus_macaque|31778           GCCRLSMAVRLIPAVHLGDGVFLVAPPPPPLPS--APLLELPEGLRAEALWGVNTARQEQ
Gorilla_gorilla|4724           GCCRLSMAVRLIPAVHLGDGVFLVAPPPPPLPS--APLLELPEGLRAEALWGVNTARQEQ
Homo_sapiens|16937             GCCRLSMAVRLIPAVHLGDGVFLVAPPPPPLPS--APLLELPEGLRAEALWGVNTARQEQ
Pan_troglodytes|33285          GCCRLSMAVRLIPAVHLGDGVFLVAPPPPPLPS--APLLELPEGLRAEALWGVNTARQEQ
Pongo_abelii|7671              GCCRLSMAVRLIPAVHLGDGVFLVAPPPPPLPS--APLLELPEGLRAEALWGVNTARQEQ
Choloepus_hoffmanni|5159       GCCRLSMAVRLIPAVHLGEGVFLVAPPPPALPA--GTLSELPGGLRAEALWGVNTARQEL
Procavia_capensis|5342         GCCRLSMAVRLIPAVHLGDGVFLVAPPPPPTSA--GSLSELPGGLRPEALWGVNTARQEQ
                                                                                         * 

Danio_rerio|27774              RLLTCLKGRLPSNSCHLKCLQLLKEIRNLSGEVLDQQSGAEWGTVLSSYALKTAWIRLLL
Ochotona_princeps|916          KLLSWLQERAPPGACYLKCLQLLKAVRDLGARGLDPMAAAQWRRILSSYVLKTVLLAALL
Ornithorhynchus_anatinus|23532 RLLAWLQDRAPPQACHLKCLRLLKALRDLGARGLEAEAAARWGRVLSSFGLKMAWLALLL
Monodelphis_domestica|5706     RLLAWLQERAPPGACHLKCLQLLKALRDLGARGLDPVASSQWGRILSSYTLKTALLTLLL
Felis_catus|9093               KLMSWMQERSPPDASYIKCLQLIKALRDMGACGLDPADATQ-GRILSSYMLKTVLLAVLL
Cavia_porcellus|12368          KLLVWLQERAAPGACYLKCLQLLKALRDLGARGLDPMAATQWGQVLSSYVLKTVLLTVLL
Rattus_norvegicus|30106        KLLGWLQERAPPGACYLKCLQLLKALRDLGARGLDPMAATHWGRILSSYMLKTAVLEVLL
Canis_familiaris|15250         KLLSWLQERAPPGACYLKCLQLLKALRDLGARGLDPTAATQWGRILSSYVLKTALLAVLL
Myotis_lucifugus|13980         KLLGWLQERAPPGACYLKCLQLLKALRDLGARGLDPRAAAQWGRILSSYVLKTVLLAVLL
Tarsius_syrichta|9077          KLLGWLQERAPPGACYLKCLQLLKALRDLGARGLDSAAATQWGRILSSYVLKTALLAVLL
Callithrix_jacchus|45007       KLLSWLQERAAPGACYLKCLQLLKALRDLGARGLDSAAATQWGRILSSYVLKTVLLAVLL
Rhesus_macaque|31778           KLLSWLQERAAPGACYLKCLQLLKALRDLGARGLDSAAATQWGRILSSYVLKTVLLAVLL
Gorilla_gorilla|4724           KLLSWLQERAAPGACYLKCLQLLKALRDLGARGLDSAAATQWGRILSSYVLKTVLLAVLL
Homo_sapiens|16937             KLLSWLQERAAPGACYLKCLQLLKALRDLGARGLDSAAATQWGRILSSYVLKTVLLAVLL
Pan_troglodytes|33285          KLLSWLQERAAPGACYLKCLQLLKALRDLGARGLDSAAATQWGRILSSYVLKTVLLAVLL
Pongo_abelii|7671              KLLSWLQERAAPGACYLKCLQLLKALRDLGARGLDSAAATQWGRILSSYVLKTVLLAVLL
Choloepus_hoffmanni|5159       KLLSWLQERAPPGACYLKCLQLLKALRDLGARGLDPTAATQWGRILSSYVLKSALLAVLL
Procavia_capensis|5342         KLLSTLQERASPGACYLKCLQLLKAIRDLGARGLDPTAATQWGRILSSYVLKTALLAVLL
                               :*:  :: * .. :.::***:*:* :*::..  *:   .:.   :***: ** . :  **

Danio_rerio|27774              --STPPEAWDECNLVDRLDDLLRSLRDSLQSRAL---CHLLLGGVNGLLPDSVALPKLVK
Ochotona_princeps|916          RDSGPVKDWDDAHLGECLEQLIQFLRGCLLRRHTLFHCVLGPGGTAA---EVGPLPKVLR
Ornithorhynchus_anatinus|23532 R--GPLQGWEEDRLPERLEELVLHLRDCLLRRRPLLHCLLGAGVAGV---EALSLPQLLR
Monodelphis_domestica|5706     R-GDPLHCWEEVRLRERLEELVLYLRDCLLRHRPLFHCLLGPDRAVGLTLEMGQLPKVLR
Felis_catus|9093               REGAPVQGWDEAHLGERLEELVQFLRDCLLRRHTLFHCVLGPGGAAA---EVGPLPKVLR
Cavia_porcellus|12368          HEGTSGQGWDEAHLSECLEELVQFLKACLLGRQTLFHCILGPGRAAA---EVGPLPKVLR
Rattus_norvegicus|30106        NEGGPTPSWDEAYLSECLEKLVKFLRDCLLRRRDLFHCVLGPAGAAA---EVGPLPKVLR
Canis_familiaris|15250         REGAPGQGWDEAHLCERLGELVQFLRDCLLRRHTLFHCVLGPGGAAA---EVGPLPKVLR
Myotis_lucifugus|13980         CERAPEQGWDEAHL----------------------------------------------
Tarsius_syrichta|9077          RKGSLAQSWDETHLNECLEELVQYLTDCLLRRYRLFHCVLG-------------------
Callithrix_jacchus|45007       RKGAPGQSWDEEHLGKCLEELVQFLRDCLLRRHTLFHCVLGPGGAAA---EVGPLPKVLR
Rhesus_macaque|31778           RKGAPGQGWDEEHLGKCLEELVQFLRDCLLRRHTLFHCVLGPGGAAA---EVGPLPKALR
Gorilla_gorilla|4724           RKGAPGQGWDEEHLGRCLEELVQFLRDCLLRRHTLFHCVLGPGGAAA---EVGPLPKALR
Homo_sapiens|16937             RKGAPGQGWDEEHLGRCLEELVQFLRDCLLRRHTLFHCVLGPGGAAA---EVGPLPKALR
Pan_troglodytes|33285          RKGAPGQGWDEEHLGRCLEELVQFLRDCLLRRHTLFHCVLGPGGAAA---EVGPLPKALR
Pongo_abelii|7671              RKGAPGQGWDEEHLGKCLEELVQFLRDCLLRRHTLFHCVLGPGGAAA---EVGPLPKALR
Choloepus_hoffmanni|5159       RDGAPAQGWDETRLGERLEELVQFLRDCLLRRRVLFHCVLGPGGAAA---EVGPLPKVLR
Procavia_capensis|5342         REGASAQVWDEVHLGERLEELVQFLRDCLLQRRALFHCVLGPGGAAA---EVGPLPKVLR
                                       *::  *                                              

Danio_rerio|27774              EMVPSNLWAEFSDVTLDMVSARLTYSWNHLPRLIRL------------------------
Ochotona_princeps|916          EAAPVDLLAAFDSHTRELTAARLLSTWRRLPQLLRAYGGPRYLARCPPPRSQRTLGFPE-
Ornithorhynchus_anatinus|23532 EAPPVDLLAGFDGRCRERVAARLLRTWLHLPELLAAYGGPRYLPLGPAARLGRRQGSGER
Monodelphis_domestica|5706     EAAPVDLLASFDGRTREFVAARLVSTWRRLPQLLRAYGGPRYLARCPQPRSPRAQGFPE-
Felis_catus|9093               EAAPVDLLAAFDRHARELAAARLLSTWRRLPQLLRVYGGPRYLARCPPPRSQRTQGFPE-
Cavia_porcellus|12368          EAAPVDLLAAFDMHAREQAAVRLLSTWRSLPQLLRAYGGPRYLARCPHPGVSALKGPLN-
Rattus_norvegicus|30106        EAPPVDLLAPFDQHARELAAARLLSTWRRLPQLLQVYGGPRYLARCPAPRSQRIQGFPE-
Canis_familiaris|15250         EAAPVDLLAAFDRHARELAAARLLSTWRRLPQLLRVYGGPRYLDMCPQPGSQRTQGFPE-
Myotis_lucifugus|13980         ------------------------------------------------------------
Tarsius_syrichta|9077          ------------------------------------------------------------
Callithrix_jacchus|45007       EAAPVDLLAAFDGHARELAAARLLSTWQRLPQLLRAYGGPRYLARCPPPRSQRTQGFLE-
Rhesus_macaque|31778           EAAPVDLLAAFDGQARELAAARLLSTWQRLPQLLRAYGGPRYLARCPPPRSQRTQGFLE-
Gorilla_gorilla|4724           EAAPVDLLAAFDGHARELAAARLLSTWQRLPQLLRAYGGPRYLARCPPPRSQRTQGFLE-
Homo_sapiens|16937             EAAPVDLLAAFDGHARELAAARLLSTWQRLPQLLRAYGGPRYLARCPPPRSQRTQGFLE-
Pan_troglodytes|33285          EAAPVDLLAAFDGHARELAAARLLSTWQRLPQLLRAYGGPRYLARCPPPRSQRTQGFLE-
Pongo_abelii|7671              EAAPVDLLAAFDGHARELAAARLLSTWQRLPQLLRAYGGPRYLARCPPPRSQRTQGFLE-
Choloepus_hoffmanni|5159       EAAPVDLLAAFDGRARELVAARLLSTWRRLPRLLRAYGGPRYLARCSPPRSQRAQGFPE-
Procavia_capensis|5342         EAAPVDLLAAFDQRARELAAARLLSTWRRLPQLLRVYGGPRYLVRCPPPRSQRTQGCPE-
                                                                                           

Danio_rerio|27774              ---
Ochotona_princeps|916          GEP
Ornithorhynchus_anatinus|23532 PQP
Monodelphis_domestica|5706     HDP
Felis_catus|9093               DEP
Cavia_porcellus|12368          MNH
Rattus_norvegicus|30106        DEP
Canis_familiaris|15250         DQP
Myotis_lucifugus|13980         ---
Tarsius_syrichta|9077          ---
Callithrix_jacchus|45007       GEP
Rhesus_macaque|31778           GEP
Gorilla_gorilla|4724           GEP
Homo_sapiens|16937             GEP
Pan_troglodytes|33285          GEP
Pongo_abelii|7671              GDP
Choloepus_hoffmanni|5159       DEP
Procavia_capensis|5342         DEP