Orthologs Set ID: EOG4006BQ


Orthology Database
OrthoDB4
Gene Symbol(s)
GE19828,CG13449,GD12550

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Apis mellifera 34772 531, 2193, 3462, 3774, 4175, 4527, 4816
Apis mellifera 36884 531, 2193, 3462, 3774, 4175, 4527, 4816
Branchiostoma floridae 41038 175, 1697, 1896, 2043, 3010, 3630, 3752, 3913, 4032, 4395, 4457, 4620, 4816, 5103, 5279
Culex quinquefasciatus 4487 4057, 4527, 4816, 5322
Daphnia pulex 4390 3627
Daphnia pulex 7052 4020, 4203, 5103
Drosophila melanogaster 11966 528, 4048, 4527, 4816
Drosophila sechellia 3298 528, 4048, 4527, 4816
Drosophila simulans 10317 4048, 4527, 4816
Drosophila yakuba 434 528, 4048, 4527, 4816
Linepithema humile 3366 531, 2193, 3465, 3774, 4175, 4527, 4816
Nasonia vitripennis 12741 531, 2193, 3762, 4175, 4527
Nematostella vectensis 9509 156, 217, 1500, 1953, 2398, 2946, 4289, 4470, 4707, 4816, 4928, 5103, 5175, 5279, 5376
Pediculus humanus 256 510, 2193, 2907, 3587, 3762, 4527, 4816, 5116
Pogonomyrmex barbatus 12521 531, 2250, 3468, 3774, 4259, 4527, 4816
Tribolium castaneum 9225 1957, 4140, 4527, 5103, 5322
Tribolium castaneum 9226 528, 2193

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Apis mellifera 34772 GB10801-PA apiMel3
Apis mellifera 36884 GB16161-PA apiMel3
Branchiostoma floridae 41038 fgenesh2_pg.scaffold_129000046 braFlo1
Culex quinquefasciatus 4487 CPIJ014145-RA 6047571 CPIJ014145 CpipJ1
Daphnia pulex 7052 fgenesh1_pg.C_scaffold_5000079 1.1
Daphnia pulex 4390 NCBI_GNO_0500078 1.1
Drosophila melanogaster 11966 FBtr0075590 39695 FBgn0036520 CG13449 dm3
Drosophila sechellia 3298 FBtr0207462 6605803 FBgn0179340 GM24477 droSec1
Drosophila simulans 10317 FBtr0212460 6738173 FBgn0184277 GD12550 droSim1
Drosophila yakuba 434 FBtr0266346 6534515 FBgn0237159 GE19828 droYak2
Linepithema humile 3366 LH24315-RA 1.2
Nasonia vitripennis 12741 NV12949-RA 1.2
Nematostella vectensis 9509 estExt_fgenesh1_pg.C_2970006 Nemve1
Pediculus humanus 256 PHUM014900-RA 8233761 PHUM014900 PhumU1
Pogonomyrmex barbatus 12521 PB13985-RA 1.2
Tribolium castaneum 9225 GLEAN_06521 Tcas3.0
Tribolium castaneum 9226 GLEAN_06520 Tcas3.0

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Apis mellifera 800 GB10801 apiMel3
Apis mellifera 6159 GB16161 apiMel3
Branchiostoma floridae 5883 fgenesh2_pg.scaffold_129000046 braFlo1
Culex quinquefasciatus 13813 CPIJ014145 CpipJ1
Daphnia pulex 1124 JGI_V11_311910 1.1
Daphnia pulex 1125 JGI_V11_96584 1.1
Drosophila melanogaster 10919 FBpp0075343 39695 FBgn0036520 CG13449 dm3
Drosophila sechellia 14073 FBpp0205954 6605803 FBgn0179340 GM24477 droSec1
Drosophila simulans 2883 FBpp0210952 6738173 FBgn0184277 GD12550 droSim1
Drosophila yakuba 9865 FBpp0264838 6534515 FBgn0237159 GE19828 droYak2
Linepithema humile 8602 LH24315-PA 1.2
Nasonia vitripennis 2907 NV12949-PA 1.2
Nematostella vectensis 26817 estExt_fgenesh1_pg.C_2970006 Nemve1
Pediculus humanus 253 PHUM014900-PA 8233761 PHUM014900 PhumU1
Pogonomyrmex barbatus 3985 PB13985-PA 1.2
Tribolium castaneum 6373 GLEAN_06520 Tcas3.0
Tribolium castaneum 6374 GLEAN_06521 Tcas3.0

multiple sequence alignment in CLUSTALW format


Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  ATGGCCGGGCTCGCTGGGCTAATTACTGTAAAACTCCTAACGATAGCCTATCTTCTGTTT
Nematostella_vectensis|9509   ------------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  AACAGTTGTTTCGTTCTGTACTCATCTAAGGTACAGGATGGGACATGTTCCCAACCCTGT
Nematostella_vectensis|9509   ------------------ATGGAAACCGAAGTTATGGAC------------------TGC
                                                                                          

Daphnia_pulex|7052            ---------------------------ATGGCCGCTGGTGAACTTAATCTATTT------
Tribolium_castaneum|9225      ---------------------------------ATGGCACGGGAGCTCTTCCTT------
Pediculus_humanus|256         ------------------------ATGTCGGTAACAAGTAAGACTGGTCTGTTG------
Culex_quinquefasciatus|4487   ------------------------ATGAACATCTCCACGAAAACCGGTCTGATC------
Drosophila_melanogaster|11966 ------------------------ATGAGCGCCTCAACACGTACTGGATTAATT------
Drosophila_yakuba|434         ------------------------ATGAGCGCCACAACACGTACTGGATTAATT------
Drosophila_sechellia|3298     ------------------------ATGAGCGCCTCAACACGTACTGGATTAATT------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------ATGGGACCTCATAAATATAGAAGAAATTTATTTTTC------
Tribolium_castaneum|9226      ------------------------ATGAGTCAAACATCAAGAACTGGCTTAATC------
Nasonia_vitripennis|12741     ---------------------ATGCCGAGGGTTGCCAGCAGCACTGGACTCATC------
Apis_mellifera|36884          ---------------------ATGCCAGGAATCGCAAGTGCAACAGGACTTTTA------
Apis_mellifera|34772          ---------------------ATGCCAGGAATCGCAAGTGCAACAGGACTCTTA------
Linepithema_humile|3366       ---------------------ATGACCGGAATCGCGAGCGCGACCGGTCTCTTG------
Pogonomyrmex_barbatus|12521   ---------------------ATGCCTGGAATCGCGAGTGCGACTGGTCTGCTA------
Branchiostoma_floridae|41038  ACCAACATCACCGTAGTGGCCTCACCTGGACAGAAGGGAGACATGGGACTAACAGGGAAG
Nematostella_vectensis|9509   TTTTCTTACGAGATCGCTGATTGGCCA------AAAGGTTGTCTTAAGATGGCT------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  CCCGGATCGCAAGGACCCCTTGGCGTAAAGGGGAAAAAAGGCGACCGCGGCATCCTGGGG
Nematostella_vectensis|9509   ---------------------GGAATAACATTAAATGACCAAGACCGCGTGTGGTTG---
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  CTGGTGGGTCCGATGGGCATCCCAGGTGCTGAAGGAGAACCAGGTGCCGCCGGCGCCTCA
Nematostella_vectensis|9509   ------------------------------------------ACAGCGGGCAATAGGGTG
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  GGTGAGAAGGGAGAGCGAGGACCGCAAGGTGTACACGGACCATCTGGCCAGAAAGGTGCT
Nematostella_vectensis|9509   CAAGACAGAGAATATCTAGATCCCAACGCCCTCTACAACTTTTTTTCAAGTGCTAATGCC
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  GCAGGCGAGCCAGGTGTGACAGGTGTGAGAGGGTTTCCTGGGGTAAAGGGCCCGCCAGGT
Nematostella_vectensis|9509   GAC---------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  GAGAGAGGAACACCGGGATGGCTGGGTCTTCCAGGTAGGCGTGGCGAGAAAGGAAGTAAA
Nematostella_vectensis|9509   ------------------------AGGCTATATAACAGAAGGGTGAAAAGTGCTACTCCA
                                                                                          

Daphnia_pulex|7052            ------------GTTGCTGGGATACAACAAAAGATTGTTGTGGAACAAAGTCGCAAAAAA
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------CCAAGTTCAAAAAAAGTTTCTCAGAAACATTACTGTGTAAGAAAAAAAACA---
Culex_quinquefasciatus|4487   ------------GCGAGCCCTCGGAAGCACATCGTCCGGCCGCGGAAGGAGTTCGACCCG
Drosophila_melanogaster|11966 ------------CCCACGCCCAAGAGGCATATCAAGTATTTAAAAAAGCGCAAAAACCAA
Drosophila_yakuba|434         ------------CCCACGCCCAAGAGGCATGTCAAGTACCTTAAAAAACGCAAAAATCAA
Drosophila_sechellia|3298     ------------CCCACGCCCAAGAGGCATGTCAAGTACCTTAAAAAGCGCAAAAACCAA
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ---------------------------GATGTGTTCAATGGCAGATCAAACTAC------
Tribolium_castaneum|9226      ------------GCAAGCCCCACTAAAAAAATATACAGGTCACAAAAAGTTTCAACA---
Nasonia_vitripennis|12741     ------------GCGGCGCGCGTGCGGCCGGTTAGGAGGCCCAAGCCTAAGAAA------
Apis_mellifera|36884          ------------GAAGCACGTATCCGACCAACTTATCGACCTAAATCGAAGAAT------
Apis_mellifera|34772          ------------GAAGCACGTATCCGACCAACTTATCGACCTAAATCGAAGAAT------
Linepithema_humile|3366       ------------TCCGCGCGAATTCGGCCGATTCGCCGGCCCAAGCCCAAGAGC------
Pogonomyrmex_barbatus|12521   ------------TCTGCGCGAATTCGGCCGATTCGCAGACCAAAACCCAAGAAC------
Branchiostoma_floridae|41038  GGTGACCCAGGACAGGCAGGTGCAGCAGGTGCGCAGGGGCCGCCAGGTGTGGGTGCACCT
Nematostella_vectensis|9509   AGGTTTAATACCTCTATGGGAGCTACAAAAGCAAGGAATCATGCCTATGGCCACCAGCCA
                                                                                          

Daphnia_pulex|7052            GACCCAGATTCTTACAAACTGAAACTGTCACAAGGTTCACGAACAAAAGAAGCT------
Tribolium_castaneum|9225      ------------------------------------------GCAAGAACCGCCGAT---
Pediculus_humanus|256         ------------------TTCGAACTGCCTCTGCTT------GCCGTACCTGTTTCA---
Culex_quinquefasciatus|4487   ------------------GCCGTCCTGGCGCCATGTGCGATCACCCGCCAGGTCCCC---
Drosophila_melanogaster|11966 CATGGCGATATATCGCGAATGCCTCTCAAGTTCGAG------GCCACGCCCATGCCG---
Drosophila_yakuba|434         CATGGCGATATATCGCGAATGCCCCTCAAGTTTGAG------GCCACGCCCATGCCG---
Drosophila_sechellia|3298     CATGGCGATATATCGCGAATGCCTCTCAAGTTCGAG------GCCACGCCCATGCCA---
Drosophila_simulans|10317     ------------------ATGCCTCTCAAGTTCGAG------GCCACGCCCATGCCG---
Daphnia_pulex|4390            ------------------ATCGATCTCGGACTATGCATCACAGCTCGACCAGCCCCT---
Tribolium_castaneum|9226      ------------------ATTCAACTGCGAGCATTT------GCACGCCCTGCACCC---
Nasonia_vitripennis|12741     ------------------CTGGAGCTCGTGGGGCCA------TCGGTACCGGCGCCG---
Apis_mellifera|36884          ------------------ATAGAACTTGCAGGTTTT------GTTAAACCAGCACCT---
Apis_mellifera|34772          ------------------ATAGAACTTGCAGGTTTT------GTTAAACCAGCACCT---
Linepithema_humile|3366       ------------------GTGGAATTATCCGGTTGC------ACCAAAGCGGCACCG---
Pogonomyrmex_barbatus|12521   ------------------GTGGAATTATCGGGTTGT------ACCCGAGCGGCACCG---
Branchiostoma_floridae|41038  GGACAGAAGGGAGAGAAGGGTGAGCCTGGAGGAACAGGTGTTAGAACGCCATCACCTCTG
Nematostella_vectensis|9509   GGGTGGGAAACACCAAATTTATCTGTTGGCATGCTAAAAAATCCTTCTCCTACTCCT---
                                                                               .          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  GGACCACCTGGAGAAAAGGGAGATACAGGCGCACCTGGGGGAACAGGTGCGCTTGGGCCA
Nematostella_vectensis|9509   ------------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ------TGCAACCGGAAACCG---------------------------------------
Tribolium_castaneum|9225      ------TATACGCATACAGCG---------------------------------------
Pediculus_humanus|256         ------TTTGCTCTCAGGCCA---------------------------------------
Culex_quinquefasciatus|4487   ------TTAGCGCTGCGGCCA---------------------------------------
Drosophila_melanogaster|11966 ------CTATCCTTACGCCCG---------------------------------------
Drosophila_yakuba|434         ------CTGTCGTTGCGACCG---------------------------------------
Drosophila_sechellia|3298     ------CTATCCTTACGCCCC---------------------------------------
Drosophila_simulans|10317     ------CTTTCCTTACGCCCC---------------------------------------
Daphnia_pulex|4390            ------CGAACTGCTAGACCT---------------------------------------
Tribolium_castaneum|9226      ------TTCGTCCTTAAGCCC---------------------------------------
Nasonia_vitripennis|12741     ------TTCACTCTGCGTCCG---------------------------------------
Apis_mellifera|36884          ------TTTATTCTTCGTCCT---------------------------------------
Apis_mellifera|34772          ------TTTATTCTTCGTCCT---------------------------------------
Linepithema_humile|3366       ------TTCGCCCTCCGACCG---------------------------------------
Pogonomyrmex_barbatus|12521   ------TTCGCCCTTCGACCG---------------------------------------
Branchiostoma_floridae|41038  CCAGGTGTCGCAGGACGGCCAGGTGTGGGAGTGACTGGGAAGAAGGGGGCTAAAGGTGAG
Nematostella_vectensis|9509   ------GTAACATCACGGCCT---------------------------------------
                                             .   *                                        

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  GAGGGGAAAGTCGGTACCACAGGTGCCCCCGGACAAAAGGGTGAGACAGGTGGACAAGGA
Nematostella_vectensis|9509   ---------------GCATCATCTCGAAGTGGGTATAGTTCAAAGTCAGGAACAAAATCT
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------TTTGCTGGA---------------------------
Culex_quinquefasciatus|4487   ------------------------TTCGGGGGC---------------------------
Drosophila_melanogaster|11966 ------------------------TTTGGAGGA---------------------------
Drosophila_yakuba|434         ------------------------TTTGGAGGA---------------------------
Drosophila_sechellia|3298     ------------------------TTTGGAGGA---------------------------
Drosophila_simulans|10317     ------------------------TTTGGAGGT---------------------------
Daphnia_pulex|4390            ------------------------TTAGCAGGG---------------------------
Tribolium_castaneum|9226      ------------------------TTTGCAGGA---------------------------
Nasonia_vitripennis|12741     ------------------------TTTGCCGGT---------------------------
Apis_mellifera|36884          ------------------------TTTTCTGGT---------------------------
Apis_mellifera|34772          ------------------------TTTTCTGGT---------------------------
Linepithema_humile|3366       ------------------------TTCGCCGGT---------------------------
Pogonomyrmex_barbatus|12521   ------------------------TTCGCTGGA---------------------------
Branchiostoma_floridae|41038  ATGACCGGTTCTCCTGGG------TTACCTGGGCAGCAAGGTGAGAAGGGAGACAAAGGT
Nematostella_vectensis|9509   ATACACTCCTCACCAACGGCTATGTACCTAGGATTCCAAAGGACACGATGCAAGTCTGCA
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  GAGCCTGCTGAGGTGAGAGAAACGCAGGTGCGTGGTCCAACAGGTGAGAACGGTTTACCT
Nematostella_vectensis|9509   CCACCAAGGCATTTTAGATATGTGCCAAAGAGGCCCCAGACAGCAAGTTCTGGAGCAGGC
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  GGAGAGAAGGGACAGAAAGGTGATTCCGGCACACCAGGTGCACCTGGTGAATCAAGTTAC
Nematostella_vectensis|9509   TCCAGTCGA---------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  ATAACAGTCAGTGGTGAGTCGTACGTTCTACAAGGACCTCCTGGGTCAAGGGGGGTACCG
Nematostella_vectensis|9509   ---------------------------------------CCTGTATCAAGGGGTGCGCCG
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  GGTGACAAGGGGGAGAAGGGCGACAGGGGGTTTCCTGGTGACAGGGGGTTCCATGGCGGT
Nematostella_vectensis|9509   CAAAGGGCATGGCAGCTAAGAACAAGTTCTGCTTCAACATCACGATCATTACTT------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  CAGGGAACACCTGGGTACCCGGGCTCACCTGGACCTGAAGGTATGCCAGGTATGAAGGGA
Nematostella_vectensis|9509   ------------------------------TCTCCTGAAGATATC---------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  ACGAAAGGTGAGCCAGGAAAACCAGGTAAAACAGGTGCACCGGGTGAATTTGGTCAAACA
Nematostella_vectensis|9509   CATAAAAGACAAAAAGAAAGATGCAAATCTGCCCCTTTGCCATATAATTTTAGTGCAGTT
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  GGTGGCCAGGGGAGGACAGGGTTCAAAGGAGACAAGGGTGAACCA------------GGG
Nematostella_vectensis|9509   GAACTTGTAACGAAGGTCCCAAGTGACGGCAATGAACATGACAAGCTTTACGCCATGACA
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  AAGCCGTGTAGCTGTGCAGGCGGCGTGTTGAGCGCGCACGGCCGACTAGCAGATGCACCG
Nematostella_vectensis|9509   AGGCCATTGACTTGC---------------------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  TTCGTGGCGTTCTCCGCCGCCTTAGCTAACCGGATCGTCAACGTCCTGGAAAATACCATC
Nematostella_vectensis|9509   ---------------------------------ATGCCCAATATTATACAAAATGCAGTG
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  GTGAAGTACAACATCGTCCACACCAACGAGGGGAGGGCGTACGATATGGCAACGGGGAAG
Nematostella_vectensis|9509   ACCCATAGTGGTTTAAGACACTGTTGTTCT------GCATACAAT---------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  TTCACGACTTCAATCCCTGGGTACTACATGTTCACGTACTCAGGCATGACGACAAGCGTG
Nematostella_vectensis|9509   ---------------------------------ACCCGGCCTAAAACAGCAACAGACACA
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  AAGGGCTCCGCCTACTGGAGTCGGCTGGTACTGAACGGTGAACCTGTCATCAGTCTGTAT
Nematostella_vectensis|9509   AGACATGCACAGTTTTGG------------------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  GACAAGTCGATGGGAGAACATCTCTCCAGTAGTAACAGTGTTATCTTGTTGCTGAAGCCT
Nematostella_vectensis|9509   ------------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  GGGGACGAGGTTTGGGTGGAGCTGGACGCCCGGTCCTCCATGTGGGGGGACTACACGGGT
Nematostella_vectensis|9509   ------------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  TACGTCACGTTCTCAGGAACCACCATGGACGGGATTTCGGAACTCCCGTGTCCCCACAAG
Nematostella_vectensis|9509   ------------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  CGGCCCGTGGCTCCGAGGAGGAACGCAGGGCGGCTGGTGCGCATTCGGCGCCCGAACACT
Nematostella_vectensis|9509   ---CCAGTTGCA------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  CAGGACATGGAGGCCCTGATGGTCCAACAGGCGTCAGGACAACTGTACCTCACCACGCCA
Nematostella_vectensis|9509   ------------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  TACCGACAACTGCCTGAAAATGACTTCTGCTCAAAGGTTGACTGTCTGTATTGCCATCGG
Nematostella_vectensis|9509   ------------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ---------AATAGTGTCGTCTTGAAAACTGCAAAGAAGCGACCGACTGAACTTTTGTGC
Tribolium_castaneum|9225      ------------------------------------CCCAAGTCCCCGACCCACCTATTG
Pediculus_humanus|256         ---------------------ATATATAATCCTTTTCCATACGGTTGCTCTATTTTATGT
Culex_quinquefasciatus|4487   ---------------------CTCTACAACCCGTACTCCAAGGGATGTTCCGTTCTGTGC
Drosophila_melanogaster|11966 ---------------------CTCTTCAATCCTTTTGCCAAAGGATGCTCGGTGCTGTGC
Drosophila_yakuba|434         ---------------------CTCTTTAATCCTTTCGCCAAGGGATGCTCGGTGCTTTGC
Drosophila_sechellia|3298     ---------------------CTCTTCAATCCTTTTGCCAAAGGATGCTCGGTGCTGTGC
Drosophila_simulans|10317     ---------------------CTCTTCAATCCTTTTGCCAAAGGATGCTCGGTGCTGTGC
Daphnia_pulex|4390            ---------------------CTTCCCAATCCATATCCATATGGTTGCTCGGTGCTGTGT
Tribolium_castaneum|9226      ---------------------CTTTACAACCCTTATCCGTACGGTTGTTCCCTTCTTTGC
Nasonia_vitripennis|12741     ---------------------CTCTTCAACCCATATCCTTACGGCTGCTCGGTACTGTGC
Apis_mellifera|36884          ---------------------CTCTTTAATCCTTATCCTTATGGCTGTTCTATACTGTGT
Apis_mellifera|34772          ---------------------CTCTTTAATCCTTATCCTTATGGCTGTTCTATACTGTGT
Linepithema_humile|3366       ---------------------CTCTTTAATCCTTATCCCTATGGTTGCTCGGTGTTGTGC
Pogonomyrmex_barbatus|12521   ---------------------CTCTTTAATCCCTATCCTTACGGCTGCTCTGTGCTGTGC
Branchiostoma_floridae|41038  CTCCGTATGCAGAAATTGATGAAGCCCTCCCCCTGGCCCAGGGGAAACCCCCACACCCCC
Nematostella_vectensis|9509   ---------------------AGACCATCTGTATACAGAAGAGGTCAAGTTCCACAGTAC
                                                                      .                   

Daphnia_pulex|7052            GAAACG------------------------------------------------------
Tribolium_castaneum|9225      ACCCAC------------------------------------------------------
Pediculus_humanus|256         AATCAT------------------------------------------------------
Culex_quinquefasciatus|4487   AACCAT------------------------------------------------------
Drosophila_melanogaster|11966 AATCAT------------------------------------------------------
Drosophila_yakuba|434         AACCAT------------------------------------------------------
Drosophila_sechellia|3298     AATCAT------------------------------------------------------
Drosophila_simulans|10317     AATCAT------------------------------------------------------
Daphnia_pulex|4390            AATCAT------------------------------------------------------
Tribolium_castaneum|9226      AACCAC------------------------------------------------------
Nasonia_vitripennis|12741     AATCAT------------------------------------------------------
Apis_mellifera|36884          AATCAT------------------------------------------------------
Apis_mellifera|34772          AATCAT------------------------------------------------------
Linepithema_humile|3366       AATCAT------------------------------------------------------
Pogonomyrmex_barbatus|12521   AACCAT------------------------------------------------------
Branchiostoma_floridae|41038  AGACACACCCACTACCACGCCCCCGTCCTACCCATCATCAAACAAGGCCGCTGTCTTGTC
Nematostella_vectensis|9509   CTTCACTTTGTTACGCCAGCACCC------------------------------------
                                 ..                                                       

Daphnia_pulex|7052            ---------------------------------------------------------GAA
Tribolium_castaneum|9225      ---------------------------------------------------------CCG
Pediculus_humanus|256         ---------------------------------------------------------CCA
Culex_quinquefasciatus|4487   ---------------------------------------------------------CCG
Drosophila_melanogaster|11966 ---------------------------------------------------------CCG
Drosophila_yakuba|434         ---------------------------------------------------------CCC
Drosophila_sechellia|3298     ---------------------------------------------------------CCG
Drosophila_simulans|10317     ---------------------------------------------------------CCG
Daphnia_pulex|4390            ---------------------------------------------------------CCG
Tribolium_castaneum|9226      ---------------------------------------------------------CCA
Nasonia_vitripennis|12741     ---------------------------------------------------------CCA
Apis_mellifera|36884          ---------------------------------------------------------CCA
Apis_mellifera|34772          ---------------------------------------------------------CCA
Linepithema_humile|3366       ---------------------------------------------------------CCA
Pogonomyrmex_barbatus|12521   ---------------------------------------------------------CCG
Branchiostoma_floridae|41038  AGGAGAAGAAATCTGAAGACGCCGCGAAGTCGTCGCAAGGCCACGGTAATCCACTTGCCT
Nematostella_vectensis|9509   ------------------------------------------------ATCTCTGGTCAA
                                                                                        . 

Daphnia_pulex|7052            TCGAACTGCTCTAGTTCTCAGGAAGAAACTAAGCCAGTC---------------------
Tribolium_castaneum|9225      AACGCG------------------------------------------------------
Pediculus_humanus|256         ACAGATTTCGAAGCCAAAGCCATTGTTCAAAAAGCTAAAGAT------------------
Culex_quinquefasciatus|4487   GCCGCCCAGGAGTTGAAAAACGTCGTCCGGTTAGCTAAGGAC------------------
Drosophila_melanogaster|11966 GCGCCATCTGGTGTCAAGGATGTGATTAATCAGCTGAAGACA------------------
Drosophila_yakuba|434         GCACCTTCTGGGGTTAAGGATGTGATTAACCAGCTGAAGACA------------------
Drosophila_sechellia|3298     GCGCCATCTGGGGTCAAGGATGTGATTAATCAGCTGAAGACA------------------
Drosophila_simulans|10317     GCGCCATCTGGGGTCAAGGATGTGATTAATCAGCTGAAGACA------------------
Daphnia_pulex|4390            AAGGACCCCGAGCTAAAAGATGTC------------------------------------
Tribolium_castaneum|9226      ACGGACAGCGAAGCAAAAGAATTACTAAAAAGAGTGAAAGAC------------------
Nasonia_vitripennis|12741     GCGGATGGCGAGGCTAAGGAGATCGTTCGCCGAGCGAAAGAC------------------
Apis_mellifera|36884          GCAGATTGTGAAGCAAGAGAAGTTCTCAGACGGGCTAAAGAT------------------
Apis_mellifera|34772          GCAGATTGTGAAGCAAGAGAAGTTCTCAGACGGGCTAAAGAT------------------
Linepithema_humile|3366       GCAGATTGCGAGGCGAAGGAGGTGGTGCGACGCGCTAAGGAT------------------
Pogonomyrmex_barbatus|12521   GCGGATTGCGAGGCGAAGGAGGTCGTCCGACGCGCTAAGGAT------------------
Branchiostoma_floridae|41038  CCCCTGACGGGAGAAAACATGACCGTCCACCGAGCCAAGGGCGGCGGCGTTCCCTGGTGG
Nematostella_vectensis|9509   TCACCCACCAACCTGACCAGCGGGGATAACACCCAGTCAGAT------------------
                               .                                                          

Daphnia_pulex|7052            ---------------------------ATTTGG---------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ---------------------------GCATGG---------------------------
Culex_quinquefasciatus|4487   ---------------------------GCCTGGATTACCGATGCCCGG------------
Drosophila_melanogaster|11966 ---------------------------TCGTTG---------------------------
Drosophila_yakuba|434         ---------------------------TCGTTG---------------------------
Drosophila_sechellia|3298     ---------------------------TCGTTG---------------------------
Drosophila_simulans|10317     ---------------------------TCGTTG---------------------------
Daphnia_pulex|4390            ---------------------------GTGTGG---------------------------
Tribolium_castaneum|9226      ---------------------------TCATGG---------------------------
Nasonia_vitripennis|12741     ---------------------------ACCTGG---------------------------
Apis_mellifera|36884          ---------------------------TCATGG---------------------------
Apis_mellifera|34772          ---------------------------TCATGG---------------------------
Linepithema_humile|3366       ---------------------------ACATGG---------------------------
Pogonomyrmex_barbatus|12521   ---------------------------ACATGGGTAAAAAATTCATCCGCCGTATGTAGG
Branchiostoma_floridae|41038  GCCAACAAGACTCCGCTAGGGGGCATCTCATGGGTGAACGCCGACGTCACCGAACCATCT
Nematostella_vectensis|9509   ------------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------GTTGACATTGTAAAAAAATTGCCTTCTCCG
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------GCAACAGAAGGAAAATCGTTGATAGATTTA
Culex_quinquefasciatus|4487   ------------------------------ACCGTCCACAGCGAGAAGCTGCTGATGGGC
Drosophila_melanogaster|11966 ------------------------------GCGATCGAGGGCAAAGGCCAGCAGCATGGG
Drosophila_yakuba|434         ------------------------------GCGATCGAGGGCAAAGGGCAGCAGCATGGA
Drosophila_sechellia|3298     ------------------------------GCGATCGAGGGCAAAGGCCAGCAGCATGGT
Drosophila_simulans|10317     ------------------------------GCGATCGAGGGCAAAGGCCAGCAGCATGGT
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------GCCACTGAAGGCAAAAACTTGCTATTGACC
Nasonia_vitripennis|12741     ------------------------------GCGAGCGAAGGCAAAGCTCTATTGCTGCCA
Apis_mellifera|36884          ------------------------------GCAAATGAAGGAAAGACATTATTATTACCA
Apis_mellifera|34772          ------------------------------GCAAATGAAGGAAAGACATTATTATTACCA
Linepithema_humile|3366       ------------------------------GCGACCGAGGGGAAAGCTCTTTTGCTGCCG
Pogonomyrmex_barbatus|12521   AAAGAAGATAAATGTGGTGTCATAAACCATGCGGCCGAAGGAAAAGCTCTTTTGCTGCCG
Branchiostoma_floridae|41038  ACT---------------------------GCAGCCGATGGGATCAAACTGAGCGCAAAC
Nematostella_vectensis|9509   ------------------------------GAGGAGCCTGATGACACCCTGCTCGAGGAA
                                                                                          

Daphnia_pulex|7052            GAAGTAGAGACTCCACTTCCAGTA------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         GAAGAAAAAGATGCATTGAAATCACAAAGA------------------------------
Culex_quinquefasciatus|4487   GGCCAGGGCCAC------------------------------------------------
Drosophila_melanogaster|11966 AAACAGGATAAAATT---------------------------------------------
Drosophila_yakuba|434         AAGCAGGATAAAATT---------------------------------------------
Drosophila_sechellia|3298     AAACAAGACAAAATT---------------------------------------------
Drosophila_simulans|10317     AAACAGGATAAAATT---------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      GAAGAGATTGAAGCAATCAGAGCTGGATTCGAAAAT------------------------
Nasonia_vitripennis|12741     GCAGAGCTAGAGCTTCTGCATCAGCAC---------------------------------
Apis_mellifera|36884          GAAGAAATGGAAATGATTAGAGCGAATTTAGTAACTGTAGGCAAT---------------
Apis_mellifera|34772          GAAGAAATGGAAATGATTAGAGCGAATTTAGTAACTGTAGGCAAT---------------
Linepithema_humile|3366       GAGGAAATGGAAATGATACGGACGAGTCTACTGGCGATGGGCGCGGGCGGAGGCGTAGGT
Pogonomyrmex_barbatus|12521   GAAGAGATGGAGATGATCCGGACGAGTCTGCTAGTGGTGGGCGCAAGCGGAGGCGGAGGC
Branchiostoma_floridae|41038  GTTAACGGTGAGATTATACACTTGGAGGAAATACAACTGAGAGAGCAAAAGGACGAGGAA
Nematostella_vectensis|9509   GATCTGGATGAGATGGTGTTGTTTGAAGAGAGCTTTGTGGTACCT---------------
                                                                                          

Daphnia_pulex|7052            ---------ACTAAACCAACCACCTCTCGAAAGTTACCGACAAGTGTTTGGATGTCAAGA
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ---------AAAGAATTAATTTCATCGGAATTTAGTAAAAGCATTTACGAT---------
Culex_quinquefasciatus|4487   ---------GGTTCGGGAAAGCAACCCGATGGCAGTAAGCGGATGATGTCCAAGGATTCG
Drosophila_melanogaster|11966 ---------------CCTGAGGAGCCGGATTTGCAGCCCCATGAGACGGAT---------
Drosophila_yakuba|434         ---------------CCTGAGGAGCCGGAGCTGCAGCCCCATGAGGCGGAT---------
Drosophila_sechellia|3298     ---------------CCTGAGGAGCCGGAACTGCAGCCCCATGAGGCGGAT---------
Drosophila_simulans|10317     ---------------CCTGAGGAGCCGGAAATGCAGCCCCATGAGGCGGAT---------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ---------TTCCAGCCTCTAGAAAAAAACGTAAAACACGTGCAAATAAAC---------
Nasonia_vitripennis|12741     ---------AACAAGCCGATCAGCGGCGGCGAACATCAGGAGGGTCTGGAC---------
Apis_mellifera|36884          ---------GCTGCCGATGTAAGTGGAAATACTGGAGCTGAAATAACTAAT---------
Apis_mellifera|34772          ---------GCTGCCGATATAAATGGAAATACTGGAGCTGAAATAACTAAT---------
Linepithema_humile|3366       GAG------GCTGGAAATGTCGGAGGTAACAGCGGTGGCGACGGTTACAAAGTTACCGAG
Pogonomyrmex_barbatus|12521   GAGGCA---GCTGGAAATGTCGGAGGTGACGGCGATGGTTACAATGCCGAG---------
Branchiostoma_floridae|41038  GAAGCAAAAACTGGGAAGGAGGGAAGTGAAGAAGGGGAAGACAAATTTGGAGAACTCGAA
Nematostella_vectensis|9509   ---------GCCACACCCACTGAGCCGTCCTTG---TCAGAACAGTACGACCCATCAGAA
                                                                                          

Daphnia_pulex|7052            AATTCCCGTTCAGGAATATTGCCC------GAAGGA------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ---------GAAAATGTTTTAAAAGATTCTTCGTAC------------------------
Culex_quinquefasciatus|4487   GATCTGCCGGATCACGTGCCGGAG------GAGTTC------------------------
Drosophila_melanogaster|11966 ------------AATATTCCGGAG------GATCTG------------------------
Drosophila_yakuba|434         ------------AATATTCCGGAG------GATCTG------------------------
Drosophila_sechellia|3298     ------------AATATTCCGGAG------GATCTG------------------------
Drosophila_simulans|10317     ------------AATATTCCGGAG------GATCTG------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ---GCCCTTGATAGCGTTCCTGAG------GAATTA------------------------
Nasonia_vitripennis|12741     ---------------GTTCCAGAG------GAGCTA------------------------
Apis_mellifera|36884          ---GATTCCAATACCGTTCCCGAG------GAATTA------------------------
Apis_mellifera|34772          ---GATTCCAATACCGTTCCCGAG------GAATTA------------------------
Linepithema_humile|3366       GTGACCGCTTCGGCGGTGCCCGAG------GAGCTC------------------------
Pogonomyrmex_barbatus|12521   ATGACCGCTTCGGCGGTGCCCGAG------GAGCTC------------------------
Branchiostoma_floridae|41038  GCATCAAAGGAAAATGTCTTACCA------GATATTTCTGATTCTGACACGTCGTCTGTG
Nematostella_vectensis|9509   CTGGATGAAAGAGATGTTGCAGACATGGGTGATATT------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  CGTTCCGCTGATACTGTGATCTCCAAGGACACGGGTATAGGAACGGCTACGGCAATCTCA
Nematostella_vectensis|9509   ------------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ---------------------------------------TTTCAA---------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ---------------------------------------TTCCGG---------------
Drosophila_melanogaster|11966 ---------------------------------------TTCCGG---------------
Drosophila_yakuba|434         ---------------------------------------TTCCGG---------------
Drosophila_sechellia|3298     ---------------------------------------TTCCGG---------------
Drosophila_simulans|10317     ---------------------------------------TTCCGG---------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ---------------------------------------TTCAGA---------------
Nasonia_vitripennis|12741     ---------------------------------------TTCCGG---------------
Apis_mellifera|36884          ---------------------------------------TTTCGA---------------
Apis_mellifera|34772          ---------------------------------------TTTCGA---------------
Linepithema_humile|3366       ---------------------------------------TTCCGG---------------
Pogonomyrmex_barbatus|12521   ---------------------------------------TTCCGG---------------
Branchiostoma_floridae|41038  GAGGAGGTGACTCTACCTTCTCTGTCAAACATAAAAGTGTTTCGTCCTAAAGATCACTTT
Nematostella_vectensis|9509   ---------------------------------------GTTGAG---------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  GCCGATGGGACAGACGAGACGAGTACTGAGGAGACTGCTAGTTCCTATGAGGAAAATGTC
Nematostella_vectensis|9509   ------------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  GGAGGGCAAGATGAGAACCAAACTAAAATCACAGAAGAAGTAGGAAAAAATGATGTCGTC
Nematostella_vectensis|9509   ------------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  GAAGTAGAAAGGCGATCAGTCGTTGATGAGCTAACGTTGGACACGGAAGATACGTCCAAA
Nematostella_vectensis|9509   ------------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  CAGCATCCATCACAGCATCCAGAAGAAATAGATGGAGAACTCCTCTGTACAAAAGACGGG
Nematostella_vectensis|9509   ------------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ---------ATTTACATTCAA---------AAG------------------AATTTGAAC
Tribolium_castaneum|9225      ---------------------------TCAAGG------------------TCATCGACC
Pediculus_humanus|256         ---------AATTTCGAAGAAACAAATGAAAAA------------------TGTTTAACT
Culex_quinquefasciatus|4487   ---------CGCTACACGGACACCGACTCGCGG------------------CCACTGACA
Drosophila_melanogaster|11966 ---------CGATATGCGGAAACGGACTCGCGT------------------CCGATGACG
Drosophila_yakuba|434         ---------CGATATGCGGAAACGGATTCGCGG------------------CCGATGACG
Drosophila_sechellia|3298     ---------CGATATGCGGAAACCGATTCGCGA------------------CCGATGACG
Drosophila_simulans|10317     ---------CGATATGCGGAAACGGATTCGCGT------------------CCGATGACG
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ---------CGTTACACAGAGACGGACTCGAGG------------------CCTTTAACC
Nasonia_vitripennis|12741     ---------CGCTACACCGAGACGGACTCGCGT------------------CCGGTGAGT
Apis_mellifera|36884          ---------AAATATACTGAGACCGATTCGAGA------------------CCTTTGACT
Apis_mellifera|34772          ---------AAATATACTGAGACCGATTCGAGA------------------CCTTTGACT
Linepithema_humile|3366       ---------AAATACACAGAAACCGATTCGCGA------------------CCTTTGACC
Pogonomyrmex_barbatus|12521   ---------AAATATACGGAAACTGATTCGCGA------------------CCTTTGACC
Branchiostoma_floridae|41038  TGTTCCTGTCCGTACAACAAAGCCTCACCGCAGAAACAGTCGCCGAAAAATTCATCGCCT
Nematostella_vectensis|9509   ---------CGATACCTTGATATGGCAGACAACTACAACAGCACCAACAACACCCTACTC
                                                                                          

Daphnia_pulex|7052            CTCATAGAGGATGTCCAGACAGCTAAGAGAAGAAGGTCGGATAATCGGGACATTTTCCGC
Tribolium_castaneum|9225      CCGAGC---TCGGTCAAGGCCCTCAAAAAGAAAAACAAG---------------------
Pediculus_humanus|256         TCAACACCAAACAATAAAATTTCACCGAACGTTAAAAAT---------------------
Culex_quinquefasciatus|4487   CCAACACCGACCGTAGCTAGCGGACGAACCCGGGCGAGCGTCGTCGGTGGGTCCCATCTG
Drosophila_melanogaster|11966 CCAACGCCCACGGTAACTAGTATCCATACCAGGACCAGT---------GCTGGGTCTTTC
Drosophila_yakuba|434         CCAACGCCCACGGTAACGAGTATCCATACCAGAACCAGC---------GCTGGGTCCTTC
Drosophila_sechellia|3298     CCAACGCCCACGGTAACTAGTATCCATACCAGGACCAGT---------GCTGGGTCCTTC
Drosophila_simulans|10317     CCAACGCCCACGGTAACTAGTATCCATACCAGGACCAGT---------GCTGGGTCCTTC
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      CCCGCCCCCACATTAGCAAGCGCCGCAACCAGAGCCTCG------------------GGA
Nasonia_vitripennis|12741     CCTACTATTAGCGTCGAGCCGACACAGATCAACGATGAC---------------------
Apis_mellifera|36884          CCTGCACCTACGCTCGCCAGCGGTCCTCCTTTGACAAAT---------------------
Apis_mellifera|34772          CCTGCACCTACGCTCGCTAGCGGTCCTCCTTTGACAAAT---------------------
Linepithema_humile|3366       CCGGCGCCCACGCTAGCCAGCGGACCTACGGCATTAACC---------------------
Pogonomyrmex_barbatus|12521   CCGGCGCCTACGCTCGCCAGCGGACCAACGGCGTTAACT---------------------
Branchiostoma_floridae|41038  CCTGATCTACATTTAGCAAACCTTCAGCTTGTGCAAAATGCAGACGACGGTGGAGAAAAT
Nematostella_vectensis|9509   CATCCTCCTGAACAGTACCCTCTTCCTGTCGATGACAACAAGTCAGACTCTGCCTCTGAC
                                                                                          

Daphnia_pulex|7052            ACCGAACAAGAAGATGATGTG---------------AACTGGACGTCTAACGCTCCTCGA
Tribolium_castaneum|9225      ------------GAAGTGGAG---------------GAGCCCCCCATTAAGGAGAAACAA
Pediculus_humanus|256         ---CGACGATGTCTTACACCA---------------GATCCGACATCTTTCATTCCAACA
Culex_quinquefasciatus|4487   ACCCGGCGCTGTGTCACGCCG------------------GAACCGCAAACGCAGAACCTG
Drosophila_melanogaster|11966 TATCGCCGATGCATTACTCCG---------------GAATGGGGTAAACACGAGAACATA
Drosophila_yakuba|434         TATCGCCGATGCATTACTCCG---------------GAGTGGGGCAAGCACGAGAATATA
Drosophila_sechellia|3298     TATCGTCGATGCATTACCCCG---------------GAATGGGGCAAACACGAGAACATA
Drosophila_simulans|10317     TATCGCCGATGCATTACTCCG---------------GAATGGGGCAAACACGAGAACATA
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      TCTAGACGCTGTGTCACGCCA---------------GACCCCGCCCCCACCAATCAAATT
Nasonia_vitripennis|12741     ------------------------------------GATCTCGACGGCAGTGCCAGAGAG
Apis_mellifera|36884          ------AGAGCGACTCAGGAA---------------GAATTTCCGGCGGCTTGCAATTTA
Apis_mellifera|34772          ------AGAGCGACTCAGGAA---------------GAATTTTCGGCGGCTTGCAATTTA
Linepithema_humile|3366       ---AGCCGCGCAACCCAGGAG---------------GATTTACCTGCGCCTTGTAATCCG
Pogonomyrmex_barbatus|12521   ---GGTCGCACGGCCCAGGAG---------------GATTTGCTGGCGACCTGTAACCCG
Branchiostoma_floridae|41038  GAGTCGGCAACATCTCGGCCATACGATAATGATCTTGACTGGAAAAAGAACGAACTCCAA
Nematostella_vectensis|9509   TTCCAGGAACCAGAAGTACAAATACTTATTACAAGAAAGTCACCCTCACCTGAACCAGTG
                                                                                          

Daphnia_pulex|7052            CCATCCGAGTGGCTACTGAAACCTCCT---------------------------------
Tribolium_castaneum|9225      GAGGAAAAGAAGTCGGAC------------------------------------------
Pediculus_humanus|256         AAAGAAAAAACACTTTTGGTGTTGGAT---------------------------------
Culex_quinquefasciatus|4487   CAAGAACGGAAGCAACTGATCCTGGAC---------------------------------
Drosophila_melanogaster|11966 AAG---CGTAAGAAGATCATTTTGGAC---------------------------------
Drosophila_yakuba|434         AAG---CGGAAGAAGATCATATTGGAT---------------------------------
Drosophila_sechellia|3298     AAG---CGGAAGAAGATCATATTGGAT---------------------------------
Drosophila_simulans|10317     AAG---CGGAAGAAGATCATATTGGAT---------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      CGAGAAAAGACACTCCTCATTTTGGAC---------------------------------
Nasonia_vitripennis|12741     ACCCTCAGGACGACGCTGGTGCTGGAT---------------------------------
Apis_mellifera|36884          CGAGAACGAACTACGTTGATCCTAGAT---------------------------------
Apis_mellifera|34772          CGAGAACGAACTACGTTGATCCTGGAT---------------------------------
Linepithema_humile|3366       CGCGAGCGCACCACCCTGGTCCTGGAT---------------------------------
Pogonomyrmex_barbatus|12521   CGTGAGCGCACCACTTTAGTTCTGGAT---------------------------------
Branchiostoma_floridae|41038  GAGGAGGAGGCTGCTATAATGTTGGACCCAAACTTGCCGTGGTTGTCCCACGGCTATAAG
Nematostella_vectensis|9509   GAAGAGCCAGAGGCAATAAGTAATACCCCTGAGCCAGCACTGGAAACTACAGATCCCGAA
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  AAAGGCAAGGATGATTTTAGCCAGAAGTTCCTATCAGATGTGGACTACGCCAAACATCAT
Nematostella_vectensis|9509   GCCAAAGAGACAAATAAACCAGAT------------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  ACTGACACATCTTCCGAGAATAGACTACGGATCTCGACTCCGAGAAAGGACCAGCAAGAA
Nematostella_vectensis|9509   ------------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  AGAGTGAAGAGCGCAACTGTAAGGAGAGTACAGGATGGTAGAGGCGGAAGCGCACGTTCA
Nematostella_vectensis|9509   ------------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  CGAGACAGTGGCGGGGATACCTACCAGTTCTTACGGGAGTCTCGCCCGAGAAGTGCTTAT
Nematostella_vectensis|9509   ------------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  TCGCTGTACAGCGTGAAGTCGTTTATGTCCGGTCCACCTCAGGTGAAAAGCAAAAGAGCT
Nematostella_vectensis|9509   ------------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  CGGAGTGCGACAGTACGAAGAAAAGCGGCTGACTTGCAGAAAAGTTTTACACAAGTAGAG
Nematostella_vectensis|9509   ------------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ---------------CTTCAACGGAAGAAAAAACGAAATAGAAAAAGCATT---AAGTTT
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ---------------CTTAGACGAAGTCATAGTCAGGATACGGTTCATTTGCAAAGAGAT
Culex_quinquefasciatus|4487   ---------------CTACGGCGAAGTCACAGC------------------CAGGAAACT
Drosophila_melanogaster|11966 ---------------CTACGGAGATCGCACTCC------------------CAGGAGACG
Drosophila_yakuba|434         ---------------CTCCGCAGATCCCACTCC------------------CAGGAGACG
Drosophila_sechellia|3298     ---------------CTACGGAGATCGCACTCC------------------CAGGAGACG
Drosophila_simulans|10317     ---------------CTACGGAGATCGCACTCC------------------CAGGAGACG
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ---------------TTGAGGCGGAGCCACAGC---------------------------
Nasonia_vitripennis|12741     ---------------CTGAGGGCGAGCTCGCACGAGATTCAAGAG------AACGAAACC
Apis_mellifera|36884          ---------------CTTAGAACGAATTCACAAAAACGGATGGAA------AATGAAACT
Apis_mellifera|34772          ---------------CTTAGAACGAATTCACAAAAACGGATGGAA------AATGAAACT
Linepithema_humile|3366       ---------------CTCCGAGCGAACTCGCAAAACCAGCAGGTGGAG---AGCGAAACT
Pogonomyrmex_barbatus|12521   ---------------CTTCGAACGAGCTCGCAGAGCAACCAGCAGTTGGAAAATGAGGCT
Branchiostoma_floridae|41038  AGAGGGTACGAAGAAGTACGAATAGACAGAAACTTTCGCAAACTCGCACGGCCGAGGACT
Nematostella_vectensis|9509   ---------------GTGATAACAGAACACGATAATGTGCAGGAACATGAGCAAAAAGGC
                                                                                          

Daphnia_pulex|7052            GAGAAA------------------------------------------TGG---------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         TTAAGT------------------------------------------TTTGAT------
Culex_quinquefasciatus|4487   TTGTAC------------------------------------------TGG---------
Drosophila_melanogaster|11966 CTCTAC------------------------------------------TGG---------
Drosophila_yakuba|434         CTCTAC------------------------------------------TGG---------
Drosophila_sechellia|3298     CTCTAC------------------------------------------TGG---------
Drosophila_simulans|10317     CTCTAC------------------------------------------TGG---------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     CTCAGT------------------------------------------TGG---------
Apis_mellifera|36884          TTTAGT------------------------------------------TGG---------
Apis_mellifera|34772          TTTAGT------------------------------------------TGG---------
Linepithema_humile|3366       TTCAGC------------------------------------------TGG---------
Pogonomyrmex_barbatus|12521   TTTAGC------------------------------------------TGG---------
Branchiostoma_floridae|41038  GCTCAGGGGTTGGTACGCGGGAGACCTAATGTGACGTGGAGCGGAGACTGGCGT------
Nematostella_vectensis|9509   GAAACAAGTGATGGGGACACCAAGCAAGAAGTTCCTTTTATTAAAGAGGAGCAAATAGAG
                                                                                          

Daphnia_pulex|7052            ---------------------CTACAACTTCCTTGCGGTTTACAAGGTATCCATTTGGAA
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ---AATAATAATGATACGGGTAACATACCGGATGAAAATATTTCCAGACCAGGTACACCC
Culex_quinquefasciatus|4487   ------AACGCGTCGTCCGAGCTGTCCCCAAGCCAGCTGCAGGATCCCTCGTGGATGCAG
Drosophila_melanogaster|11966 ---AAG---------------------CCCAGTTCGGACCTGACCCAAAGCGGCCTGGAG
Drosophila_yakuba|434         ---AAG---------------------CCCAGTTCGGAGTTGACCCAAAGCGGCCTGGAG
Drosophila_sechellia|3298     ---AAG---------------------CCCAGTTCGGAGCTGACCCAAAGCGGCCTGGAG
Drosophila_simulans|10317     ---AAG---------------------CCCAGTTCGGAGCTGACCCAAAGCGGCCTGGAG
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ---CGAGCTTTAACGCTTGAACCAATACCCAGCACGCGCAGGACCGATCTCTCCTCCAGT
Apis_mellifera|36884          ---CATGCATTGACTTTAGAACCACCGCCGACCCATCGAAAAAATGAGATTGTTGTATCT
Apis_mellifera|34772          ---CATGCATTGACTTTAGAACCACCGCCGACCCATCGAAAAAATGAGATTGTTGTATCT
Linepithema_humile|3366       ---CATGCTCTTACACTCGAACTACCGCCGACGCCTCGAAAAAGCGAAATATTTGTTTGC
Pogonomyrmex_barbatus|12521   ---CACGCTCTTACACTCGATCTGCCGCCAACTCCTCGGAAGAGCGAGATATTTGTCTAC
Branchiostoma_floridae|41038  ---CCGACATCTTCCACGGGACTGATTCCTACGACACCGTTCGACAGATATGTCAGTTAC
Nematostella_vectensis|9509   GATAAGGGACCTGAAGTAAGAAATGATATGGAACCTCATGAGACAGATGTCCCTTTGCAA
                                                                                          

Daphnia_pulex|7052            ---GGAAGAGAGCCTCGAAAGACCAACCCACTTCAA---CCCGGTCCTCGCAAT------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         TCGAGCCAAAGTCCCGTACAAACAAAGAAGAAAAAAACGCCAAGAAAAAAATCGATTGTT
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 GAGGACAAGAAACCCAAGAGTGCCGGTGCCAATGAG---GACAAGAAGCCAAAG------
Drosophila_yakuba|434         GAGGACAAGAAGCCCAAGAGTGCCGGTGCCAACGAG---GACAAAAAGCCGAAG------
Drosophila_sechellia|3298     GAGGACAAGAAGCCGAAGAGTGCCGGTGCCAATGAG---GACAAGAAGCCAAAG------
Drosophila_simulans|10317     GAGGACAAGAAGCCGAAGAGTGCCGGTGCCAATGAG---GACAAGAAGCCAAAG------
Daphnia_pulex|4390            ---------AGGCCGAGAATATCATCGACACATGAA------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     CAACGGCGTAAACCGGTTTCTTCTAGGAATCGGTCGACGACTGCGCTCTCCACT------
Apis_mellifera|36884          ---------AAACCGATTTCAAGACGTGCGATAGAA---AATTCGATTCATACT------
Apis_mellifera|34772          ---------AAACCGATTTCAAGACGTGCGATAGAA---AATTCGATTCATACT------
Linepithema_humile|3366       ---------AAACCGATCTCGCGACCGCAACATTCGGCACCCGCGCCGCCT---------
Pogonomyrmex_barbatus|12521   ---------AAGCCGACCTCGCGAGCGCAACATTCA---TCAGCAACTCCTATA------
Branchiostoma_floridae|41038  GAG------AGACCGCGCTCTGCCAGACGGGTAAGAAGAGGTGAGACACCACAGTTCTTC
Nematostella_vectensis|9509   GAACCAATAAAGCCCCCTGAACCTGAGCCCCTAAAAGAGGCTCCTCCTCCTGTA------
                                                                                          

Daphnia_pulex|7052            ---------------------------------------------------CAGAAACCA
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         TCCTCC---------------------------------------------ACGACAGCT
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ---------------------------------------------------AGGCAGCCA
Drosophila_yakuba|434         ---------------------------------------------------AGGCAGCCC
Drosophila_sechellia|3298     ---------------------------------------------------AGGCAGCCA
Drosophila_simulans|10317     ---------------------------------------------------AGGCAGCCA
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ---------------------------------------------------------TCT
Apis_mellifera|36884          ---------------------------------------------------GCAGATTCA
Apis_mellifera|34772          ---------------------------------------------------GCAGATTCG
Linepithema_humile|3366       ---------------------------------------------------------CCA
Pogonomyrmex_barbatus|12521   ---------------------------------------------------CTGCCTTCT
Branchiostoma_floridae|41038  GACATCTCCAAGAGAGCGTGGCTTCACGATCGCCCACCGCAATCGCCACCCAGAACCCCA
Nematostella_vectensis|9509   ---------------------------------------------------AGCATTAGT
                                                                                          

Daphnia_pulex|7052            GCTAAACAATGTCAGATTCGAAATTGTTCGCCTGATGACGAAATGGGTTGGGTGTACGAT
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         TCCAGTTTAAAAACTCAAAATTCGAAAGGTTCCGATTCGAAGGTTCAAGATTCCGTAACT
Culex_quinquefasciatus|4487   ------------------------------CACCACAGCCAGATACCGGAAACGGTGGAC
Drosophila_melanogaster|11966 TCCAACGAGCAGAGA---------------CCGAAGTCCTCGCTGGCCACCGCAACTCTG
Drosophila_yakuba|434         TCCAACGAGCAGAGA---------------CCGAAGTCCTCGCTGGCCACAGCAAACCTG
Drosophila_sechellia|3298     TCCAACGATCAGAGA---------------CCCAAGTCCTCGCTGGCCACCGCAACTCTG
Drosophila_simulans|10317     TCCAACGAGCAGAGA---------------CCCAAGTCCTCGCTGGCCACCGCAACTCTG
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     CCCGTTCGCTCCGTT---------------CCTGTGCTTGAGGTGAGCGACGCAGCCTCG
Apis_mellifera|36884          ACGATCGATATTCAA---------------AACGTAGATGCTTCTAATGAATCGAATTCT
Apis_mellifera|34772          ACGATCGATATTCAA---------------AACGTAGATGCTTCTAATGAATCGAATTCT
Linepithema_humile|3366       CCGTCACCTCCCTCG---------------CCCATCGTTGAAGGATGTGAAACAAGTTCG
Pogonomyrmex_barbatus|12521   CCATCGCCTCCCTCA---------------TCTACCGCTGAAAAATGCGAAACGATTGCT
Branchiostoma_floridae|41038  CCCCCTCCGCAAAGAATAAGGACGCCAGTCAGGATTGTCAGAACTCCATCAAATGTGTCA
Nematostella_vectensis|9509   CCCGCAGAGCCAAAAGTCAAGTTCCTTGATTCAGTCAAAATATCAAGTTATAAACCACCA
                                                                                          

Daphnia_pulex|7052            GGGAAAAAAGTG------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         AGTTCAAGTCCCACTCGAAGCGTTTTAATAACAGAAAAGGAAAAAAAACTAAGCAAAACT
Culex_quinquefasciatus|4487   GAGCGTGTCCTC------------------------------------------------
Drosophila_melanogaster|11966 ACACCCGGCGGA---------------------------------------------GAT
Drosophila_yakuba|434         GCACCAGGCGGA---------------------------------------------GAT
Drosophila_sechellia|3298     GCACCCGGCGGA---------------------------------------------GAT
Drosophila_simulans|10317     GCACCCGGCGGA---------------------------------------------GAT
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ACTCGCAGCGCACCAACGAATCTCGCTCCAATCGCTCCCACCGAAGACGATGACGACGAG
Apis_mellifera|36884          AATAGAAACGTG------------------------------------------------
Apis_mellifera|34772          AATAGAAACGTG------------------------------------------------
Linepithema_humile|3366       TCCAAGAATGCG------------------------------------------------
Pogonomyrmex_barbatus|12521   ACATGCACGCCT------------------------------------------------
Branchiostoma_floridae|41038  GCCAAAGCAGGCAGTGGGGAGCCCAGCACAGTGGAGATGTCTCCCCCTCCATCCCCACCT
Nematostella_vectensis|9509   GAGCCAAACCCTGTAGCACCAAAGGAACCACCAAAACCAATCCTGAAGCCCACCAAGGCT
                                                                                          

Daphnia_pulex|7052            ACTTTTCAGTTGATCAAT------------------------------------------
Tribolium_castaneum|9225      GATGAAGAGGAGGCAGAG------------------------------------------
Pediculus_humanus|256         CATAATAAAAGTACGGAT------------------------------------------
Culex_quinquefasciatus|4487   GGGGGAGACGGCGCCGAA------------------------------------------
Drosophila_melanogaster|11966 GCCATCAATGACCAGGAG------------------------------------------
Drosophila_yakuba|434         GCCACCAATGATCCGGAG------------------------------------------
Drosophila_sechellia|3298     GCCTCCAATGACCAGGAG------------------------------------------
Drosophila_simulans|10317     GCCTCCAATGACCAGGAG------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     GAAGAAGACGAGGACGAC------------------------------------------
Apis_mellifera|36884          ACAGAAGAAGAAACAGAA------------------------------------------
Apis_mellifera|34772          ACAGAAGAAGAAACAGAA------------------------------------------
Linepithema_humile|3366       GAGGAAGAGGCCGACAGC------------------------------------------
Pogonomyrmex_barbatus|12521   TTCTCTCGTTTGAGGCTT------------------------------------------
Branchiostoma_floridae|41038  CCGGAGCAGGAGGAGGAGATACCTGTAGAGGAGGAGGAGGAGGAGGAGGATGGAGACTGG
Nematostella_vectensis|9509   CCTGAGCCAAAACTGGCT------------------------------------------
                                                                                          

Daphnia_pulex|7052            ---------------------------------------------------------CAG
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ---------------------------------------------------------AGC
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ---------------------------------------------------------GCC
Drosophila_yakuba|434         ---------------------------------------------------------GCC
Drosophila_sechellia|3298     ---------------------------------------------------------GCC
Drosophila_simulans|10317     ---------------------------------------------------------GCC
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ---------------------------------------------------------ACT
Apis_mellifera|36884          ---------------------------------------------------------AAA
Apis_mellifera|34772          ---------------------------------------------------------AAA
Linepithema_humile|3366       ---------------------------------------------------------GGC
Pogonomyrmex_barbatus|12521   ---------------------------------------------------------TCG
Branchiostoma_floridae|41038  CAGGAACAGATTGAAGTGTCAGTACAGATGAAGGAGCCAGAGCCACCGCCCCCCTCCCCA
Nematostella_vectensis|9509   ---------------------------------------------------------CCA
                                                                                          

Daphnia_pulex|7052            GGGAAACAAAAGAACAAATCCGAGAAAAAACGTAGGCGACGACGAATCAAAACAAAAAAG
Tribolium_castaneum|9225      ---------------------------------GACGAGTTTATCAAGCGCAGAGGGAAG
Pediculus_humanus|256         ACATCGAGCGATGATGTGATAGTTAAAAGAAGAGGTAAA------AAAAGAAAAGGAAAA
Culex_quinquefasciatus|4487   ---------------------------------TCGGACAAGGAGGACCGCCAAGGCAAA
Drosophila_melanogaster|11966 AAGCCCAAAACCTGCATCAATGAGCATGAGCTCAGCGACGAGGATGTGCGAAGGGGCAAG
Drosophila_yakuba|434         AAGCCCAAAACCTGCATCAATGAGCACGAACTCAGCGACGAGGATGTGCGAAGGGGCAAG
Drosophila_sechellia|3298     AAGCCCAAAACCTGCGTCAATGAGCACGAGCTCAGCGACGAGGATGTGCGAAGGGGCAAG
Drosophila_simulans|10317     AAGCCCAAAACCTGCATCAATGAACACGAGCTCAGCGACGAGGATGTGCGAAGGGGCAAG
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     GGCCCCGAGGAGTCGGCTCCGATGCGTCGGCGCGGAAAGTTGCGCCGCAAAAAACGCAAG
Apis_mellifera|36884          TCAAATAAGGAAGTGACAATTGTACGTAGAAGAGGAAAA---CGATTACGAAAAAGAAAG
Apis_mellifera|34772          TCAAATAAGGAAGTGACAATTGTACGTAGAAGAGGAAAA---CGATTACGAAAAAGAAAG
Linepithema_humile|3366       AGCGAGCAGCAACCAGTAATTATTCGAAGACGGGGAAAG---CGATTGCGTAAAAGAAAG
Pogonomyrmex_barbatus|12521   TCACTTAAAGAAATTGTGTTACCATCGCTTATCGGTGAA---AGAGTTCGTCCCGGAACG
Branchiostoma_floridae|41038  ACCCCTGAACCTCCCGAAGAGCCAGAACTTGCCTGGGATGAGGAGGAGAAACAGGAGGAG
Nematostella_vectensis|9509   GCGCCAGCTACACCAGCAAAGACAGAGCAACTGAAAAAGCCTAGAGCCAAACCAACATTT
                                                                                          

Daphnia_pulex|7052            GGTAAAAAGCTGCCGAAGCAGTCTTCATCCAAAGGAGCAAGAAGCTTACGCAACCCG---
Tribolium_castaneum|9225      AAAAGGCGCAAGAAGCGGGAAGGCTCTGGGGCACCGGCTTTCCAGACCTCAGTGGACCCG
Pediculus_humanus|256         AAAACATTGAAAGAAAGAGGAAAAGAAGGTGAAAAAGAATTCAAAGGAATACCAGATCCA
Culex_quinquefasciatus|4487   CCAACCCCGATGACCTGTATCAACGCGATGGAGGACGCTTCACGGCCCAACCAGGACCCG
Drosophila_melanogaster|11966 AAACGCAAGAAGTTGAAGCCAGCTCAAGCCACCACCACATTCCACTTGAGTGAGGATCCC
Drosophila_yakuba|434         AAGCGCAAGAAGTTGAAGCCAGCTCAAGCCACCACCACATTCCACCTAAGTGAGGATCCC
Drosophila_sechellia|3298     AAACGCAAGAAGTTGAAGCCAGCTCAAGCCACCACCACATTCCATTTGAGTGAGGATCCC
Drosophila_simulans|10317     AAACGGAAGAAGTTGAAGCCAGCTCAAGCCACCACCACATTTCACTTGAGTGAGGATCCC
Daphnia_pulex|4390            ---------------------GGCGGAGCAGAGCATTACGAA------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     TGTCGTCGGGGCTCGATCTACGGCCAACAGACCGAGGTCCGCGAGCCACCTGAGCCTCTC
Apis_mellifera|36884          CATAGAAGAGGATCAGGCTATGGACAACAAACAGAAGTTCGTGACTTATTTGAAACAACA
Apis_mellifera|34772          CATAGAAGAGGATCAGGCTATGGACAACAAACAGAAGTTCGTGACTTATTTGAAATAACA
Linepithema_humile|3366       TGTAGGAGGGGCTCGACTTACGGCCAGCAAACGGAAGTTCGCGATCCGCTCGAGCCTGCG
Pogonomyrmex_barbatus|12521   CGGAGAAAGAGGCCGACA---GCGGCAGCGAACAGCAACCGGCAATTACACGAAGACGGG
Branchiostoma_floridae|41038  GAACAACCAAAGCCACCTTCGCCACCTCCCACCCCTCCAAGGGAGCCAACACCCCCTCCA
Nematostella_vectensis|9509   GAGAGGCGTGAGGCTGATATCAAGTCACAGCACAAACCAAGTCAACTG------------
                                                                                          

Daphnia_pulex|7052            ---------------------------------------------------GATACATCG
Tribolium_castaneum|9225      ---------------------------------------------------GAAACACAG
Pediculus_humanus|256         ------------------------------------------------AACGAAACTCAA
Culex_quinquefasciatus|4487   ---------------------------------------------------GAGACCGCG
Drosophila_melanogaster|11966 ---------------------------------------------------GAGACGCAG
Drosophila_yakuba|434         ---------------------------------------------------GAGACGCAG
Drosophila_sechellia|3298     ---------------------------------------------------GAGACGCAG
Drosophila_simulans|10317     ---------------------------------------------------GAGACGCAG
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ---------------------------------------------------GAGACCCAA
Apis_mellifera|36884          ---------------------------------------------------GAAACTCAA
Apis_mellifera|34772          ---------------------------------------------------GAAACTCAA
Linepithema_humile|3366       ---------------------------------------------------GTAACCCAG
Pogonomyrmex_barbatus|12521   GAAAGCGATTGCGTAAAAGAAAGTGTAGAAGGGGCTCGACGTATGGCCAACAAACGGAAG
Branchiostoma_floridae|41038  CGAGAGCCCACACCCCCTCCGAGGGAACCTACACCCCCTCCGAGGGAACCCACACCCCCT
Nematostella_vectensis|9509   ---------------------------------------------------CCAACACCA
                                                                                          

Daphnia_pulex|7052            GTTTTG------------------------------------------------GACGAA
Tribolium_castaneum|9225      GTCGCTACGATTGGTCCCGACTCACACAACCCCAGTGCTCGCCCTTCT------CTAGTC
Pediculus_humanus|256         GTATCGGCAATAGGTAGCGATTCGATGAATAGCAGTTCGAGACATTCATTTTCGGGAGAT
Culex_quinquefasciatus|4487   GTGGCCACCATCGATCCGGACTCGCCCAACTACTCGGCCCGTCCGTCG------CTGGTG
Drosophila_melanogaster|11966 GTGGCTGCTTTGGGTCCCGATTCACTGAATCCCAGCACCAGACCAAGT------TTGATA
Drosophila_yakuba|434         GTGGCTGCTTTGGGTCCCGATTCACTCAATCCCAGCACCAGACCAAGT------TTGATA
Drosophila_sechellia|3298     GTGGCTGCTTTGGGTCCCGATTCACTGAATCCCAGCACCAGACCAAGT------TTGATA
Drosophila_simulans|10317     GTGGCTGCTTTGGGTCCCGATTCACTGAATCCCAGCACCAGACCAAGT------TTGATA
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     GTCTCGCAGATCGACGAGGGTTCTAGGAGGGGGTCATTATGCACAAAT------CGGTTG
Apis_mellifera|36884          ATCTCACACATAGGAGATGGATCTAGAAGAACATCAATTCATACAAAT------AATGAT
Apis_mellifera|34772          ATCTCACACATAGGAGATGGATCTAGAAGAACATCAATTCATACAAAT------AATGAT
Linepithema_humile|3366       GTCTCGCAGATCGGAAATGGATCACGGCGACCGTCGCTTCATGTGGAT------ACTGGC
Pogonomyrmex_barbatus|12521   TTCGCGATCCTCTCGAGCCCACGGTTACGCAGGTCTCACAAATCGGAA------ACGGAT
Branchiostoma_floridae|41038  CCAAGAGAACCCACACCCCCTCCTAGGGAACCTACACCCCCTCCAAGAGAGCCCACACCA
Nematostella_vectensis|9509   TGGGTTGAACCAGAACCAGAAGCTGAGAAACAAGAGGTAAAAGAAGAG------CAGAAA
                                                                                          

Daphnia_pulex|7052            AATGATGAGCCGGTT------------------------------------------TTT
Tribolium_castaneum|9225      CCAGCTACTCCCGAA------------------------------------------GAA
Pediculus_humanus|256         GAAAAAACATCTGAAAATATCGTGGAA------------------------------GAA
Culex_quinquefasciatus|4487   CCAACCGGTCGCAGT------------------------------------------CTG
Drosophila_melanogaster|11966 CCC---AACTCACTC------------------------------------------ACC
Drosophila_yakuba|434         CCC---AACTCACTC------------------------------------------ACC
Drosophila_sechellia|3298     CCC---AACTCACTC------------------------------------------ACC
Drosophila_simulans|10317     CCT---AACTCACTC------------------------------------------ACC
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ---------------------------------------------------------CAG
Nasonia_vitripennis|12741     GAAGAAACGAGGCAA------------------------------------------GCC
Apis_mellifera|36884          GATGTGGAAAACGTA------------------------------------------ACG
Apis_mellifera|34772          GATGTGGAAAACGTA------------------------------------------ACA
Linepithema_humile|3366       GAAATCGATGAT---------------------------------------------TCG
Pogonomyrmex_barbatus|12521   CACGGCGAGCGTCGT------------------------------------------CAG
Branchiostoma_floridae|41038  CCTCCAGAGCCAGAGAAAGAGCCAACACCACCCCCATCCCCTCCCCCTGTGGAAAAGGCC
Nematostella_vectensis|9509   GAAGAAGAGAAA---------------------------------------------CCA
                                                                                          

Daphnia_pulex|7052            CTGGATCCA---------------------------------------------------
Tribolium_castaneum|9225      ACTCTAGAGGTTCCCGAATCGGGGAAAAGGTCCGCCAGGCCCTCAAAATGC---------
Pediculus_humanus|256         ATAATACCAACGATAGTAAAAGAAGATGTTGAAATAGATGAAAATAAAAAA---------
Culex_quinquefasciatus|4487   CTCAGTTCCGGGGCCGAGTCGCCTCCGAGGGCCAGCGTCGAGGAACAGATC---------
Drosophila_melanogaster|11966 TTGTTGCCC---------AAGGACAAGCGAGAAACTGAACGGGAACCGATC---------
Drosophila_yakuba|434         TTGTTGCCC---------AAGGATAAGCGTGAAACTGAGCGAGAACCGATC---------
Drosophila_sechellia|3298     TTGTTGCCC---------AAGGACAAGCGAGAAACGGAGCGGGAACCGATC---------
Drosophila_simulans|10317     TTGTTGCCC---------AAGGACAAGCGAGAAACTGAGCGGGAACCGATC---------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      GTAACGCCC---------------------------------------------------
Nasonia_vitripennis|12741     TCCTTGGAC---------AAAGGCACTTTGCCAGCAATCAAGCAC---------------
Apis_mellifera|36884          AGCACTCCT---------AAGAAAACTTCTCCAATAAATAATAAATTTTCC---------
Apis_mellifera|34772          GGCACTCCT---------AAGAAAACTTCTCCAATAAATAATAAATTTTTC---------
Linepithema_humile|3366       GCGACTCCT------------AAGAAATCGCCCGCGCAAGCAACGAGTCAC---------
Pogonomyrmex_barbatus|12521   CTGCACGTAAATACTAGCGAGGGTGACAGTTCAGCGGATTCCAAGAAAACGTCCGCGCAG
Branchiostoma_floridae|41038  CCCACCCCTCCGCCACCGTCCCCAACCCCTGAGGTAGAAGAACACCCAGTAGAAGTTGCC
Nematostella_vectensis|9509   CCAACACCTGCTTCATTAGAACCTGAGAGGCTTCCAGACCCAGAGTTTGTC---------
                                                                                          

Daphnia_pulex|7052            ---------------AAACTGAACGGAGCT------------------------------
Tribolium_castaneum|9225      ---------------TGGGATATTGACTCG------------------------------
Pediculus_humanus|256         ---------------------------TCA------------------------------
Culex_quinquefasciatus|4487   ---------------GAGTACATCGAGTGC------------------------------
Drosophila_melanogaster|11966 ---------------CTCTTGAAGGGCAGT------------------------------
Drosophila_yakuba|434         ---------------CTCCTGAAGGGCAGT------------------------------
Drosophila_sechellia|3298     ---------------CTCTTGAAGGGCAGT------------------------------
Drosophila_simulans|10317     ---------------CTCTTAAAGGGCAGT------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ---------------GACATGCCGCCGAGC------------------------------
Apis_mellifera|36884          ---------------ACAATGCTTCCCAGT------------------------------
Apis_mellifera|34772          ---------------ACAATGCTTCCCAGT------------------------------
Linepithema_humile|3366       ---------------ACGATACCTTCGAGC------------------------------
Pogonomyrmex_barbatus|12521   CGGCCAACAAACCAGATGTTGCCTTCGAGT------------------------------
Branchiostoma_floridae|41038  CCACCCCTGGTGGAAGAAGAACCCCCAGCCCCGACACCCTCACCTGAACCAGTTGTAGAG
Nematostella_vectensis|9509   ---------------AGAGCCCCAGGTGCC------------------------------
                                                                                          

Daphnia_pulex|7052            ------------------------------------------------------------
Tribolium_castaneum|9225      ------------------------------------------------------------
Pediculus_humanus|256         ------------------------------------------------------------
Culex_quinquefasciatus|4487   ------------------------------------------------------------
Drosophila_melanogaster|11966 ------------------------------------------------------------
Drosophila_yakuba|434         ------------------------------------------------------------
Drosophila_sechellia|3298     ------------------------------------------------------------
Drosophila_simulans|10317     ------------------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------------------------------
Apis_mellifera|36884          ------------------------------------------------------------
Apis_mellifera|34772          ------------------------------------------------------------
Linepithema_humile|3366       ------------------------------------------------------------
Pogonomyrmex_barbatus|12521   ------------------------------------------------------------
Branchiostoma_floridae|41038  GACCCTCCACCTGAGTTGATAGCAAACCCCAACTGTATGAGGTTTGCTATCAACTGGAGG
Nematostella_vectensis|9509   ------------------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ---------TTCATA---AACGAAGTCGGTGCTCAACCACCAATTGAGGTTTGTGAAGAA
Tribolium_castaneum|9225      ---------TTCCTAGACGTCGAAATTTTGAAACAATTAAGGCGCGAGTTGGACGAGGAA
Pediculus_humanus|256         ---------TTTTTATCAAAAGATATTTTAAAACAACTTCAAAGACAGTTAGATCAAGAA
Culex_quinquefasciatus|4487   ---------TTCCTGGACGACGAAGCGCTCTGTCTGCTCCGCCGTGGACTCAACATCGAC
Drosophila_melanogaster|11966 ---------TTCCTTACCGATGAAGCTTTTCAGGCGCTGAAAACCGATTTGGATGTGGAT
Drosophila_yakuba|434         ---------TTCCTCACCGATGAAGCCTTTCAGGCGTTGAAAACCGATTTAGATGTGGAT
Drosophila_sechellia|3298     ---------TTTCTCACCGACGAAGCTTTTCAGGCGCTGAAAACCGATTTGGATGTTGAT
Drosophila_simulans|10317     ---------TTCCTCACCGATGAAGCTTTTCAGGCGTTGAAAACCGATTTGGATGTGGAC
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ---------TTTCTACCACCGGAAGTCCTGAAAGAACTGAGCAGAGAGCTGGATCGGGAA
Apis_mellifera|36884          ---------TTTATTGATGAAGATATCTTGAAGCATTTATGCAGAGAATTAGACAGCGAT
Apis_mellifera|34772          ---------TTTATTGATGAAGATATCTTGAAGCATTTATGCAGAGAATTAGACAGCGAT
Linepithema_humile|3366       ---------TTCCTCGCACCTGACATTCTAAAGCACTTATGTCGAGAACTAGATCGCGAC
Pogonomyrmex_barbatus|12521   ---------TTCCTCGCACCAGATATTTTGAAGCATTTGTGCAGAGAGTTAGACCGCGAC
Branchiostoma_floridae|41038  TCAGAGGTCATCTTAAGTGATGAGGAGATGGAGGAACCCACGACAGAAGCTCCTCAAGAG
Nematostella_vectensis|9509   ---------TATAAAATGTACCAGCCAATTGACTTATTGGAATATGGGTTAGACAACGCT
                                                                                          

Daphnia_pulex|7052            GCGGTAAAAAACAAG---------------------------CAACACTCTGTAGAAGAT
Tribolium_castaneum|9225      GTTATTGATAATGAATTCAACCAGAAACGACGAACGGCTCTACAAGAAGCGTTAAAAACC
Pediculus_humanus|256         GTTGTCGATTCCGAACTTAATTTTAACAGAAGAAAAGCTTTGGAAGAAGCTTTACATCAC
Culex_quinquefasciatus|4487   ATCGTCGAGTCCGTCTTTGAGCGTTACAAAGCACGAGCCATGCGGGAAGCGTTCCGAACG
Drosophila_melanogaster|11966 CTTATTGAAAATACTTTTGGTCGATATCTCAATAGAGCTCTAAGAGAGGCCATCAAGTAC
Drosophila_yakuba|434         CTTATAGAAAACACCTTTGGAAGATACCTTAATAGAGCTCTTAGAGAGGCGATTAAGTAC
Drosophila_sechellia|3298     CTTATTGAAAACACTTTTGGTCGATATCTCAATAGAGCTCTAAGAGAGGCCATCAAGTAC
Drosophila_simulans|10317     TTAATAGAAAACACTTTTGGTAGATATCTCAATAGAGCTCTAAGAGAGGCCATCAAGTAC
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     GCGGTGGAATGGGAGTTCAATGCCAAAAGAAGAATAGCTCTGGAGGAAGCCTTGAGAGTC
Apis_mellifera|36884          AAAGTGGAAGCAGAGTTTTCAATTCGAAGAAAGATTGCATATGAGGAAGCTTTGCGTGTA
Apis_mellifera|34772          AAAGTGGAAGCAGAGTTTTCAATTCGAAGAAAGATTGCATATGAGGAAGCTTTGCGTGTA
Linepithema_humile|3366       AAGGTGGAGGCGGAATTTTCAATCAAGAAAAGAATCGCCTTGGAGGAAGCATTAAGAGTG
Pogonomyrmex_barbatus|12521   AAAATAGAGGCAGAATTCTCGATCAAGAGACGAATCGCATTAGAAGAAGCGTTACGAGTG
Branchiostoma_floridae|41038  GAGGAGGATGGCAAGAAAGGGAGGAAGAAGTCAGCCAAGGGGAAGAAGAAGAAGAAAAGG
Nematostella_vectensis|9509   CGGCGGAACCAAACA------GCTAAACGGTCTACTCCTGCTGTAAATCCAATGCCGCAA
                                                                                          

Daphnia_pulex|7052            CTCGGGGAA---------------------------------------------------
Tribolium_castaneum|9225      ATCCCGAAGGACAAAATAAAT---------------------------------------
Pediculus_humanus|256         AAATCAAAGGTAAAATATAATCAACAG---------------------------------
Culex_quinquefasciatus|4487   GCAACCACCGACAAGCTGGACTTCCAG---------------------------------
Drosophila_melanogaster|11966 ATGCCACCC---------------------------------------------------
Drosophila_yakuba|434         ATGCCCCCA---------------------------------------------------
Drosophila_sechellia|3298     ATGCCACCC---------------------------------------------------
Drosophila_simulans|10317     ATGCCACCC---------------------------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     AGCGGTGGC---------------------------------------------------
Apis_mellifera|36884          AAAGGTGAG---------------------------------------------------
Apis_mellifera|34772          AAAGGTGAG---------------------------------------------------
Linepithema_humile|3366       AAAGGTGAC---------------------------------------------------
Pogonomyrmex_barbatus|12521   AAAGGTGAT---------------------------------------------------
Branchiostoma_floridae|41038  AAAGCCCCGCCCAAAGTGGAGAAGACACCAGTACCTAGTGCCTTGCTCATGGATGCCTCG
Nematostella_vectensis|9509   GGGCCCAGT---------------------------------------------------
                                                                                          

Daphnia_pulex|7052            ---------------------------AGTCTACGTAATCTCCAAGTCGAAGACGACCAC
Tribolium_castaneum|9225      ---------------------------TGCGAGGCCTTGATTAAGGTCCAAAACGAATTA
Pediculus_humanus|256         ---------------------------GGAGAAGAAATAAAACAACTCAAAAAAGATTTT
Culex_quinquefasciatus|4487   ---------------------------TCGCGAGCCGTCAAGCAGCTGGAGGAGACGCTG
Drosophila_melanogaster|11966 ---------------------------AAACCCAAAACTGTTCCGAAGCCCGTCGACGAT
Drosophila_yakuba|434         ---------------------------AAACCGAAAACTGTGCCGAAGCCAGTCGATGAT
Drosophila_sechellia|3298     ---------------------------AAACCCAAAACTGTGCCGAAGCCCGTCGATGAT
Drosophila_simulans|10317     ---------------------------AAACCCAAAACTGTGCCGAAGCCAGTCGATGAT
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------------------------AGAGCTGCGCCTCCCCGACAAAGT
Apis_mellifera|36884          ---------------------------AATTATTTACATTCAAAACAATCTCAAATATTT
Apis_mellifera|34772          ---------------------------AATTATTTACATTCAAAACAATCTCAAATATTT
Linepithema_humile|3366       ---------------------------GCTTATTCAACCCTGCGCGGATCTCGACAAGCT
Pogonomyrmex_barbatus|12521   ---------------------------GCGTACTCGACTCTGCGTGGATCTCGTCAAACC
Branchiostoma_floridae|41038  GAGATCTTAAACATGGAGATGAAGATGAGGAGGAAGAATCTCTTGGAGAACAAGGCGGAA
Nematostella_vectensis|9509   ---------------------------TACCACCAAATGCTCCCTGAAAGCAGCCTAGTC
                                                                                          

Daphnia_pulex|7052            AACGGGAATAATGACGTCTTGTATCAAGTTGAAGGCACAGTCGCAGTGGAAGACATGTCC
Tribolium_castaneum|9225      AAATTGCCTCCTGTTAACACAGAACTT---------------------------------
Pediculus_humanus|256         CATTTATCTATAAAAAATTCGGAAAAT---------------------------------
Culex_quinquefasciatus|4487   GACATCCACGACATCGACCACGAGAAG---------------------------------
Drosophila_melanogaster|11966 AAAGTTTCACCAGAAACAACATCCAAA---------------------------------
Drosophila_yakuba|434         AAAGTTCCACCAGAAACAACGTCCAAA---------------------------------
Drosophila_sechellia|3298     AAAGTTCCACCAGAAACAACGTCCAAA---------------------------------
Drosophila_simulans|10317     AAAGTTCCACCAGAAACAACGTCCAAA---------------------------------
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     CCAGTCCAGCCCATCAGCCAGTCTACC---------------------------------
Apis_mellifera|36884          TCAAATCCTGTACTAATAAATACA------------------------------------
Apis_mellifera|34772          TCAAATCCTGTACTAATAAATACA------------------------------------
Linepithema_humile|3366       AGTGCCAGTTTGTTGGCACAAAACGCT---------------------------------
Pogonomyrmex_barbatus|12521   AGTGCCAGCCCGTTAGTGGAAAATGCT---------------------------------
Branchiostoma_floridae|41038  AACGACGCCATCGTTGCGGAGGTTCAGGAGTTTGAGGTGAAGCGACCCAAACAGCAAGCG
Nematostella_vectensis|9509   ATCAATGCCATCATGGATGAGGAGAAG---------CGTAAACGTGAAGGCATGAAACCA
                                                                                          

Daphnia_pulex|7052            TGGCTGTATTTTCCGCGAGCTGGCAACAATTTCGGAGCACGGTTTGAATTGCCCATAGAT
Tribolium_castaneum|9225      TGGCTGTCTCTACCGCGGGTTTTTTCGCGCTCTAGTGCCCGCTTTGAGCTGCCTCTGGAC
Pediculus_humanus|256         TGGTTATCCATTCCAAGAGTTTTCACAAGACGTTGTGCCAGATTTGAATTGCCAATGGAT
Culex_quinquefasciatus|4487   TGGATCGACCTGCCGCGCAAGTACTCGCGATCGTCGGCCCGCTTCGAACTCCCGATGGAC
Drosophila_melanogaster|11966 ---------ATGCCGCGAAAGTTCTCAAAATCAGCGACAAGATTCGATGTACCCATGGAC
Drosophila_yakuba|434         ---------ATGCCGCGAAAGTTCTCCAAATCAGCGACCAGATTCGATGTACCGATGGAT
Drosophila_sechellia|3298     ---------ATGCCGCGAAAGTTCTCCAAATCAGCGACCAGATTCGATGTACCCATGGAC
Drosophila_simulans|10317     ---------ATGCCGCGAAAGTTCTCCAAATCAGCGACCAGATTCGATGTACCCATGGAC
Daphnia_pulex|4390            ------------AATGCTAAAATGATGAAAAGAGCTAATCGAGCAGGATTGCCACATGAT
Tribolium_castaneum|9226      ------------CCCAAAGGTCAAATAAAACAA---------------------------
Nasonia_vitripennis|12741     ---------GTGCCTCGCCTCTTCTATCGTCAGAGCGCCAGGTTCGAGTTG---CTCGAC
Apis_mellifera|36884          ------------CCGCGAGCATTTTCGCGCCAAACAGCTCGATTTGAAATT---CTTAAT
Apis_mellifera|34772          ------------CCGCGAGCATTTTCGCGCCAAACAGCTCGATTTGAAATT---CTTAAT
Linepithema_humile|3366       ------------CCCCGAATATTTTCCCGTCAAGCGGCGCGGTTTGAGTTA---CTCGAC
Pogonomyrmex_barbatus|12521   ------------CCCCGAATATTCTCTCGTCAAGCGATGCGATTTGAATTG---CTCGAT
Branchiostoma_floridae|41038  TGGCTGCAGGGGAGACTGGCCCTGTCCAGACAGATCAGCAGATTTGAGCTGCCTATGGAC
Nematostella_vectensis|9509   TGGCTACAGGGGAGACTTGCCCTCTCTAAACAGACCAGTAGATTTGAGTTACCAATGGAT
                                          .           :  ..                               

Daphnia_pulex|7052            TTGAGAAAACTAAAAAGTACGTACACAATTGATAAGAAACGATTTCTGTCAATCGACTTT
Tribolium_castaneum|9225      AGCAGAACGCTGGAAACC------------------------------------------
Pediculus_humanus|256         AGTAGATTATTAAATGAC------------------------------------------
Culex_quinquefasciatus|4487   ACGCGAACTCTTTCCACA------------------------------------------
Drosophila_melanogaster|11966 CTTTCCATGCTAAAAAAT------------------------------------------
Drosophila_yakuba|434         CTTTCCATGCTAAAAAAT------------------------------------------
Drosophila_sechellia|3298     CTTTCCATGCTAAAAAAT------------------------------------------
Drosophila_simulans|10317     CTTTCCATGCTAAAAAAT------------------------------------------
Daphnia_pulex|4390            GAAGGAAGC---------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     AGCCAGTCTCTGGTCGGC------------------------------------------
Apis_mellifera|36884          AGTGAAAGTTTACGTGGT------------------------------------------
Apis_mellifera|34772          AGTGAAAGTTTACGTGGT------------------------------------------
Linepithema_humile|3366       AGTCAAAGTCTTCGAGGA------------------------------------------
Pogonomyrmex_barbatus|12521   AGTCAAAGTCTTTGCGGA------------------------------------------
Branchiostoma_floridae|41038  ATGAGACTACTAGAAGGG------------------------------------------
Nematostella_vectensis|9509   GTTAAAGTTTTAGAGTCA------------------------------------------
                                                                                          

Daphnia_pulex|7052            GTTAAAGATGATTTTACCTGCACAGAGATGACTCCTCTTGAATACTTGTCGCAATATGTT
Tribolium_castaneum|9225      ---------------------------ATGACACCGCTACAGTACATCCAAAACAATGTC
Pediculus_humanus|256         ---------------------------ATGACACCTTTGAATTATTTACAAAATTATTCG
Culex_quinquefasciatus|4487   ---------------------------ATGACCCCGATCGAGTACCTGAAGCGGCACGTC
Drosophila_melanogaster|11966 ---------------------------ATGACCCCGTGGGATTATTTGAGCAAGTACGTC
Drosophila_yakuba|434         ---------------------------ATGACGCCCTGGGATTATTTGAGCAAGTGCGTC
Drosophila_sechellia|3298     ---------------------------ATGACACCGTGGGATTATTTGAGCAAGTGCGTC
Drosophila_simulans|10317     ---------------------------ATGACACCGTGGGATTATTTGAGCAAGTGCGTC
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ---------------------------CTGAAACCTCTGGACTACCTGGGCCGCTACGTC
Apis_mellifera|36884          ---------------------------GTAACAATCTTGGAATATCTTAGCAGACACGTA
Apis_mellifera|34772          ---------------------------GTAACAATCTTGGAATATCTTAGCAGACACGTA
Linepithema_humile|3366       ---------------------------TTAAAGCCAATTCAATACCTTACTAAGCACGCG
Pogonomyrmex_barbatus|12521   ---------------------------CTAACGTCGCTGCAATATCTCAGCAAATATGCT
Branchiostoma_floridae|41038  ---------------------------ATGAGTCCTATTGAGTACCTGTCTAACTACTGC
Nematostella_vectensis|9509   ---------------------------ATGTCAGCGATGGATTACCTAACACAGTACTGT
                                                                                          

Daphnia_pulex|7052            GTCGCGACGCGTTGCCGGCAAAGACTAAATGACGTAGTCTTT------------------
Tribolium_castaneum|9225      AGTATCACGAGCCCTAGGAAACTGTTGTATAATTGCATTTTC------------------
Pediculus_humanus|256         TTTCCATCTCAATCGAGACTTTTACTTTATAATCACGTATTT------------------
Culex_quinquefasciatus|4487   GTCCTCTGTGACGATCGCAAGAAGCTGTTCCATCGGATCTTCTGCCGGAACCTGCCCTCC
Drosophila_melanogaster|11966 TGGGTGTCGCAACAGAGAAAACAGCTGTATAAACGAGTATTC------------------
Drosophila_yakuba|434         TGGGTATCGCATCAGAGAAAACAGCTGTATAAGCGAGTATTC------------------
Drosophila_sechellia|3298     TGGGTGTCGCAACAGAGAAAGCAGCTGTATAAACGAGTATTC------------------
Drosophila_simulans|10317     TGGGTGTCGCAACAGAGAAAGCAGCTGTATAAACGAGTATTC------------------
Daphnia_pulex|4390            ------------------------ATTTTCCATCACAACTGG------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     TACGTGAGCGACACCCGCAAGTCCATGTTCAGTCGGGTTTTC------------------
Apis_mellifera|36884          TTTGTTTCCTCGGGAAGGAAACATATTTTTGCTAGAGTTTTC------------------
Apis_mellifera|34772          TTTGTTTCCTCGGGAAGGAAACATATTTTTGCTAGAGTTTTC------------------
Linepithema_humile|3366       TACGTCACATCGGGAAGAAAACAAATATTCGGTCGAATATTC------------------
Pogonomyrmex_barbatus|12521   TACATCACGTCAGGAAGAAAATTAATATTTGGTCGAATATTT------------------
Branchiostoma_floridae|41038  ATTGTGAGCAAGAGGAGACAGAACCTGTACAAGCAGTCCTTC------------------
Nematostella_vectensis|9509   ATTATAAGCACAAGAAGAAAAGCACTGTACAAGAATATTTTT------------------
                                                                                          

Daphnia_pulex|7052            ------------------GAACGACACGCCACAGAG------------------------
Tribolium_castaneum|9225      ------------------AACAAGTTCAAAATCGACGAGCTTGAGGCGACCAGTGAA---
Pediculus_humanus|256         ------------------AATTTATGTAAAGAAACAACAGAAGACGAACAAGAAGAAGAT
Culex_quinquefasciatus|4487   GACGACGGCAAACCAAACCAAGAGTTCAACGAGAACGACTCCATCCCGGAGACGGAAACG
Drosophila_melanogaster|11966 ------------------TTAAAGTATCTGAGTAGAATCGAGGAGCCGGAAAGCGAGTTG
Drosophila_yakuba|434         ------------------TTGAAGTACTTGAGTAGAATCGAGGAGCCGGAAAGCGAGTTG
Drosophila_sechellia|3298     ------------------TTGAAGTATCTGAGTAGAATCGAGGAGCCGGAAAGCGAGTTG
Drosophila_simulans|10317     ------------------TTGAAGTATCTGAGTAGAATCGAGGAGCCGGAAAGCGAGTTG
Daphnia_pulex|4390            ------------------GAGCAA------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------------------AACAAGTACCGCGAGGAGAGCAACGATTCTGGCCCA------
Apis_mellifera|36884          ------------------AACAAATTTCAAAAAGATATGATACAAAGTAAT---------
Apis_mellifera|34772          ------------------AACAAATTTCAAAAAGATATGATACAAAATAAT---------
Linepithema_humile|3366       ------------------AACAAATTTAATGAAGACTCGTTGCACAGCGCA---------
Pogonomyrmex_barbatus|12521   ------------------AATAAATTTAACGAAGAGGCGTTGCACAGCGCG---------
Branchiostoma_floridae|41038  ------------------ACAAAGGCAGACAGAGACAGGGAT------------------
Nematostella_vectensis|9509   ------------------CAGAAGACTGACAAGGATAGGGAT------------------
                                                                                          

Daphnia_pulex|7052            ---------------------------------------------TCAAAGCTCTCTACT
Tribolium_castaneum|9225      ---------------------------------------------AGAAAGATTCGAGGA
Pediculus_humanus|256         AATGAA---------------------------------------AGAATATTATTAGGA
Culex_quinquefasciatus|4487   CCCGTCCAGCTGGAAACGTTCAAGAACCTGCTGGCGGACGTGACGCGCCTCATCCCGATG
Drosophila_melanogaster|11966 GCCGCCATGGGAAATGATGAGCTGCCGGAATACAAATACCGTGAGAGAACCCTCGTCTGG
Drosophila_yakuba|434         GCCGCCATGGGAAATGATGAGCTGCCGGAATACACATACCGCGAAAGAACCCTCGTCTGG
Drosophila_sechellia|3298     GCCGCCATGGGCAATGATGAGCTGCCGGAATACAAATACCGTGAAAGAACCCTCGTCTGG
Drosophila_simulans|10317     GCCGCCATGGGAAATGATGAGCTGCCGGAATACAAATACCGTGAAAGAACCCTCGTCTGG
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ---------------------------------------------CGTTACATGCTCGCT
Apis_mellifera|36884          ---------------------------------------------AAATATGTTTTACCA
Apis_mellifera|34772          ---------------------------------------------AAATATGTTTTACCA
Linepithema_humile|3366       ---------------------------------------------CGACGCATTTCGCCG
Pogonomyrmex_barbatus|12521   ---------------------------------------------CGACGCATTTCATCG
Branchiostoma_floridae|41038  ---------------------------------------------GGAATCATCAGTGTT
Nematostella_vectensis|9509   ---------------------------------------------GGGATTATATCATAT
                                                                                          

Daphnia_pulex|7052            GAGAAACTCTTCCTTTCTCTAACCGAAATCCTCGGGTTCCACTTGGATTCGCAGGCAGAA
Tribolium_castaneum|9225      AAAGACATCCAGAGTGCGCTGAATTTGATGATGGGTAAAGCAATGACGCAGAAACAAGCG
Pediculus_humanus|256         AAGGTAAATTTAACTCGTTTGGAAAAAATTATGGGTAGGAGTATGACGAATGAAATAATA
Culex_quinquefasciatus|4487   GCCAACTTTGACAAGGCGATGCACGAGGCGCTCGGCTTCCACGGCACGCCCGAGAAGATC
Drosophila_melanogaster|11966 CAGAGTCTGCCGCAAGCTCTCGAGGATGTTCTGGAGTTCCATGGCACCGAGGAAAATGTA
Drosophila_yakuba|434         CAGAGCCTGCCACAAGCTCTCGAGGATGTCCTGGAGTTCCATGGCACCGAGGAAAACGTG
Drosophila_sechellia|3298     CAGAGTCTGCCACAAGCTCTCGAGGATGTTCTGGAGTTCCATGGCACCGAGGAAAATGTA
Drosophila_simulans|10317     CAGAGTCTGCCACAAGCACTCGAGGATGTTCTGGAGTTCCATGGCACTGAGGAAAATGTA
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     CGACATCTAGCCGAGGCGCTGCACGAAGTCATGGGCCGAGAGCTTGCTTCCTCTGAGATA
Apis_mellifera|36884          AACGACATCCATGAAGCTCTTCAAGATATAATTGGGAAACCTATAACTCAGGAACAAGAA
Apis_mellifera|34772          AATGACATCCATGAAGCTCTTCAAGATATAATTGGGAAGCCTATAACTCAGGAACAAGAA
Linepithema_humile|3366       ACCGACGTTGAAGAGGCCCTTCAGGAAATGATTGGGAAGGCGTTGACGGACGAGCAGAGA
Pogonomyrmex_barbatus|12521   TGCGACATTGAGGAGGCTCTTCAGGAAGTAGTCGGGAGAATATTGAGTGACGAAGAGCGA
Branchiostoma_floridae|41038  AAGGAATTAGACAAGGCACTGAAACAAATCCACGTGGACGGCGTCACTACCGAGCAAGTC
Nematostella_vectensis|9509   AGGGAACTAGACAAGGCACTCAAGGAGGTTCATGTTGATTCCATCAACACAAGTCAAGTG
                                                                                          

Daphnia_pulex|7052            GAAAAACTGTCCGAGTTGATAGAC------TTGGTT------TCCGTTTCTGAGCTTACC
Tribolium_castaneum|9225      ACGTACATTCGCGATTTGATTGGC------TGGAGG------GACGATGACGTCATGGAT
Pediculus_humanus|256         GAAAATTTTCAAAATTTAATCGGT------TGGAAA------AACGATGAAAAATTAAAT
Culex_quinquefasciatus|4487   TTCGAGATTCGCGAGCTGCTGGAGCTGAACTACGAGTACTACCAGGAGATTCCGATTGAC
Drosophila_melanogaster|11966 CAAGGCACACTGAGAATGTTGGGCTACGACGCCCAA------GCATCGGGTGACTTGGAC
Drosophila_yakuba|434         CAGGGCACACTAAGAATGTTGGGCTACGATGCCCAA------GGATCGGGTGACTTGGAT
Drosophila_sechellia|3298     CAAGGCACACTGAGAATGTTGGGCTACGACGCCCAA------GTATCGGGTGACTTGGAC
Drosophila_simulans|10317     CAAGGCACACTGAGAATGTTGGGCTACGACGCCCAA------GTATCGGGTGACTTGGAC
Daphnia_pulex|4390            AAGATTATATCAAATGCGCTGGGA------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     GACTTTCTCGAGAACGCGCTCGGC---------GAG------AGGCGCGAACTTCTCGAC
Apis_mellifera|36884          ACGTATTTAAAACTTATAATTGGC---------GAG------ATTAAAGAACCCTTAAAT
Apis_mellifera|34772          ACGTATTTAAAACTTATAATTGGC---------GAG------ATTAAAGAACCCTTAAAT
Linepithema_humile|3366       TCTTATCTGAAGTCTGTTATAGGA---------GAT------ATAACGGAGTCGCTGGGC
Pogonomyrmex_barbatus|12521   TCTTATCTGAAGTCTCTGATAGGA---------GAT------ATAACGCAGCCGCTCGGT
Branchiostoma_floridae|41038  CAGAAAATCCTCGACGTCATCCAG------GCCACT------GATGACACCAAATTCGAC
Nematostella_vectensis|9509   AGACAAATAGCAGAGATGGTTGAG------GCAGAT------GACAAAACAAAATTCAAC
                                                                                          

Daphnia_pulex|7052            CGAGAGCAGTTCGCTGGTATTGGAGCACTAGCCGAACGCATCGGACGCAGT---------
Tribolium_castaneum|9225      TTTAAAACGTTTTGCGGTTTGTGCGCCCTCTGTGAACGCCTATTGGCTCCTGAGTACTGT
Pediculus_humanus|256         TTTCGAACTTTTACCGGTATTTGTGCCATTTGCGAAAGGATTTTAGGACCGAAATATTTT
Culex_quinquefasciatus|4487   TTCCGGTCCTGGTGTGGGATTGTGGCGTTTGCGGAGCGGTTTATCATCACG---------
Drosophila_melanogaster|11966 TTCCGCGCCTGGTGCGGAATTGTCTCCTTCGCCGAAAGATTGGCCCTAGCT---------
Drosophila_yakuba|434         TTCCGCGCCTGGTGCGGAATTGTGTCCTTCGCCGAAAGATTGGCACTTGCT---------
Drosophila_sechellia|3298     TTCCGCGCCTGGTGCGGAATCGTCTCCTTCGCCGAAAGATTGGCCCTAGCT---------
Drosophila_simulans|10317     TTCCGCGCCTGGTGCGGAATCGTCTCCTTCGCCGAAAGATTGGCCCTAGCT---------
Daphnia_pulex|4390            ------TCATACGCT---------------------------------------------
Tribolium_castaneum|9226      TATTTAGCGTGGTGCTCCATT---------------------------------------
Nasonia_vitripennis|12741     TTCAGAACCTGGTGCGGCGTCTGCGCGTTCGCCGAGCGCGGTTTGCCCGAG---------
Apis_mellifera|36884          TTTAGAAGTTGGTGTGGTTTGTGTGCCGCGGTGGAACGATTATTTTGTTCT---------
Apis_mellifera|34772          TTTAGAAGTTGGTGTGGTTTGTGTGCCGCGGTGGAACGATTATTTTGTTCT---------
Linepithema_humile|3366       TTTAGGGAGTGGTGCGGACTGTGCGCTGCCGTCGAGAGGCTGTTGTGTCCT---------
Pogonomyrmex_barbatus|12521   TTTAGAGAGTGGTGCGGTTTGTGCGCTGCTGTCGAAAGACTGCTGTGTCCT---------
Branchiostoma_floridae|41038  GCCAAACTGTTCACCGCTGTCTGTGCCCTGGCTGAGAGGATGTTGTACACATACTTTGTT
Nematostella_vectensis|9509   CTAAAACAGTTCTCAGCTATTGCTGCATTCTCAGAAAGAATCCTGTTTGCAGACTTTGTA
                                       *                                                  

Daphnia_pulex|7052            ------------------GGCATC---AGTCGACGTGATGATCTAGAGTTGGCAGACTTT
Tribolium_castaneum|9225      GCGCAGTTGCCAGACCGCAAGAGC---GATCCTTGTCACGAAATTGAAACCGCCGATTTT
Pediculus_humanus|256         AAAAATATGCCAAATCAATCGAAA---GATCCGAGATATGAAATCGAAAGAGCCGATTTT
Culex_quinquefasciatus|4487   ---------CAGGACCGCGAGCTG---GACCCGTGCAATGAGCTGGAGATGGTGGACTTT
Drosophila_melanogaster|11966 ------GATGAATCCGGATCGGAT---GATTCGTGCGACGAGTTGGAAAAGGCCGATTTC
Drosophila_yakuba|434         ------GATGAGTCTGGATCGGAT---GATTCCTGCGACGAGCTGGAAAAGGCCGACTTC
Drosophila_sechellia|3298     ------GATGAGTCCGGATCGGAT---GATTCGTGCGACGAGTTGGAAAAGGCCGATTTC
Drosophila_simulans|10317     ------GATGAGTCCGGATCGGAT---GATTCGTGCGACGAGTTGGAAAAGGCAGATTTC
Daphnia_pulex|4390            ------GAAACAGGCAGG------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     ------CTGCCGAGGCGCGAGGAC---GATCCAGCTTCCTGGCTCGAGCGAGCCGATTTC
Apis_mellifera|36884          ------CTTCCTCTGAAAGAAATC---GATCCACCTACATGGCTCGAAAGAGTGGATTTT
Apis_mellifera|34772          ------CTTCCTCTGAAAGAAATC---GATCCACCTACATGGCTCGAAAGAGTGGATTTT
Linepithema_humile|3366       ------CTGCCGTCGAAGGAGACC---GATCCGCCGGCATGGCTCGAAAGAGCGGACTTT
Pogonomyrmex_barbatus|12521   ------CTCCCACCGAGGGAGAAC---GATCCGCCAACCTGGCTCGAAAGAACGGACTTC
Branchiostoma_floridae|41038  ACGGAAGACACTGATGACATCATGTACAGCCAGAAGGAGCGAGTGGAGGATGCAGACTTC
Nematostella_vectensis|9509   ACGGAAGAAACAAGAGGACTCAAT---AACACTCGGGAAATCATAGAAGAAGCCGACTTC
                                                                                          

Daphnia_pulex|7052            GATCTTTTACATAAAAAGATGTCTTATTTG---GAAATGAGCCAATTTCTCCGAAGATTA
Tribolium_castaneum|9225      GAAGCGCTAACAAGGAAATTACATGGGAAA---AAGGTGGACAAGAACTTGGTGGAGATC
Pediculus_humanus|256         GAAACTCTAGAATATAAATTAAAACGATTG---AAATTGGATAAAAGATTAGAAAATATA
Culex_quinquefasciatus|4487   GAGTCGCTGGAGCGACGGATTCGTTCGGCG---AAACCGTCGGAGAATCTTTGCAAAGTG
Drosophila_melanogaster|11966 AATAGCATGGAGCAAATAATGCCAAACTTC---ACTGTGCCCGAAAAGCTTAAGGAAATT
Drosophila_yakuba|434         AATAGCATGGAGCAAATAATGCCGGACTTT---ACTGTGCCCGAGAAGCTCAAGGAAATT
Drosophila_sechellia|3298     AATAGCATGGAGCAAATAATGCCGGACTTC---ACTGTGCCCGAAAAGCTTAAGGAAATT
Drosophila_simulans|10317     AATAGCATGGAGCAAATAATGCCGGACTTC---ACTGTGCCCGAAAAGCTTAAGGAAATT
Daphnia_pulex|4390            ------------------------------------------------------------
Tribolium_castaneum|9226      ------------------------------------------------------------
Nasonia_vitripennis|12741     GAGACGCTCGAGAGGAGGCTGAGAAACGTC---AGCGTCGACGAAAAACTCGCCGCTATG
Apis_mellifera|36884          GAAACGTTAGAACGAAGACTTAAGGCTATT---AATGTAGATCCTAAATTAGCACAATTT
Apis_mellifera|34772          GAAACGTTAGAACGAAGACTTAAGGCTATT---AATGTAGATCCTAAATTAGCACAATTT
Linepithema_humile|3366       GAAGCTCTAGAACGAAGACTCAAGTCAGTCGAATCACTAGACTCCACACTGGCATTATTG
Pogonomyrmex_barbatus|12521   GAAGATCTGGAACAAAGACTTAAATCAGCCGAATCAGTTGATCCCACATTGGCGTTATTG
Branchiostoma_floridae|41038  TGCGCTTTGGAGTGGAAACTACACGGTGTG---AAAGTCAACCCTCCCATCAGGAAACTA
Nematostella_vectensis|9509   TGCAGTTTAAAATCGAAATTGGATGGATTT---AAGGTCAGCCCAACAGTGAGAAAGATA
                                                                                          

Daphnia_pulex|7052            TTTTTGTTCATTAGTGAAATAGAAGATCTTGTC---TAA
Tribolium_castaneum|9225      CTGCAAGGGATTAAGACTCGC---------------TAG
Pediculus_humanus|256         TTAAAATCACTAAGAGATTTG---------------TAA
Culex_quinquefasciatus|4487   CTGCATATCATCAAAAGTAAC---------------TGA
Drosophila_melanogaster|11966 TTCGATGTAATTCGAAAGACACATAAAAAAAGATATTGA
Drosophila_yakuba|434         TTCGATGTAATTCGGAAAACACATAAAAATAGATACTGA
Drosophila_sechellia|3298     TTCGATGTAATTCGAAAGACACATAAAAATAGATATTGA
Drosophila_simulans|10317     TTCGATGTAATTCGAAAGACACATAAAAATAGATATTGA
Daphnia_pulex|4390            ------------------------------------TAA
Tribolium_castaneum|9226      ------------------------------------TAA
Nasonia_vitripennis|12741     CTCAGGCTCATTAGGGATCGC------------------
Apis_mellifera|36884          TTAAGAGAGATTCGTGACAAA---------------TAA
Apis_mellifera|34772          TTAAGAGAGATTCGTGACAAA---------------TAA
Linepithema_humile|3366       TTGAAGGAGATTCGTGACAGA---------------TAA
Pogonomyrmex_barbatus|12521   TTGAGGGCAATTCGTGATAGA---------------TAA
Branchiostoma_floridae|41038  CTACAAATGCTA------------------------TAG
Nematostella_vectensis|9509   CTGGATGTGTTA------------------------TAG
                                                                     

multiple sequence alignment in CLUSTALW format


Daphnia_pulex|1125            -------------------------------------------------MAAGELNLF--
Tribolium_castaneum|6374      ---------------------------------------------------MARELFL--
Pediculus_humanus|253         ------------------------------------------------MSVTSKTGLL--
Culex_quinquefasciatus|13813  ------------------------------------------------MNISTKTGLI--
Drosophila_melanogaster|10919 ------------------------------------------------MSASTRTGLI--
Drosophila_yakuba|9865        ------------------------------------------------MSATTRTGLI--
Drosophila_sechellia|14073    ------------------------------------------------MSASTRTGLI--
Drosophila_simulans|2883      ------------------------------------------------------------
Daphnia_pulex|1124            ----------------------------------------------MGPHKYRRNLFF--
Tribolium_castaneum|6373      ------------------------------------------------MSQTSRTGLI--
Nasonia_vitripennis|2907      -----------------------------------------------MPRVASSTGLI--
Apis_mellifera|6159           -----------------------------------------------MPGIASATGLL--
Apis_mellifera|800            -----------------------------------------------MPGIASATGLL--
Linepithema_humile|8602       -----------------------------------------------MTGIASATGLL--
Pogonomyrmex_barbatus|3985    -----------------------------------------------MPGIASATGLL--
Branchiostoma_floridae|5883   MAGLAGLITVKLLTIAYLLFNSCFVLYSSKVQDGTCSQPCTNITVVASPGQKGDMGLTGK
Nematostella_vectensis|26817  --------------------------METEVMD------CFSYEIADWP--KGCLKMA--
                                                                                          

Daphnia_pulex|1125            ------------------------------------------------------------
Tribolium_castaneum|6374      ------------------------------------------------------------
Pediculus_humanus|253         ------------------------------------------------------------
Culex_quinquefasciatus|13813  ------------------------------------------------------------
Drosophila_melanogaster|10919 ------------------------------------------------------------
Drosophila_yakuba|9865        ------------------------------------------------------------
Drosophila_sechellia|14073    ------------------------------------------------------------
Drosophila_simulans|2883      ------------------------------------------------------------
Daphnia_pulex|1124            ------------------------------------------------------------
Tribolium_castaneum|6373      ------------------------------------------------------------
Nasonia_vitripennis|2907      ------------------------------------------------------------
Apis_mellifera|6159           ------------------------------------------------------------
Apis_mellifera|800            ------------------------------------------------------------
Linepithema_humile|8602       ------------------------------------------------------------
Pogonomyrmex_barbatus|3985    ------------------------------------------------------------
Branchiostoma_floridae|5883   PGSQGPLGVKGKKGDRGILGLVGPMGIPGAEGEPGAAGASGEKGERGPQGVHGPSGQKGA
Nematostella_vectensis|26817  -------GITLNDQDRVWL---------------TAGNRVQDREYLDPNALYNFFSSANA
                                                                                          

Daphnia_pulex|1125            --------------------------------------------VAGIQQKIVVEQSRKK
Tribolium_castaneum|6374      ------------------------------------------------------------
Pediculus_humanus|253         ------------------------------------------PSSKKVSQKHYCVRKKT-
Culex_quinquefasciatus|13813  --------------------------------------------ASPRKHIVRPRKEFDP
Drosophila_melanogaster|10919 --------------------------------------------PTPKRHIKYLKKRKNQ
Drosophila_yakuba|9865        --------------------------------------------PTPKRHVKYLKKRKNQ
Drosophila_sechellia|14073    --------------------------------------------PTPKRHVKYLKKRKNQ
Drosophila_simulans|2883      ------------------------------------------------------------
Daphnia_pulex|1124            -------------------------------------------------DVFNGRSNY--
Tribolium_castaneum|6373      --------------------------------------------ASPTKKIYRSQKVST-
Nasonia_vitripennis|2907      --------------------------------------------AARVRPVRRPKPKK--
Apis_mellifera|6159           --------------------------------------------EARIRPTYRPKSKN--
Apis_mellifera|800            --------------------------------------------EARIRPTYRPKSKN--
Linepithema_humile|8602       --------------------------------------------SARIRPIRRPKPKS--
Pogonomyrmex_barbatus|3985    --------------------------------------------SARIRPIRRPKPKN--
Branchiostoma_floridae|5883   AGEPGVTGVRGFPGVKGPPGERGTPGWLGLPGRRGEKGSKGDPGQAGAAGAQGPPGVGAP
Nematostella_vectensis|26817  D---------------------------RLYNRRVKSATPRFNTSMGATKARNHAYGHQP
                                                                                          

Daphnia_pulex|1125            DPDSYKLKLSQGSRTKEA------------------------CNRKP-------------
Tribolium_castaneum|6374      --------------ARTAD-----------------------YTHTA-------------
Pediculus_humanus|253         ------FELPLL--AVPVS-----------------------FALRP-------------
Culex_quinquefasciatus|13813  ------AVLAPCAITRQVP-----------------------LALRP-------------
Drosophila_melanogaster|10919 HGDISRMPLKFE--ATPMP-----------------------LSLRP-------------
Drosophila_yakuba|9865        HGDISRMPLKFE--ATPMP-----------------------LSLRP-------------
Drosophila_sechellia|14073    HGDISRMPLKFE--ATPMP-----------------------LSLRP-------------
Drosophila_simulans|2883      ------MPLKFE--ATPMP-----------------------LSLRP-------------
Daphnia_pulex|1124            ------IDLGLCITARPAP-----------------------RTARP-------------
Tribolium_castaneum|6373      ------IQLRAF--ARPAP-----------------------FVLKP-------------
Nasonia_vitripennis|2907      ------LELVGP--SVPAP-----------------------FTLRP-------------
Apis_mellifera|6159           ------IELAGF--VKPAP-----------------------FILRP-------------
Apis_mellifera|800            ------IELAGF--VKPAP-----------------------FILRP-------------
Linepithema_humile|8602       ------VELSGC--TKAAP-----------------------FALRP-------------
Pogonomyrmex_barbatus|3985    ------VELSGC--TRAAP-----------------------FALRP-------------
Branchiostoma_floridae|5883   GQKGEKGEPGGTGVRTPSPLGPPGEKGDTGAPGGTGALGPPGVAGRPGVGVTGKKGAKGE
Nematostella_vectensis|26817  GWETPNLSVGMLKNPSPTP-----------------------VTSRP-------------
                                                                            .             

Daphnia_pulex|1125            ------------------------------------------------------------
Tribolium_castaneum|6374      ------------------------------------------------------------
Pediculus_humanus|253         ----------------------------FAG-----------------------------
Culex_quinquefasciatus|13813  ----------------------------FGG-----------------------------
Drosophila_melanogaster|10919 ----------------------------FGG-----------------------------
Drosophila_yakuba|9865        ----------------------------FGG-----------------------------
Drosophila_sechellia|14073    ----------------------------FGG-----------------------------
Drosophila_simulans|2883      ----------------------------FGG-----------------------------
Daphnia_pulex|1124            ----------------------------LAG-----------------------------
Tribolium_castaneum|6373      ----------------------------FAG-----------------------------
Nasonia_vitripennis|2907      ----------------------------FAG-----------------------------
Apis_mellifera|6159           ----------------------------FSG-----------------------------
Apis_mellifera|800            ----------------------------FSG-----------------------------
Linepithema_humile|8602       ----------------------------FAG-----------------------------
Pogonomyrmex_barbatus|3985    ----------------------------FAG-----------------------------
Branchiostoma_floridae|5883   EGKVGTTGAPGQKGETGGQGMTGSPG--LPGQQGEKGDKGEPAEVRETQVRGPTGENGLP
Nematostella_vectensis|26817  -----ASSRSGYSSKSGTKSIHSSPTAMYLGFQRTRCKSAPPRHFRYVPKRPQTASSGAG
                                                                                          

Daphnia_pulex|1125            ------------------------------------------------------------
Tribolium_castaneum|6374      ------------------------------------------------------------
Pediculus_humanus|253         ------------------------------------------------------------
Culex_quinquefasciatus|13813  ------------------------------------------------------------
Drosophila_melanogaster|10919 ------------------------------------------------------------
Drosophila_yakuba|9865        ------------------------------------------------------------
Drosophila_sechellia|14073    ------------------------------------------------------------
Drosophila_simulans|2883      ------------------------------------------------------------
Daphnia_pulex|1124            ------------------------------------------------------------
Tribolium_castaneum|6373      ------------------------------------------------------------
Nasonia_vitripennis|2907      ------------------------------------------------------------
Apis_mellifera|6159           ------------------------------------------------------------
Apis_mellifera|800            ------------------------------------------------------------
Linepithema_humile|8602       ------------------------------------------------------------
Pogonomyrmex_barbatus|3985    ------------------------------------------------------------
Branchiostoma_floridae|5883   GEKGQKGDSGTPGAPGESSYITVSGESYVLQGPPGSRGVPGDKGEKGDRGFPGDRGFHGG
Nematostella_vectensis|26817  SSR------------------------------PVSRGAPQRAWQLRTSSASTSRSLL--
                                                                                          

Daphnia_pulex|1125            ------------------------------------------------------------
Tribolium_castaneum|6374      ------------------------------------------------------------
Pediculus_humanus|253         ------------------------------------------------------------
Culex_quinquefasciatus|13813  ------------------------------------------------------------
Drosophila_melanogaster|10919 ------------------------------------------------------------
Drosophila_yakuba|9865        ------------------------------------------------------------
Drosophila_sechellia|14073    ------------------------------------------------------------
Drosophila_simulans|2883      ------------------------------------------------------------
Daphnia_pulex|1124            ------------------------------------------------------------
Tribolium_castaneum|6373      ------------------------------------------------------------
Nasonia_vitripennis|2907      ------------------------------------------------------------
Apis_mellifera|6159           ------------------------------------------------------------
Apis_mellifera|800            ------------------------------------------------------------
Linepithema_humile|8602       ------------------------------------------------------------
Pogonomyrmex_barbatus|3985    ------------------------------------------------------------
Branchiostoma_floridae|5883   QGTPGYPGSPGPEGMPGMKGTKGEPGKPGKTGAPGEFGQTGGQGRTGFKGDKGEP----G
Nematostella_vectensis|26817  ----------SPEDI-----HKRQKERCKSAPLPYNFSAVELVTKVPSDGNEHDKLYAMT
                                                                                          

Daphnia_pulex|1125            ------------------------------------------------------------
Tribolium_castaneum|6374      ------------------------------------------------------------
Pediculus_humanus|253         ------------------------------------------------------------
Culex_quinquefasciatus|13813  ------------------------------------------------------------
Drosophila_melanogaster|10919 ------------------------------------------------------------
Drosophila_yakuba|9865        ------------------------------------------------------------
Drosophila_sechellia|14073    ------------------------------------------------------------
Drosophila_simulans|2883      ------------------------------------------------------------
Daphnia_pulex|1124            ------------------------------------------------------------
Tribolium_castaneum|6373      ------------------------------------------------------------
Nasonia_vitripennis|2907      ------------------------------------------------------------
Apis_mellifera|6159           ------------------------------------------------------------
Apis_mellifera|800            ------------------------------------------------------------
Linepithema_humile|8602       ------------------------------------------------------------
Pogonomyrmex_barbatus|3985    ------------------------------------------------------------
Branchiostoma_floridae|5883   KPCSCAGGVLSAHGRLADAPFVAFSAALANRIVNVLENTIVKYNIVHTNEGRAYDMATGK
Nematostella_vectensis|26817  RPLTC--------------------------MPNIIQNAVTHSGLRHCCS--AYN-----
                                                                                          

Daphnia_pulex|1125            ------------------------------------------------------------
Tribolium_castaneum|6374      ------------------------------------------------------------
Pediculus_humanus|253         ------------------------------------------------------------
Culex_quinquefasciatus|13813  ------------------------------------------------------------
Drosophila_melanogaster|10919 ------------------------------------------------------------
Drosophila_yakuba|9865        ------------------------------------------------------------
Drosophila_sechellia|14073    ------------------------------------------------------------
Drosophila_simulans|2883      ------------------------------------------------------------
Daphnia_pulex|1124            ------------------------------------------------------------
Tribolium_castaneum|6373      ------------------------------------------------------------
Nasonia_vitripennis|2907      ------------------------------------------------------------
Apis_mellifera|6159           ------------------------------------------------------------
Apis_mellifera|800            ------------------------------------------------------------
Linepithema_humile|8602       ------------------------------------------------------------
Pogonomyrmex_barbatus|3985    ------------------------------------------------------------
Branchiostoma_floridae|5883   FTTSIPGYYMFTYSGMTTSVKGSAYWSRLVLNGEPVISLYDKSMGEHLSSSNSVILLLKP
Nematostella_vectensis|26817  -----------TRPKTATDTRHAQFW----------------------------------
                                                                                          

Daphnia_pulex|1125            ------------------------------------------------------------
Tribolium_castaneum|6374      ------------------------------------------------------------
Pediculus_humanus|253         ------------------------------------------------------------
Culex_quinquefasciatus|13813  ------------------------------------------------------------
Drosophila_melanogaster|10919 ------------------------------------------------------------
Drosophila_yakuba|9865        ------------------------------------------------------------
Drosophila_sechellia|14073    ------------------------------------------------------------
Drosophila_simulans|2883      ------------------------------------------------------------
Daphnia_pulex|1124            ------------------------------------------------------------
Tribolium_castaneum|6373      ------------------------------------------------------------
Nasonia_vitripennis|2907      ------------------------------------------------------------
Apis_mellifera|6159           ------------------------------------------------------------
Apis_mellifera|800            ------------------------------------------------------------
Linepithema_humile|8602       ------------------------------------------------------------
Pogonomyrmex_barbatus|3985    ------------------------------------------------------------
Branchiostoma_floridae|5883   GDEVWVELDARSSMWGDYTGYVTFSGTTMDGISELPCPHKRPVAPRRNAGRLVRIRRPNT
Nematostella_vectensis|26817  -----------------------------------------PVA----------------
                                                                                          

Daphnia_pulex|1125            -------------------------------------------NSVVLKTAKKRPTELLC
Tribolium_castaneum|6374      ----------------------------------------------------PKSPTHLL
Pediculus_humanus|253         -----------------------------------------------IYNPFPYGCSILC
Culex_quinquefasciatus|13813  -----------------------------------------------LYNPYSKGCSVLC
Drosophila_melanogaster|10919 -----------------------------------------------LFNPFAKGCSVLC
Drosophila_yakuba|9865        -----------------------------------------------LFNPFAKGCSVLC
Drosophila_sechellia|14073    -----------------------------------------------LFNPFAKGCSVLC
Drosophila_simulans|2883      -----------------------------------------------LFNPFAKGCSVLC
Daphnia_pulex|1124            -----------------------------------------------LPNPYPYGCSVLC
Tribolium_castaneum|6373      -----------------------------------------------LYNPYPYGCSLLC
Nasonia_vitripennis|2907      -----------------------------------------------LFNPYPYGCSVLC
Apis_mellifera|6159           -----------------------------------------------LFNPYPYGCSILC
Apis_mellifera|800            -----------------------------------------------LFNPYPYGCSILC
Linepithema_humile|8602       -----------------------------------------------LFNPYPYGCSVLC
Pogonomyrmex_barbatus|3985    -----------------------------------------------LFNPYPYGCSVLC
Branchiostoma_floridae|5883   QDMEALMVQQASGQLYLTTPYRQLPENDFCSKVDCLYCHRLRMQKLMKPSPWPRGNPHTP
Nematostella_vectensis|26817  -----------------------------------------------RPSVYRRGQVPQY
                                                                                          

Daphnia_pulex|1125            ET-------------------------------------ESNCSSSQEETKPV-------
Tribolium_castaneum|6374      TH-------------------------------------PNA------------------
Pediculus_humanus|253         NH-------------------------------------PTDFEAKAIVQKAKD------
Culex_quinquefasciatus|13813  NH-------------------------------------PAAQELKNVVRLAKD------
Drosophila_melanogaster|10919 NH-------------------------------------PAPSGVKDVINQLKT------
Drosophila_yakuba|9865        NH-------------------------------------PAPSGVKDVINQLKT------
Drosophila_sechellia|14073    NH-------------------------------------PAPSGVKDVINQLKT------
Drosophila_simulans|2883      NH-------------------------------------PAPSGVKDVINQLKT------
Daphnia_pulex|1124            NH-------------------------------------PKDPELKDV------------
Tribolium_castaneum|6373      NH-------------------------------------PTDSEAKELLKRVKD------
Nasonia_vitripennis|2907      NH-------------------------------------PADGEAKEIVRRAKD------
Apis_mellifera|6159           NH-------------------------------------PADCEAREVLRRAKD------
Apis_mellifera|800            NH-------------------------------------PADCEAREVLRRAKD------
Linepithema_humile|8602       NH-------------------------------------PADCEAKEVVRRAKD------
Pogonomyrmex_barbatus|3985    NH-------------------------------------PADCEAKEVVRRAKD------
Branchiostoma_floridae|5883   RHTHYHAPVLPIIKQGRCLVRRRNLKTPRSRRKATVIHLPPLTGENMTVHRAKGGGVPWW
Nematostella_vectensis|26817  LHFVTPAP----------------------------ISGQSPTNLTSGDNTQSD------
                                                                                          

Daphnia_pulex|1125            ---------IW-------------------VDIVKKLPSPEVETPLPV------------
Tribolium_castaneum|6374      ------------------------------------------------------------
Pediculus_humanus|253         ---------AW-------------------ATEGKSLIDLEEKDALKSQR----------
Culex_quinquefasciatus|13813  ---------AWITDAR--------------TVHSEKLLMGGQGH----------------
Drosophila_melanogaster|10919 ---------SL-------------------AIEGKGQQHGKQDKI---------------
Drosophila_yakuba|9865        ---------SL-------------------AIEGKGQQHGKQDKI---------------
Drosophila_sechellia|14073    ---------SL-------------------AIEGKGQQHGKQDKI---------------
Drosophila_simulans|2883      ---------SL-------------------AIEGKGQQHGKQDKI---------------
Daphnia_pulex|1124            ---------VW-------------------------------------------------
Tribolium_castaneum|6373      ---------SW-------------------ATEGKNLLLTEEIEAIRAGFEN--------
Nasonia_vitripennis|2907      ---------TW-------------------ASEGKALLLPAELELLHQH-----------
Apis_mellifera|6159           ---------SW-------------------ANEGKTLLLPEEMEMIRANLVTVGN-----
Apis_mellifera|800            ---------SW-------------------ANEGKTLLLPEEMEMIRANLVTVGN-----
Linepithema_humile|8602       ---------TW-------------------ATEGKALLLPEEMEMIRTSLLAMGAGGGVG
Pogonomyrmex_barbatus|3985    ---------TWVKNSSAVCRKEDKCGVINHAAEGKALLLPEEMEMIRTSLLVVGASGGGG
Branchiostoma_floridae|5883   ANKTPLGGISWVNADVTEPST---------AADGIKLSANVNGEIIHLEEIQLREQKDEE
Nematostella_vectensis|26817  ------------------------------EEPDDTLLEEDLDEMVLFEESFVVP-----
                                                                                          

Daphnia_pulex|1125            ---TKPTTSRKLPTSVWMSRNSRSGILP--EG----------------------------
Tribolium_castaneum|6374      ------------------------------------------------------------
Pediculus_humanus|253         ---KELISSEFSKSIYD------ENVLKDSSY----------------------------
Culex_quinquefasciatus|13813  ---GSGKQPDGSKRMMSKDSDLPDHVPE--EF----------------------------
Drosophila_melanogaster|10919 -----PEEPDLQPHETD-------NIPE--DL----------------------------
Drosophila_yakuba|9865        -----PEEPELQPHEAD-------NIPE--DL----------------------------
Drosophila_sechellia|14073    -----PEEPELQPHEAD-------NIPE--DL----------------------------
Drosophila_simulans|2883      -----PEEPEMQPHEAD-------NIPE--DL----------------------------
Daphnia_pulex|1124            ------------------------------------------------------------
Tribolium_castaneum|6373      ---FQPLEKNVKHVQIN----ALDSVPE--EL----------------------------
Nasonia_vitripennis|2907      ---NKPISGGEHQEGLD--------VPE--EL----------------------------
Apis_mellifera|6159           ---AADVSGNTGAEITN----DSNTVPE--EL----------------------------
Apis_mellifera|800            ---AADINGNTGAEITN----DSNTVPE--EL----------------------------
Linepithema_humile|8602       E--AGNVGGNSGGDGYKVTEVTASAVPE--EL----------------------------
Pogonomyrmex_barbatus|3985    EA-AGNVGGDGDGYNAE---MTASAVPE--EL----------------------------
Branchiostoma_floridae|5883   EAKTGKEGSEEGEDKFGELEASKENVLP--DISDSDTSSVRSADTVISKDTGIGTATAIS
Nematostella_vectensis|26817  ---ATPTEPSL-SEQYDPSELDERDVADMGDI----------------------------
                                                                                          

Daphnia_pulex|1125            -------------FQ---------------------------------------------
Tribolium_castaneum|6374      ------------------------------------------------------------
Pediculus_humanus|253         ------------------------------------------------------------
Culex_quinquefasciatus|13813  -------------FR---------------------------------------------
Drosophila_melanogaster|10919 -------------FR---------------------------------------------
Drosophila_yakuba|9865        -------------FR---------------------------------------------
Drosophila_sechellia|14073    -------------FR---------------------------------------------
Drosophila_simulans|2883      -------------FR---------------------------------------------
Daphnia_pulex|1124            ------------------------------------------------------------
Tribolium_castaneum|6373      -------------FR---------------------------------------------
Nasonia_vitripennis|2907      -------------FR---------------------------------------------
Apis_mellifera|6159           -------------FR---------------------------------------------
Apis_mellifera|800            -------------FR---------------------------------------------
Linepithema_humile|8602       -------------FR---------------------------------------------
Pogonomyrmex_barbatus|3985    -------------FR---------------------------------------------
Branchiostoma_floridae|5883   EEVTLPSLSNIKVFRPKDHFADGTDETSTEETASSYEENVGGQDENQTKITEEVGKNDVV
Nematostella_vectensis|26817  -------------VE---------------------------------------------
                                                                                          

Daphnia_pulex|1125            -------------------------------------------IYIQ---K------NLN
Tribolium_castaneum|6374      -------------------------------------------------SR------SST
Pediculus_humanus|253         -------------------------------------------NFEETNEK------CLT
Culex_quinquefasciatus|13813  -------------------------------------------RYTDTDSR------PLT
Drosophila_melanogaster|10919 -------------------------------------------RYAETDSR------PMT
Drosophila_yakuba|9865        -------------------------------------------RYAETDSR------PMT
Drosophila_sechellia|14073    -------------------------------------------RYAETDSR------PMT
Drosophila_simulans|2883      -------------------------------------------RYAETDSR------PMT
Daphnia_pulex|1124            ------------------------------------------------------------
Tribolium_castaneum|6373      -------------------------------------------RYTETDSR------PLT
Nasonia_vitripennis|2907      -------------------------------------------RYTETDSR------PVS
Apis_mellifera|6159           -------------------------------------------KYTETDSR------PLT
Apis_mellifera|800            -------------------------------------------KYTETDSR------PLT
Linepithema_humile|8602       -------------------------------------------KYTETDSR------PLT
Pogonomyrmex_barbatus|3985    -------------------------------------------KYTETDSR------PLT
Branchiostoma_floridae|5883   EVERRSVVDELTLDTEDTSKQHPSQHPEEIDGELLCTKDGCSCPYNKASPQKQSPKNSSP
Nematostella_vectensis|26817  -------------------------------------------RYLDMADNYNSTNNTLL
                                                                                          

Daphnia_pulex|1125            LIEDVQTAKRRRSDNRDIFRTEQEDDV-----NWTSNAPRPSEWLLKPP-----------
Tribolium_castaneum|6374      PS-SVKALKKKNK-----------EVE-----EPPIKEKQEEKKSD--------------
Pediculus_humanus|253         STPNNKISPNVKN--------RRCLTP-----DPTSFIPTKEKTLLVLD-----------
Culex_quinquefasciatus|13813  PTPTVASGRTRASVVGGSHLTRRCVTP------EPQTQNLQERKQLILD-----------
Drosophila_melanogaster|10919 PTPTVTSIHTRTS---AGSFYRRCITP-----EWGKHENIK-RKKIILD-----------
Drosophila_yakuba|9865        PTPTVTSIHTRTS---AGSFYRRCITP-----EWGKHENIK-RKKIILD-----------
Drosophila_sechellia|14073    PTPTVTSIHTRTS---AGSFYRRCITP-----EWGKHENIK-RKKIILD-----------
Drosophila_simulans|2883      PTPTVTSIHTRTS---AGSFYRRCITP-----EWGKHENIK-RKKIILD-----------
Daphnia_pulex|1124            ------------------------------------------------------------
Tribolium_castaneum|6373      PAPTLASAATRAS------GSRRCVTP-----DPAPTNQIREKTLLILD-----------
Nasonia_vitripennis|2907      PTISVEPTQINDD-------------------DLDGSARETLRTTLVLD-----------
Apis_mellifera|6159           PAPTLASGPPLTN---------RATQE-----EFPAACNLRERTTLILD-----------
Apis_mellifera|800            PAPTLASGPPLTN---------RATQE-----EFSAACNLRERTTLILD-----------
Linepithema_humile|8602       PAPTLASGPTALT--------SRATQE-----DLPAPCNPRERTTLVLD-----------
Pogonomyrmex_barbatus|3985    PAPTLASGPTALT--------GRTAQE-----DLLATCNPRERTTLVLD-----------
Branchiostoma_floridae|5883   PDLHLANLQLVQNADDGGENESATSRPYDNDLDWKKNELQEEEAAIMLDPNLPWLSHGYK
Nematostella_vectensis|26817  HPPEQYPLPVDDNKSDSASDFQEPEVQILITRKSPSPEPVEEPEAISNTPEPALETTDPE
                                                                                          

Daphnia_pulex|1125            ------------------------------------------------------------
Tribolium_castaneum|6374      ------------------------------------------------------------
Pediculus_humanus|253         ------------------------------------------------------------
Culex_quinquefasciatus|13813  ------------------------------------------------------------
Drosophila_melanogaster|10919 ------------------------------------------------------------
Drosophila_yakuba|9865        ------------------------------------------------------------
Drosophila_sechellia|14073    ------------------------------------------------------------
Drosophila_simulans|2883      ------------------------------------------------------------
Daphnia_pulex|1124            ------------------------------------------------------------
Tribolium_castaneum|6373      ------------------------------------------------------------
Nasonia_vitripennis|2907      ------------------------------------------------------------
Apis_mellifera|6159           ------------------------------------------------------------
Apis_mellifera|800            ------------------------------------------------------------
Linepithema_humile|8602       ------------------------------------------------------------
Pogonomyrmex_barbatus|3985    ------------------------------------------------------------
Branchiostoma_floridae|5883   KGKDDFSQKFLSDVDYAKHHTDTSSENRLRISTPRKDQQERVKSATVRRVQDGRGGSARS
Nematostella_vectensis|26817  AKETNKPD----------------------------------------------------
                                                                                          

Daphnia_pulex|1125            ------------------------------------------------------------
Tribolium_castaneum|6374      ------------------------------------------------------------
Pediculus_humanus|253         ------------------------------------------------------------
Culex_quinquefasciatus|13813  ------------------------------------------------------------
Drosophila_melanogaster|10919 ------------------------------------------------------------
Drosophila_yakuba|9865        ------------------------------------------------------------
Drosophila_sechellia|14073    ------------------------------------------------------------
Drosophila_simulans|2883      ------------------------------------------------------------
Daphnia_pulex|1124            ------------------------------------------------------------
Tribolium_castaneum|6373      ------------------------------------------------------------
Nasonia_vitripennis|2907      ------------------------------------------------------------
Apis_mellifera|6159           ------------------------------------------------------------
Apis_mellifera|800            ------------------------------------------------------------
Linepithema_humile|8602       ------------------------------------------------------------
Pogonomyrmex_barbatus|3985    ------------------------------------------------------------
Branchiostoma_floridae|5883   RDSGGDTYQFLRESRPRSAYSLYSVKSFMSGPPQVKSKRARSATVRRKAADLQKSFTQVE
Nematostella_vectensis|26817  ------------------------------------------------------------
                                                                                          

Daphnia_pulex|1125            -----LQRKKKRNRKSI-KFEK--------------W----------LQLPCGLQGIHLE
Tribolium_castaneum|6374      ------------------------------------------------------------
Pediculus_humanus|253         -----LRRSHSQDTVHLQRDLS--------------FD---NNNDTGNIPDENISRPGTP
Culex_quinquefasciatus|13813  -----LRRSHS------QETLY--------------W-----NASSELSPSQLQDPSWMQ
Drosophila_melanogaster|10919 -----LRRSHS------QETLY--------------W----K-------PSSDLTQSGLE
Drosophila_yakuba|9865        -----LRRSHS------QETLY--------------W----K-------PSSELTQSGLE
Drosophila_sechellia|14073    -----LRRSHS------QETLY--------------W----K-------PSSELTQSGLE
Drosophila_simulans|2883      -----LRRSHS------QETLY--------------W----K-------PSSELTQSGLE
Daphnia_pulex|1124            ------------------------------------------------------------
Tribolium_castaneum|6373      -----LRRSHS-------------------------------------------------
Nasonia_vitripennis|2907      -----LRASSHEIQE--NETLS--------------W----RALTLEPIPSTRRTDLSSS
Apis_mellifera|6159           -----LRTNSQKRME--NETFS--------------W----HALTLEPPPTHRKNEIVVS
Apis_mellifera|800            -----LRTNSQKRME--NETFS--------------W----HALTLEPPPTHRKNEIVVS
Linepithema_humile|8602       -----LRANSQNQQVE-SETFS--------------W----HALTLELPPTPRKSEIFVC
Pogonomyrmex_barbatus|3985    -----LRTSSQSNQQLENEAFS--------------W----HALTLDLPPTPRKSEIFVY
Branchiostoma_floridae|5883   RGYEEVRIDRNFRKLARPRTAQGLVRGRPNVTWSGDWR---PTSSTGLIPTTPFDRYVSY
Nematostella_vectensis|26817  -----VITEHDNVQEHEQKGETSDGDTKQEVPFIKEEQIEDKGPEVRNDMEPHETDVPLQ
                                                                                          

Daphnia_pulex|1125            -GREPRKTNPLQ-PGPRN-------------------QKPAKQCQIRNCSPDDEMGWVYD
Tribolium_castaneum|6374      ------------------------------------------------------------
Pediculus_humanus|253         SSQSPVQTKKKKTPRKKSIVSS---------------TTASSLKTQNSKGSDSKVQDSVT
Culex_quinquefasciatus|13813  --------------------------------------------------HHSQIPETVD
Drosophila_melanogaster|10919 EDKKPKSAGANE-DKKPK-------------------RQPSNEQR-----PKSSLATATL
Drosophila_yakuba|9865        EDKKPKSAGANE-DKKPK-------------------RQPSNEQR-----PKSSLATANL
Drosophila_sechellia|14073    EDKKPKSAGANE-DKKPK-------------------RQPSNDQR-----PKSSLATATL
Drosophila_simulans|2883      EDKKPKSAGANE-DKKPK-------------------RQPSNEQR-----PKSSLATATL
Daphnia_pulex|1124            ---RPRISSTHE------------------------------------------------
Tribolium_castaneum|6373      ------------------------------------------------------------
Nasonia_vitripennis|2907      QRRKPVSSRNRSTTALST---------------------SPVRSV-----PVLEVSDAAS
Apis_mellifera|6159           ---KPISRRAIE-NSIHT-------------------ADSTIDIQ-----NVDASNESNS
Apis_mellifera|800            ---KPISRRAIE-NSIHT-------------------ADSTIDIQ-----NVDASNESNS
Linepithema_humile|8602       ---KPISRPQHSAPAPP----------------------PPSPPS-----PIVEGCETSS
Pogonomyrmex_barbatus|3985    ---KPTSRAQHS-SATPI-------------------LPSPSPPS-----STAEKCETIA
Branchiostoma_floridae|5883   E--RPRSARRVRRGETPQFFDISKRAWLHDRPPQSPPRTPPPPQRIRTPVRIVRTPSNVS
Nematostella_vectensis|26817  EPIKPPEPEPLKEAPPPV-------------------SISPAEPKVKFLDSVKISSYKPP
                                                                                          

Daphnia_pulex|1125            GKKV----------------TFQLIN---------------------------------Q
Tribolium_castaneum|6374      --------------------DEEEAE----------------------------------
Pediculus_humanus|253         SSSPTRSVLITEKEKKLSKTHNKSTD---------------------------------S
Culex_quinquefasciatus|13813  ERVL----------------GGDGAE----------------------------------
Drosophila_melanogaster|10919 TPGG---------------DAINDQE---------------------------------A
Drosophila_yakuba|9865        APGG---------------DATNDPE---------------------------------A
Drosophila_sechellia|14073    APGG---------------DASNDQE---------------------------------A
Drosophila_simulans|2883      APGG---------------DASNDQE---------------------------------A
Daphnia_pulex|1124            ------------------------------------------------------------
Tribolium_castaneum|6373      ------------------------------------------------------------
Nasonia_vitripennis|2907      TRSAPTNLAPIAPTEDDDDEEEDEDD---------------------------------T
Apis_mellifera|6159           NRNV----------------TEEETE---------------------------------K
Apis_mellifera|800            NRNV----------------TEEETE---------------------------------K
Linepithema_humile|8602       SKNA----------------EEEADS---------------------------------G
Pogonomyrmex_barbatus|3985    TCTP----------------FSRLRL---------------------------------S
Branchiostoma_floridae|5883   AKAGSGEPSTVEMSPPPSPPPEQEEEIPVEEEEEEEDGDWQEQIEVSVQMKEPEPPPPSP
Nematostella_vectensis|26817  EPNPVAPKEPPKPILKPTKAPEPKLA---------------------------------P
                                                                                          

Daphnia_pulex|1125            GKQKNKSEKKRRRRRIKTKKGKKLPKQSSSKGARSLRNP------------------DTS
Tribolium_castaneum|6374      -----------DEFIKRRGKKRRKKREGSGAPAFQTSVDP-----------------ETQ
Pediculus_humanus|253         TSSDDVIVKRRGK--KRKGKKTLKERGKEGEKEFKGIPDP----------------NETQ
Culex_quinquefasciatus|13813  -----------SDKEDRQGKPTPMTCINAMEDASRPNQDP-----------------ETA
Drosophila_melanogaster|10919 KPKTCINEHELSDEDVRRGKKRKKLKPAQATTTFHLSEDP-----------------ETQ
Drosophila_yakuba|9865        KPKTCINEHELSDEDVRRGKKRKKLKPAQATTTFHLSEDP-----------------ETQ
Drosophila_sechellia|14073    KPKTCVNEHELSDEDVRRGKKRKKLKPAQATTTFHLSEDP-----------------ETQ
Drosophila_simulans|2883      KPKTCINEHELSDEDVRRGKKRKKLKPAQATTTFHLSEDP-----------------ETQ
Daphnia_pulex|1124            ---------------------------GGAEHYE--------------------------
Tribolium_castaneum|6373      ------------------------------------------------------------
Nasonia_vitripennis|2907      GPEESAPMRRRGKLRRKKRKCRRGSIYGQQTEVREPPEPL-----------------ETQ
Apis_mellifera|6159           SNKEVTIVRRRGK-RLRKRKHRRGSGYGQQTEVRDLFETT-----------------ETQ
Apis_mellifera|800            SNKEVTIVRRRGK-RLRKRKHRRGSGYGQQTEVRDLFEIT-----------------ETQ
Linepithema_humile|8602       SEQQPVIIRRRGK-RLRKRKCRRGSTYGQQTEVRDPLEPA-----------------VTQ
Pogonomyrmex_barbatus|3985    SLKEIVLPSLIGE-RVRPGTRRKRPT-AAANSNRQLHEDGESDCVKESVEGARRMANKRK
Branchiostoma_floridae|5883   TPEPPEEPELAWDEEEKQEEEQPKPPSPPPTPPREPTPPPREPTPPPREPTPPPREPTPP
Nematostella_vectensis|26817  APATPAKTEQLKKPRAKPTFERREADIKSQHKPSQL---------------------PTP
                                                                                          

Daphnia_pulex|1125            VL----------------DENDEPV--------------FLDP-----------------
Tribolium_castaneum|6374      VATIGPDSHNPSARPS--LVPATPE--------------ETLEVPESGKRSARPSKC---
Pediculus_humanus|253         VSAIGSDSMNSSSRHSFSGDEKTSENIVE----------EIIPTIVKEDVEIDENKK---
Culex_quinquefasciatus|13813  VATIDPDSPNYSARPS--LVPTGRS--------------LLSSGAESPPRASVEEQI---
Drosophila_melanogaster|10919 VAALGPDSLNPSTRPS--LIP-NSL--------------TLLP---KDKRETEREPI---
Drosophila_yakuba|9865        VAALGPDSLNPSTRPS--LIP-NSL--------------TLLP---KDKRETEREPI---
Drosophila_sechellia|14073    VAALGPDSLNPSTRPS--LIP-NSL--------------TLLP---KDKRETEREPI---
Drosophila_simulans|2883      VAALGPDSLNPSTRPS--LIP-NSL--------------TLLP---KDKRETEREPI---
Daphnia_pulex|1124            ------------------------------------------------------------
Tribolium_castaneum|6373      ---------------------------------------QVTP-----------------
Nasonia_vitripennis|2907      VSQIDEGSRRGSLCTN--RLEETRQ--------------ASLD---KGTLPAIKH-----
Apis_mellifera|6159           ISHIGDGSRRTSIHTN--NDDVENV--------------TSTP---KKTSPINNKFS---
Apis_mellifera|800            ISHIGDGSRRTSIHTN--NDDVENV--------------TGTP---KKTSPINNKFF---
Linepithema_humile|8602       VSQIGNGSRRPSLHVD--TGEIDD---------------SATP----KKSPAQATSH---
Pogonomyrmex_barbatus|3985    FAILSSPRLRRSHKSE--TDHGERR--------------QLHVNTSEGDSSADSKKTSAQ
Branchiostoma_floridae|5883   PREPTPPPREPTPPPREPTPPPEPEKEPTPPPSPPPVEKAPTPPPPSPTPEVEEHPVEVA
Nematostella_vectensis|26817  WVEPEPEAEKQEVKEE--QKEEEK---------------PPTPASLEPERLPDPEFV---
                                                                                          

Daphnia_pulex|1125            -----KLNGA---------------------------------FI-NEVGAQPPIEVCEE
Tribolium_castaneum|6374      -----WDIDS---------------------------------FLDVEILKQLRRELDEE
Pediculus_humanus|253         ---------S---------------------------------FLSKDILKQLQRQLDQE
Culex_quinquefasciatus|13813  -----EYIEC---------------------------------FLDDEALCLLRRGLNID
Drosophila_melanogaster|10919 -----LLKGS---------------------------------FLTDEAFQALKTDLDVD
Drosophila_yakuba|9865        -----LLKGS---------------------------------FLTDEAFQALKTDLDVD
Drosophila_sechellia|14073    -----LLKGS---------------------------------FLTDEAFQALKTDLDVD
Drosophila_simulans|2883      -----LLKGS---------------------------------FLTDEAFQALKTDLDVD
Daphnia_pulex|1124            ------------------------------------------------------------
Tribolium_castaneum|6373      ------------------------------------------------------------
Nasonia_vitripennis|2907      -----DMPPS---------------------------------FLPPEVLKELSRELDRE
Apis_mellifera|6159           -----TMLPS---------------------------------FIDEDILKHLCRELDSD
Apis_mellifera|800            -----TMLPS---------------------------------FIDEDILKHLCRELDSD
Linepithema_humile|8602       -----TIPSS---------------------------------FLAPDILKHLCRELDRD
Pogonomyrmex_barbatus|3985    RPTNQMLPSS---------------------------------FLAPDILKHLCRELDRD
Branchiostoma_floridae|5883   PPLVEEEPPAPTPSPEPVVEDPPPELIANPNCMRFAINWRSEVILSDEEMEEPTTEAPQE
Nematostella_vectensis|26817  -----RAPGA---------------------------------YKMYQPIDLLEYGLDNA
                                                                                          

Daphnia_pulex|1125            AVKNK---------QHSVEDLGE--------------------------SLRNLQVEDDH
Tribolium_castaneum|6374      VIDNEFNQKRRTALQEALKTIPKDKIN----------------------CEALIKVQNEL
Pediculus_humanus|253         VVDSELNFNRRKALEEALHHKSKVKYNQQ--------------------GEEIKQLKKDF
Culex_quinquefasciatus|13813  IVESVFERYKARAMREAFRTATTDKLDFQ--------------------SRAVKQLEETL
Drosophila_melanogaster|10919 LIENTFGRYLNRALREAIKYMPP--------------------------KPKTVPKPVDD
Drosophila_yakuba|9865        LIENTFGRYLNRALREAIKYMPP--------------------------KPKTVPKPVDD
Drosophila_sechellia|14073    LIENTFGRYLNRALREAIKYMPP--------------------------KPKTVPKPVDD
Drosophila_simulans|2883      LIENTFGRYLNRALREAIKYMPP--------------------------KPKTVPKPVDD
Daphnia_pulex|1124            ------------------------------------------------------------
Tribolium_castaneum|6373      ------------------------------------------------------------
Nasonia_vitripennis|2907      AVEWEFNAKRRIALEEALRVSGG-----------------------------RAAPPRQS
Apis_mellifera|6159           KVEAEFSIRRKIAYEEALRVKGE--------------------------NYLHSKQSQIF
Apis_mellifera|800            KVEAEFSIRRKIAYEEALRVKGE--------------------------NYLHSKQSQIF
Linepithema_humile|8602       KVEAEFSIKKRIALEEALRVKGD--------------------------AYSTLRGSRQA
Pogonomyrmex_barbatus|3985    KIEAEFSIKRRIALEEALRVKGD--------------------------AYSTLRGSRQT
Branchiostoma_floridae|5883   EEDGKKGRKKSAKGKKKKKRKAPPKVEKTPVPSALLMDASEILNMEMKMRRKNLLENKAE
Nematostella_vectensis|26817  RRNQT--AKRSTPAVNPMPQGPS--------------------------YHQMLPESSLV
                                                                                          

Daphnia_pulex|1125            NGNNDVLYQVEGTVAVEDMSWLYFPRAGNNFGARFELPIDLRKLKSTYTIDKKRFLSIDF
Tribolium_castaneum|6374      KLPPVNTEL-----------WLSLPRVFSRSSARFELPLDSRTLET--------------
Pediculus_humanus|253         HLSIKNSEN-----------WLSIPRVFTRRCARFELPMDSRLLND--------------
Culex_quinquefasciatus|13813  DIHDIDHEK-----------WIDLPRKYSRSSARFELPMDTRTLST--------------
Drosophila_melanogaster|10919 KVSPETTSK--------------MPRKFSKSATRFDVPMDLSMLKN--------------
Drosophila_yakuba|9865        KVPPETTSK--------------MPRKFSKSATRFDVPMDLSMLKN--------------
Drosophila_sechellia|14073    KVPPETTSK--------------MPRKFSKSATRFDVPMDLSMLKN--------------
Drosophila_simulans|2883      KVPPETTSK--------------MPRKFSKSATRFDVPMDLSMLKN--------------
Daphnia_pulex|1124            ------------------------NAKMMKRANRAGLPHDEGS-----------------
Tribolium_castaneum|6373      ------------------------PKGQIKQ-----------------------------
Nasonia_vitripennis|2907      PVQPISQST--------------VPRLFYRQSARFEL-LDSQSLVG--------------
Apis_mellifera|6159           SNPVLINT----------------PRAFSRQTARFEI-LNSESLRG--------------
Apis_mellifera|800            SNPVLINT----------------PRAFSRQTARFEI-LNSESLRG--------------
Linepithema_humile|8602       SASLLAQNA---------------PRIFSRQAARFEL-LDSQSLRG--------------
Pogonomyrmex_barbatus|3985    SASPLVENA---------------PRIFSRQAMRFEL-LDSQSLCG--------------
Branchiostoma_floridae|5883   NDAIVAEVQEFEVKRPKQQAWLQGRLALSRQISRFELPMDMRLLEG--------------
Nematostella_vectensis|26817  INAIMDEEK---RKREGMKPWLQGRLALSKQTSRFELPMDVKVLES--------------
                                                           .                              

Daphnia_pulex|1125            VKDDFTCTEMTPLEYLSQYVVATRCRQRLNDVVF------------ERHATE--------
Tribolium_castaneum|6374      ---------MTPLQYIQNNVSITSPRKLLYNCIF------------NKFKIDELEATSE-
Pediculus_humanus|253         ---------MTPLNYLQNYSFPSQSRLLLYNHVF------------NLCKETTEDEQEED
Culex_quinquefasciatus|13813  ---------MTPIEYLKRHVVLCDDRKKLFHRIFCRNLPSDDGKPNQEFNENDSIPETET
Drosophila_melanogaster|10919 ---------MTPWDYLSKYVWVSQQRKQLYKRVF------------LKYLSRIEEPESEL
Drosophila_yakuba|9865        ---------MTPWDYLSKCVWVSHQRKQLYKRVF------------LKYLSRIEEPESEL
Drosophila_sechellia|14073    ---------MTPWDYLSKCVWVSQQRKQLYKRVF------------LKYLSRIEEPESEL
Drosophila_simulans|2883      ---------MTPWDYLSKCVWVSQQRKQLYKRVF------------LKYLSRIEEPESEL
Daphnia_pulex|1124            ----------------------------IFHHNW------------EQ------------
Tribolium_castaneum|6373      ------------------------------------------------------------
Nasonia_vitripennis|2907      ---------LKPLDYLGRYVYVSDTRKSMFSRVF------------NKYREESNDSGP--
Apis_mellifera|6159           ---------VTILEYLSRHVFVSSGRKHIFARVF------------NKFQKDMIQSN---
Apis_mellifera|800            ---------VTILEYLSRHVFVSSGRKHIFARVF------------NKFQKDMIQNN---
Linepithema_humile|8602       ---------LKPIQYLTKHAYVTSGRKQIFGRIF------------NKFNEDSLHSA---
Pogonomyrmex_barbatus|3985    ---------LTSLQYLSKYAYITSGRKLIFGRIF------------NKFNEEALHSA---
Branchiostoma_floridae|5883   ---------MSPIEYLSNYCIVSKRRQNLYKQSF------------TKADRDRD------
Nematostella_vectensis|26817  ---------MSAMDYLTQYCIISTRRKALYKNIF------------QKTDKDRD------
                                                                                          

Daphnia_pulex|1125            ---------------SKLSTEKLFLSLTEILGFHLDSQAEEKLSELID--LV--SVSELT
Tribolium_castaneum|6374      ---------------RKIRGKDIQSALNLMMGKAMTQKQATYIRDLIG--WR--DDDVMD
Pediculus_humanus|253         NE-------------RILLGKVNLTRLEKIMGRSMTNEIIENFQNLIG--WK--NDEKLN
Culex_quinquefasciatus|13813  PVQLETFKNLLADVTRLIPMANFDKAMHEALGFHGTPEKIFEIRELLELNYEYYQEIPID
Drosophila_melanogaster|10919 AAMGNDELPEYKYRERTLVWQSLPQALEDVLEFHGTEENVQGTLRMLGYDAQ--ASGDLD
Drosophila_yakuba|9865        AAMGNDELPEYTYRERTLVWQSLPQALEDVLEFHGTEENVQGTLRMLGYDAQ--GSGDLD
Drosophila_sechellia|14073    AAMGNDELPEYKYRERTLVWQSLPQALEDVLEFHGTEENVQGTLRMLGYDAQ--VSGDLD
Drosophila_simulans|2883      AAMGNDELPEYKYRERTLVWQSLPQALEDVLEFHGTEENVQGTLRMLGYDAQ--VSGDLD
Daphnia_pulex|1124            ----------------------------------------KIISNALG------------
Tribolium_castaneum|6373      ------------------------------------------------------------
Nasonia_vitripennis|2907      ---------------RYMLARHLAEALHEVMGRELASSEIDFLENALG---E--RRELLD
Apis_mellifera|6159           ---------------KYVLPNDIHEALQDIIGKPITQEQETYLKLIIG---E--IKEPLN
Apis_mellifera|800            ---------------KYVLPNDIHEALQDIIGKPITQEQETYLKLIIG---E--IKEPLN
Linepithema_humile|8602       ---------------RRISPTDVEEALQEMIGKALTDEQRSYLKSVIG---D--ITESLG
Pogonomyrmex_barbatus|3985    ---------------RRISSCDIEEALQEVVGRILSDEERSYLKSLIG---D--ITQPLG
Branchiostoma_floridae|5883   ---------------GIISVKELDKALKQIHVDGVTTEQVQKILDVIQ--AT--DDTKFD
Nematostella_vectensis|26817  ---------------GIISYRELDKALKEVHVDSINTSQVRQIAEMVE--AD--DKTKFN
                                                                                          

Daphnia_pulex|1125            REQFAGIGALAERIGRS---------GI-SRRDDLELADFDLLHKKMSYL-EMSQFLRRL
Tribolium_castaneum|6374      FKTFCGLCALCERLLAPEYCAQLPDRKS-DPCHEIETADFEALTRKLHGK-KVDKNLVEI
Pediculus_humanus|253         FRTFTGICAICERILGPKYFKNMPNQSK-DPRYEIERADFETLEYKLKRL-KLDKRLENI
Culex_quinquefasciatus|13813  FRSWCGIVAFAERFIIT------QDREL-DPCNELEMVDFESLERRIRSA-KPSENLCKV
Drosophila_melanogaster|10919 FRAWCGIVSFAERLALA-----DESGSD-DSCDELEKADFNSMEQIMPNF-TVPEKLKEI
Drosophila_yakuba|9865        FRAWCGIVSFAERLALA-----DESGSD-DSCDELEKADFNSMEQIMPDF-TVPEKLKEI
Drosophila_sechellia|14073    FRAWCGIVSFAERLALA-----DESGSD-DSCDELEKADFNSMEQIMPDF-TVPEKLKEI
Drosophila_simulans|2883      FRAWCGIVSFAERLALA-----DESGSD-DSCDELEKADFNSMEQIMPDF-TVPEKLKEI
Daphnia_pulex|1124            --SYA-----------------ETGR----------------------------------
Tribolium_castaneum|6373      YLAWCSI-----------------------------------------------------
Nasonia_vitripennis|2907      FRTWCGVCAFAERGLPE-----LPRRED-DPASWLERADFETLERRLRNV-SVDEKLAAM
Apis_mellifera|6159           FRSWCGLCAAVERLFCS-----LPLKEI-DPPTWLERVDFETLERRLKAI-NVDPKLAQF
Apis_mellifera|800            FRSWCGLCAAVERLFCS-----LPLKEI-DPPTWLERVDFETLERRLKAI-NVDPKLAQF
Linepithema_humile|8602       FREWCGLCAAVERLLCP-----LPSKET-DPPAWLERADFEALERRLKSVESLDSTLALL
Pogonomyrmex_barbatus|3985    FREWCGLCAAVERLLCP-----LPPREN-DPPTWLERTDFEDLEQRLKSAESVDPTLALL
Branchiostoma_floridae|5883   AKLFTAVCALAERMLYTYFVTEDTDDIMYSQKERVEDADFCALEWKLHGV-KVNPPIRKL
Nematostella_vectensis|26817  LKQFSAIAAFSERILFADFVTEETRGLN-NTREIIEEADFCSLKSKLDGF-KVSPTVRKI
                                 :                                                        

Daphnia_pulex|1125            FLFISEIEDLV-
Tribolium_castaneum|6374      LQGIKTR-----
Pediculus_humanus|253         LKSLRDL-----
Culex_quinquefasciatus|13813  LHIIKSN-----
Drosophila_melanogaster|10919 FDVIRKTHKKRY
Drosophila_yakuba|9865        FDVIRKTHKNRY
Drosophila_sechellia|14073    FDVIRKTHKNRY
Drosophila_simulans|2883      FDVIRKTHKNRY
Daphnia_pulex|1124            ------------
Tribolium_castaneum|6373      ------------
Nasonia_vitripennis|2907      LRLIRDR-----
Apis_mellifera|6159           LREIRDK-----
Apis_mellifera|800            LREIRDK-----
Linepithema_humile|8602       LKEIRDR-----
Pogonomyrmex_barbatus|3985    LRAIRDR-----
Branchiostoma_floridae|5883   LQML--------
Nematostella_vectensis|26817  LDVL--------