Orthologs Set ID: EOG4006BN


Orthology Database
OrthoDB4
Gene Symbol(s)
CG32751,GE16479,GD16208

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Drosophila melanogaster 20315 72, 703, 1400
Drosophila simulans 12790 72, 703, 1400
Drosophila yakuba 10163 72, 703, 1400

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Drosophila melanogaster 20315 FBtr0070880, NM_167061 318189 FBgn0052751 CG32751 dm3
Drosophila simulans 12790 FBtr0216118 6725259 FBgn0187836 GD16208 droSim1
Drosophila yakuba 10163 FBtr0262997 6524000 FBgn0233998 GE16479 droYak2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Drosophila melanogaster 18782 FBpp0070845 318189 FBgn0052751 CG32751 dm3
Drosophila simulans 6325 FBpp0214610 6725259 FBgn0187836 GD16208 droSim1
Drosophila yakuba 6831 FBpp0261489 6524000 FBgn0233998 GE16479 droYak2

multiple sequence alignment in CLUSTALW format


Drosophila_melanogaster|20315 ATGGCAAAGAATTATTGGGGGTTTTTCCTTTTCTGTTTAGCCCTTGGATTAATGCTGAAT
Drosophila_simulans|12790     ATGGCTAAGAATTATTGGGGGTTTTCCCTTTTCTGTTTAGCCCTTGGATTAATGCTGAAT
Drosophila_yakuba|10163       ATGGCGAAGAATTATTGGGGGTTTTTCCTCTTCGGTTTAACCCTAGGTTTAATGCTGAAC
                              ***** ******************* *** *** *****.****:**:*********** 

Drosophila_melanogaster|20315 TTGAGTCAGCAGGCTTCACTTTTCAAGAGAGATTTCTATACAGCTGGTGTGGTGGAGTTT
Drosophila_simulans|12790     TTGAGTCAGCAGGCCTCACTTTTCAGCAGAGATTTCTATACAGCTGGTGTGGTGGAGTTT
Drosophila_yakuba|10163       TTGAGTCAGCAGGTTTCACTTTTCAAGAGAGATTTCTATACAGCTGGTGTGGTGGAGTTT
                              *************  **********. *********************************

Drosophila_melanogaster|20315 GAGCCATCCAATGAATTGTCCGACAATCTAGCTGGCTATTTGGAGATAATCCAGTCGCAG
Drosophila_simulans|12790     AAGCCATCCAATGATTTGTCCGACAATCTAGCCGGCTATTTGGAGATAATCCACTCGCAG
Drosophila_yakuba|10163       AAGCCGTCCAATGTGCTGTCCAACAATCTAGCCGGCTATTTGGAGATAATCAGCTCGCAG
                              .****.*******:  *****.********** ******************.. ******

Drosophila_melanogaster|20315 AATGCCACTTCTACGGACATCATTGTGTTCCCCGAGAGCACACTGAACTCCGCGGGTTCC
Drosophila_simulans|12790     AATGCCACTTCTACGGACATCATTGTCTTTCCCGAGAGCACCCTGAACTCAGCGGGTTCC
Drosophila_yakuba|10163       AATGCCACTTCTACGGACATTATTGTGTTCCCAGAGAGCACTCTTAACGACATGGGTCCC
                              ******************** ***** ** **.******** ** *** ... **** **

Drosophila_melanogaster|20315 ACGACCTTTGTGCCCAATCCCGAGGATCAGATAAACCCCTGTTTGAGTGATCCCAATGCC
Drosophila_simulans|12790     ACGACCTTTGTGCCCAACCCCGAGGATCAGATTATCCCCTGTTTGAGTGACCCCAATGCC
Drosophila_yakuba|10163       ACGACCTTTGTGCCCAGTCCCGAGGATCAGATAAGCCCCTGTTTGAGTGATCCAAATGCA
                              ****************. **************:* *************** **.*****.

Drosophila_melanogaster|20315 ACCTACTATGAGGAGTTTCTGGTGACCCTGTCGTGTGCGGCCCGCAATGCCAGTAAATAC
Drosophila_simulans|12790     ACCTACTATGAGGAGTTCCTGGTGACCCTGTCGTGTGCGGCCCGCAATGCCAGCAAATAC
Drosophila_yakuba|10163       ACGTACTTCAAGGATTTTCTGGTGACCCTCTCATGTGCGGCTCGCAATGCCAGCAAATAC
                              ** ****: .**** ** *********** **.******** *********** ******

Drosophila_melanogaster|20315 ATTGTGATCAATCTGACCGAGAAGCAGAAGTGCGAGGATATTCCCGAGGATACGAGGCCA
Drosophila_simulans|12790     ATTGTGATCAATCTCACCGAGAAGCAGAAGTGCGAGGATGTTCCCGAGGATACGAGGCCA
Drosophila_yakuba|10163       GTTGTGATCAATCTCACCGAGAAGCAGAAGTGCGAGGATGTTCCCGAGGATACGAGACCC
                              .************* ************************.****************.**.

Drosophila_melanogaster|20315 TGTGCATCTAACGGACTGAATGTTTTCAACACCAATGTAGTGTTCGATCGTCAGGGAGTG
Drosophila_simulans|12790     TGTGCCTCCAACGGACTGAATGTCTTCAACACCAATGTGGTGTTCGATCGTCAGGGAGTG
Drosophila_yakuba|10163       TGTGCCTCCAACGGACTGAATGTCTTCAACACCAATGTGGTCTTCGATCGCCAGGGAGTG
                              *****.** ************** **************.** ******** *********

Drosophila_melanogaster|20315 GTGGTGTCCAGGTACCGAAAGGTTCATCTCTATGGTGAGCCCAAGAACAGCACTTTTCTG
Drosophila_simulans|12790     GTGGTGTCCAGGTACCGAAAGGTTCATCTCTATGGTGAGCCCAAGAATAGCACTTTTCTG
Drosophila_yakuba|10163       GTGGTGTCCAGGTATCGCAAGGTTCATTTGTACGGTGAAGCCAAGAACAGCACCTTCCTG
                              ************** **.********* * ** *****. ******* ***** ** ***

Drosophila_melanogaster|20315 CCGGAACTGAGCACCTTCGAGACAGACTTTGGGGTCACCTTCGGTCATTTTATCTGTTTC
Drosophila_simulans|12790     CCCGAGCTGAGCACCTTCGAGACGGACTTCGGGGTCACCTTCGGTCACTTCATCTGCTTC
Drosophila_yakuba|10163       CCGGAGCTGAGCACCTTTGAGACGGACTTTGGGGTCACCTTCGGGCACTTCATCTGCTTC
                              ** **.*********** *****.***** ************** ** ** ***** ***

Drosophila_melanogaster|20315 GACATCCTGTTCTATACTCCCGCCCATCAACTCATCGTGGAGCAGGGTATTACGGACTTC
Drosophila_simulans|12790     GACATCCTCTTCTACACCCCTGCTCATCAGCTG---GTGGATCAGGGAGTCACGGACTTT
Drosophila_yakuba|10163       GACATCCTGTTCTACACACCTGCTCATCAGCTG---GTGGATCAGGGAGTCACGGACTTT
                              ******** ***** ** ** ** *****.**    ***** *****:.* ******** 

Drosophila_melanogaster|20315 GTGTATCCGGCCATGTGGTTCTCCCAACTGCCCTTCCTCACAGCTGTTCAAATTCAGCTG
Drosophila_simulans|12790     GTCTACCCGGCCATGTGGTTCTCGCAACTGCCCTTCCTCACAGCTGTTCAGATCCAACTG
Drosophila_yakuba|10163       GTGTATCCGGCCATGTGGTTCTCCCAACTGCCCTTCCTCACAGCTGTTCAGATCCAGATG
                              ** ** ***************** **************************.** **..**

Drosophila_melanogaster|20315 GGTTGGTCCTATGCCAACAATGTGAATTTGCTGGCTGCTGGAGCAAGTGATCCCATTGTT
Drosophila_simulans|12790     GGTTGGTCCTATGCCAACAATGTGAATTTGTTGGCTGCTGGAGCAAGTGATCCCATTGTG
Drosophila_yakuba|10163       GGTTGGTCCTATGGCAACGATGTGAATTTGCTGGCTGCTGGAGCAAGTGATCCCACTGTG
                              ************* ****.*********** ************************ *** 

Drosophila_melanogaster|20315 GGAAATAGTGGATCGGGCATTTATCACGGACGCAGTGGCTCACTAAGAAGTGTGATGCGG
Drosophila_simulans|12790     GGAAATAGTGGATCGGGCATTTATCACGGACGCAGTGGCTCACTAAGGAGCGTGATGCGG
Drosophila_yakuba|10163       GGAAATAGTGGATCGGGAATTTATCACGGACGCAGTGGCTCACTGAGAAGCGTAATGCGG
                              *****************.**************************.**.** **.******

Drosophila_melanogaster|20315 CAGGAGTCCGGTGAGAGAAGTATATATGTGGCCCGGGTACCCAAATACAGGGCCAAAAGG
Drosophila_simulans|12790     CAGGAGTCCGGTGAGAGGAGTATATATGTGGCCCGGGTACCCAAATACAGGGCCAAAAGG
Drosophila_yakuba|10163       CAGGAGTCTGGTGAGAGGAGTATATACGTGGCCCGGGTACCAAAATACAGGCGCAGAAGG
                              ******** ********.******** **************.*********  **.****

Drosophila_melanogaster|20315 CGGATGAAGCGAGATCTCAAACGTCAAGTGGCCACCAGTTCAAGTTTCAACATCAAACGG
Drosophila_simulans|12790     CGGATGAAGCGGGATCTCAATCGTCAAGTGGCCACCAGTTCAAGTTTCAACATCAAACGG
Drosophila_yakuba|10163       CGGATGAAGCGGGATCTCAACCGTCAAGTGGCCACCAGTTCAAGTTTTAGCATTAAACGG
                              ***********.******** ************************** *.*** ******

Drosophila_melanogaster|20315 GATTATCTGGAAAACTTCACCAGCGAGGAGCTGAAAATCGACGCTGGAAAGATCGGTAAT
Drosophila_simulans|12790     GATTATCTGGAGAACTTCACCAGCGAGGAGCTGAAAATCGACGATGGAAAGACCGGTAAT
Drosophila_yakuba|10163       GATTATCTGGAGAACTTTAACAGCGAGAATGTGAAAATCGACGCTGGAGAAACGGGTAAT
                              ***********.***** *.*******.*  ************.****.*.*  ******

Drosophila_melanogaster|20315 CTTAGCCAGAATCTGTGTCACGGTGGCTTCTGTTGTCACTTCGATCTGGCCTGGAGATCC
Drosophila_simulans|12790     CTCAGCCAGAATCTGTGTCACGGCGGCTTCTGTTGCCACTTCGATTTGGCCTGGAGATCC
Drosophila_yakuba|10163       CTTAGCCAGATTCTGTGTCACGGTGGCTTCTGTTGTCACTTCGATCTGGCCTGGAGATCC
                              ** *******:************ *********** ********* **************

Drosophila_melanogaster|20315 TTGGGGAAACCCTCGAGGAACACCAGTCACTACAGCTATCGAGTGGGCATCTATGAGGGT
Drosophila_simulans|12790     TTGCGGAAACCCGCGAGGAACACCAGTCACTACAGCTATCGAGTGGGCATCTATGAGGGT
Drosophila_yakuba|10163       TTGAGGAATCCGTCGAGTAACACCAGTAACTACAGCTATCGAGTGGGCATCTACGAGGGT
                              *** ****:**  **** *********.************************* ******

Drosophila_melanogaster|20315 TGGCGTAATGAGAAGAGACTGGATGTCAACTATATTCGCAATTGTGGCGTATTCACCTGC
Drosophila_simulans|12790     TGGCGCAATGAGAAGAGGCTGGATGTCAACTATATTCGCAACTGTGGCTTGTTCACCTGC
Drosophila_yakuba|10163       TGGCGTAATGACAAGAGGTTGGATGTCAACTATATTCGCAACTGTGGTTTGTTCTCCTGC
                              ***** ***** *****. ********************** *****  *.***:*****

Drosophila_melanogaster|20315 TCTGGAAATTCGATAGATGATTGTGGTCAGCTGCTGCCTGACATTCAGAGGCCGCTGGTG
Drosophila_simulans|12790     TCTGGGGATTCGATAGACGATTGTGGTCAGCTGCTGCCTGACCTTCACAGGCCATTGGTG
Drosophila_yakuba|10163       TCTGGGAAGTCGATAGATGATTGTGGTCAGCTGCTGCCTGACCTACAGAGGCCGCTGGTG
                              *****..* ******** ************************.*:** *****. *****

Drosophila_melanogaster|20315 ACTTTCACCCATGTGGAGATTAGGGTCACATATCCGCAGTCTCGGGAGTTCCTTCTGTTT
Drosophila_simulans|12790     ACCTTCACCCATCTGGAGATTAGGGTCACATATCCGCAGTCGCGGAAGTTCCTCCTGTTT
Drosophila_yakuba|10163       ACCTTCACCCATCTGGAGATTGGGGTCACGTATCCGCAGTCAAGGAAATTCCTTCTGTTT
                              ** ********* ********.*******.*********** .**.*.***** ******

Drosophila_melanogaster|20315 CCCGATACCCTGCTCGATAATCTTCTGCCTCTGGAGCCCAAACAATTCGAGTGGTCACAA
Drosophila_simulans|12790     CCCGATACTCTGCTCGATAATCTTCTGCCTCTGGAGCCCAAACAATTCGAGTGGTCACAA
Drosophila_yakuba|10163       CCCGATACTCTGCTCGATAATCTTCTGCCTTTGGAGCCCAGCCAATTTGAGTGGTCACAA
                              ******** ********************* *********..***** ************

Drosophila_melanogaster|20315 AAACGGATCTCCGAGGAGAGTCACCAAGTGCGTTTTGCATTGAGGAAATCCCTAGAGGTC
Drosophila_simulans|12790     AAACGGATCTCCGAGGAGAGCCAACAAGTGCGATTGGCCCTAAGGAAATCCCTGGAAGTC
Drosophila_yakuba|10163       AAACAGATCTCTGAAGAGAGCCACCAAGTGCGATTTGCCTTGAGCAAATCCCTGGAGGTC
                              ****.****** **.***** **.********:** **. *.** ********.**.***

Drosophila_melanogaster|20315 AAGCACCTTTTGACCTTTGGCATTTATGGAAATTACTACAATAATGAGTGCACTTTTGGA
Drosophila_simulans|12790     AAGCACCTCTTGACCTTTGGCATTTATGGAAATTACTACAATAATGAGTGCACTTATGGC
Drosophila_yakuba|10163       AAACACCTCTTGACCTTTGGCATTTATGGTAATTACTACAAGAATGAGTGCACAGCTGGC
                              **.***** ********************:*********** ***********:  ***.

Drosophila_melanogaster|20315 GTGGGAACAGCAGAAGAGCAATTGGAATGCGGCTATAAAAATCCGAAAATATAA
Drosophila_simulans|12790     GTGGGAACAACAGAAGAGCAACTGGAATGCGGCTATAAAAATCCGAAAATATAA
Drosophila_yakuba|10163       GTGGGAACAGCAGAAGAGCAGTTGGAATGCGGCTATAAAAATCCGAAAACATAA
                              *********.**********. *************************** ****

multiple sequence alignment in CLUSTALW format


Drosophila_melanogaster|18782 MAKNYWGFFLFCLALGLMLNLSQQASLFKRDFYTAGVVEFEPSNELSDNLAGYLEIIQSQ
Drosophila_simulans|6325      MAKNYWGFSLFCLALGLMLNLSQQASLFSRDFYTAGVVEFKPSNDLSDNLAGYLEIIHSQ
Drosophila_yakuba|6831        MAKNYWGFFLFGLTLGLMLNLSQQVSLFKRDFYTAGVVEFKPSNVLSNNLAGYLEIISSQ
                              ******** ** *:**********.***.***********:*** **:********* **

Drosophila_melanogaster|18782 NATSTDIIVFPESTLNSAGSTTFVPNPEDQINPCLSDPNATYYEEFLVTLSCAARNASKY
Drosophila_simulans|6325      NATSTDIIVFPESTLNSAGSTTFVPNPEDQIIPCLSDPNATYYEEFLVTLSCAARNASKY
Drosophila_yakuba|6831        NATSTDIIVFPESTLNDMGPTTFVPSPEDQISPCLSDPNATYFKDFLVTLSCAARNASKY
                              ****************. *.*****.***** **********:::***************

Drosophila_melanogaster|18782 IVINLTEKQKCEDIPEDTRPCASNGLNVFNTNVVFDRQGVVVSRYRKVHLYGEPKNSTFL
Drosophila_simulans|6325      IVINLTEKQKCEDVPEDTRPCASNGLNVFNTNVVFDRQGVVVSRYRKVHLYGEPKNSTFL
Drosophila_yakuba|6831        VVINLTEKQKCEDVPEDTRPCASNGLNVFNTNVVFDRQGVVVSRYRKVHLYGEAKNSTFL
                              :************:***************************************.******

Drosophila_melanogaster|18782 PELSTFETDFGVTFGHFICFDILFYTPAHQLIVEQGITDFVYPAMWFSQLPFLTAVQIQL
Drosophila_simulans|6325      PELSTFETDFGVTFGHFICFDILFYTPAHQL-VDQGVTDFVYPAMWFSQLPFLTAVQIQL
Drosophila_yakuba|6831        PELSTFETDFGVTFGHFICFDILFYTPAHQL-VDQGVTDFVYPAMWFSQLPFLTAVQIQM
                              ******************************* *:**:**********************:

Drosophila_melanogaster|18782 GWSYANNVNLLAAGASDPIVGNSGSGIYHGRSGSLRSVMRQESGERSIYVARVPKYRAKR
Drosophila_simulans|6325      GWSYANNVNLLAAGASDPIVGNSGSGIYHGRSGSLRSVMRQESGERSIYVARVPKYRAKR
Drosophila_yakuba|6831        GWSYGNDVNLLAAGASDPTVGNSGSGIYHGRSGSLRSVMRQESGERSIYVARVPKYRRRR
                              ****.*:*********** ************************************** :*

Drosophila_melanogaster|18782 RMKRDLKRQVATSSSFNIKRDYLENFTSEELKIDAGKIGNLSQNLCHGGFCCHFDLAWRS
Drosophila_simulans|6325      RMKRDLNRQVATSSSFNIKRDYLENFTSEELKIDDGKTGNLSQNLCHGGFCCHFDLAWRS
Drosophila_yakuba|6831        RMKRDLNRQVATSSSFSIKRDYLENFNSENVKIDAGETGNLSQILCHGGFCCHFDLAWRS
                              ******:*********.*********.**::*** *: ***** ****************

Drosophila_melanogaster|18782 LGKPSRNTSHYSYRVGIYEGWRNEKRLDVNYIRNCGVFTCSGNSIDDCGQLLPDIQRPLV
Drosophila_simulans|6325      LRKPARNTSHYSYRVGIYEGWRNEKRLDVNYIRNCGLFTCSGDSIDDCGQLLPDLHRPLV
Drosophila_yakuba|6831        LRNPSSNTSNYSYRVGIYEGWRNDKRLDVNYIRNCGLFSCSGKSIDDCGQLLPDLQRPLV
                              * :*: ***:*************:************:*:***.***********::****

Drosophila_melanogaster|18782 TFTHVEIRVTYPQSREFLLFPDTLLDNLLPLEPKQFEWSQKRISEESHQVRFALRKSLEV
Drosophila_simulans|6325      TFTHLEIRVTYPQSRKFLLFPDTLLDNLLPLEPKQFEWSQKRISEESQQVRLALRKSLEV
Drosophila_yakuba|6831        TFTHLEIGVTYPQSRKFLLFPDTLLDNLLPLEPSQFEWSQKQISEESHQVRFALSKSLEV
                              ****:** *******:*****************.*******:*****:***:** *****

Drosophila_melanogaster|18782 KHLLTFGIYGNYYNNECTFGVGTAEEQLECGYKNPKI
Drosophila_simulans|6325      KHLLTFGIYGNYYNNECTYGVGTTEEQLECGYKNPKI
Drosophila_yakuba|6831        KHLLTFGIYGNYYKNECTAGVGTAEEQLECGYKNPKT
                              *************:**** ****:************