Orthologs Set ID: EOG4006BR


Orthology Database
OrthoDB4
Gene Symbol(s)
MLYCD

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Anolis carolinensis 17353 600, 716, 927, 1140
Apis mellifera 35463 549, 708, 916, 1071, 1285, 1534, 1640
Bos taurus 8430 600, 716, 927, 1140
Branchiostoma floridae 42309 228, 393, 549, 708, 927, 1063, 1240, 1640
Caenorhabditis elegans 10573 189, 423, 549, 782, 1063, 1291, 1534, 1640
Callithrix jacchus 9355 600, 716, 927, 1140
Canis familiaris 23275 60, 480, 600, 716, 927, 1140
Cavia porcellus 6308 130, 600, 716, 927, 1140
Danio rerio 11244 600, 716, 927, 1140
Daphnia pulex 24329 549, 1071, 1534, 1572, 1640
Dasypus novemcinctus 4090 597, 716, 927, 1140
Dipodomys ordii 10310 600, 716, 927, 1140
Echinops telfairi 15061 600, 716, 771, 927
Equus caballus 18610 716, 927, 1140
Erinaceus europaeus 216 548, 600, 716, 927, 1140, 1813
Felis catus 10871 600, 716, 927, 1140
Fugu rubripes 21650 600, 716, 927, 1140
Gallus gallus 4163 600, 716, 927, 1140
Gasterosteus aculeatus 23283
Gorilla gorilla 29937 600, 716, 927, 1140
Homo sapiens 32504 600, 716, 927, 1140
Ixodes scapularis 8636 549, 708, 927, 1063, 1285, 1534, 1640
Linepithema humile 8515 228, 393, 549, 708, 916, 1071, 1285, 1534, 1658
Loxodonta africana 22105 600, 716, 927, 1140
Macropus eugenii 821 26, 93, 102, 183, 267, 287, 309, 390, 401, 421, 600, 716, 927, 1140, 1308, 1398, 1413, 1488, 1602, 1641, 1677
Microcebus murinus 7543 336, 351, 371, 408, 427, 600, 716, 927, 1038, 1098, 1140, 1421, 1467, 1473, 1497, 1514, 1522, 1531, 1544, 1553
Monodelphis domestica 5421 382, 600, 716, 927, 1140
Mus musculus 42855 600, 716, 927, 1140
Myotis lucifugus 3021 76, 81, 600, 716, 820, 927, 1140, 1599
Nasonia vitripennis 4128 228, 393, 549, 708, 916, 1071, 1270, 1640
Nematostella vectensis 27223 549, 708, 927, 1063, 1376, 1484, 1555
Ochotona princeps 16626 52, 59, 77, 131, 154, 171, 183, 194, 222, 600, 716, 927, 1140, 1155
Ornithorhynchus anatinus 23986
Ornithorhynchus anatinus 23987 716, 927
Oryzias latipes 18991 276, 526, 531, 603, 716, 927, 1140
Otolemur garnettii 9673 716, 927, 1140, 1284
Pan troglodytes 14856 600, 716, 927, 1140
Pediculus humanus 8030 228, 549, 708, 969, 1285, 1534, 1742
Pogonomyrmex barbatus 2952 549, 708, 876, 916, 1071, 1119, 1285, 1534, 1640
Pongo abelii 10961 450, 480, 600, 716, 927, 1140
Procavia capensis 12495 600, 716, 927, 1140, 1175, 1214
Pteropus vampyrus 10878 91, 600, 716, 927, 1140
Rattus norvegicus 17390 600, 716, 927, 1140
Rhesus macaque 25536 600, 716, 927, 1140
Taeniopygia guttata 1636 600, 716, 927, 1140
Taeniopygia guttata 17863
Tetraodon nigroviridis 4258 600, 716, 927, 1140
Tupaia belangeri 14197 716, 927, 1140, 1813
Tursiops truncatus 9453 716, 927, 1140, 1697
Xenopus tropicalis 2763 600, 716, 927, 1140

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 17353 ENSACAT00000017767 anoCar1
Apis mellifera 35463 GB12048-PA apiMel3
Bos taurus 8430 ENSBTAT00000005562, NM_001098946 512341 ENSBTAG00000004248 MLYCD bosTau4
Branchiostoma floridae 42309 estExt_fgenesh2_pg.C_1980040 braFlo1
Caenorhabditis elegans 10573 F35G12.1a 175597 WBGene00009439 mlcd-1 ce6
Callithrix jacchus 9355 ENSCJAT00000001160 100395789 ENSCJAG00000000633 MLYCD calJac3
Canis familiaris 23275 ENSCAFT00000031784 489688 ENSCAFG00000019971 MLYCD canFam2
Cavia porcellus 6308 ENSCPOT00000001098 100728189 ENSCPOG00000001087 cavPor3
Danio rerio 11244 ENSDART00000099599 100037349 ENSDARG00000068779 mlycd danRer6
Daphnia pulex 24329 PASA_GEN_0100475 1.1
Dasypus novemcinctus 4090 ENSDNOT00000002100 ENSDNOG00000002100 MLYCD dasNov2
Dipodomys ordii 10310 ENSDORT00000009912 ENSDORG00000009913 Mlycd dipOrd1
Echinops telfairi 15061 ENSETET00000014649 ENSETEG00000014650 TENREC
Equus caballus 18610 ENSECAT00000024377 100070049 ENSECAG00000022837 MLYCD equCab2
Erinaceus europaeus 216 ENSEEUT00000000193 ENSEEUG00000000193 eriEur1
Felis catus 10871 ENSFCAT00000011553 101086616 ENSFCAG00000011551 MLYCD felCat3
Fugu rubripes 21650 ENSTRUT00000002797 101073602 ENSTRUG00000001188 mlycd fr2
Gallus gallus 4163 ENSGALT00000008821 415812 ENSGALG00000005494 MLYCD galGal3
Gasterosteus aculeatus 23283 ENSGACT00000018250 ENSGACG00000013794 mlycd gasAcu1
Gorilla gorilla 29937 ENSGGOT00000008044 101136977 ENSGGOG00000008007 MLYCD gorGor3
Homo sapiens 32504 ENST00000262430, NM_012213 23417 ENSG00000103150 MLYCD hg19,GRCh37
Ixodes scapularis 8636 ISCW010433-RA ISCW010433 IscaW1
Linepithema humile 8515 LH17056-RA 1.2
Loxodonta africana 22105 ENSLAFT00000008543 100658143 ENSLAFG00000008543 loxAfr3
Macropus eugenii 821 ENSMEUT00000000832 ENSMEUG00000000820 Meug_1.0
Microcebus murinus 7543 ENSMICT00000007023 ENSMICG00000007016 micMur1
Monodelphis domestica 5421 ENSMODT00000018900 100027732 ENSMODG00000014843 MLYCD monDom5
Mus musculus 42855 ENSMUST00000098367 56690 ENSMUSG00000074064 Mlycd mm9
Myotis lucifugus 3021 ENSMLUT00000002982 102417575 ENSMLUG00000002980 MLYCD myoLuc1
Nasonia vitripennis 4128 NV16716-RA 1.2
Nematostella vectensis 27223 e_gw.147.57.1 Nemve1
Ochotona princeps 16626 ENSOPRT00000005670 101527134 ENSOPRG00000005665 OchPri2.0
Ornithorhynchus anatinus 23986 ENSOANT00000017965 100077493 ENSOANG00000011336 ornAna1
Ornithorhynchus anatinus 23987 ENSOANT00000032258 100077493 ENSOANG00000022305 ornAna1
Oryzias latipes 18991 ENSORLT00000019744 ENSORLG00000015765 mlycd oryLat2
Otolemur garnettii 9673 ENSOGAT00000009299 100947044 ENSOGAG00000009296 MLYCD otoGar1
Pan troglodytes 14856 ENSPTRT00000015489, NM_012213 468127 ENSPTRG00000008403 MLYCD panTro2
Pediculus humanus 8030 PHUM479110-RA 8239436 PHUM479110 PhumU1
Pogonomyrmex barbatus 2952 PB23812-RA 1.2
Pongo abelii 10961 ENSPPYT00000008918 100431443 ENSPPYG00000007594 ponAbe2
Procavia capensis 12495 ENSPCAT00000000463 ENSPCAG00000000479 proCap1
Pteropus vampyrus 10878 ENSPVAT00000006998 ENSPVAG00000006998 pteVam1
Rattus norvegicus 17390 ENSRNOT00000019923 85239 ENSRNOG00000014522 Mlycd rn4
Rhesus macaque 25536 ENSMMUT00000013757 714605 ENSMMUG00000009849 rheMac2
Taeniopygia guttata 17863 ENSTGUT00000015280 ENSTGUG00000014688 taeGut1
Taeniopygia guttata 1636 ENSTGUT00000004524 100221257 ENSTGUG00000004352 taeGut1
Tetraodon nigroviridis 4258 ENSTNIT00000011844 ENSTNIG00000008807 mlycd tetNig2
Tupaia belangeri 14197 ENSTBET00000014198 ENSTBEG00000014212 tupBel1
Tursiops truncatus 9453 ENSTTRT00000008666 101333859 ENSTTRG00000008669 turTru1
Xenopus tropicalis 2763 ENSXETT00000028968 100145491 ENSXETG00000013233 mlycd xenTro2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 17136 ENSACAP00000017425 anoCar1
Apis mellifera 2047 GB12048 apiMel3
Bos taurus 10371 ENSBTAP00000005562 512341 ENSBTAG00000004248 MLYCD bosTau4
Branchiostoma floridae 1218 estExt_fgenesh2_pg.C_1980040 braFlo1
Caenorhabditis elegans 11183 F35G12.1a 175597 WBGene00009439 mlcd-1 ce6
Callithrix jacchus 2263 ENSCJAP00000001091 100395789 ENSCJAG00000000633 MLYCD calJac3
Canis familiaris 9383 ENSCAFP00000029593 489688 ENSCAFG00000019971 MLYCD canFam2
Cavia porcellus 4929 ENSCPOP00000000983 100728189 ENSCPOG00000001087 cavPor3
Danio rerio 3315 ENSDARP00000090373 100037349 ENSDARG00000068779 mlycd danRer6
Daphnia pulex 953 JGI_V11_300159 1.1
Dasypus novemcinctus 3617 ENSDNOP00000001630 ENSDNOG00000002100 MLYCD dasNov2
Dipodomys ordii 9682 ENSDORP00000009316 ENSDORG00000009913 Mlycd dipOrd1
Echinops telfairi 11860 ENSETEP00000011876 ENSETEG00000014650 TENREC
Equus caballus 20286 ENSECAP00000020246 100070049 ENSECAG00000022837 MLYCD equCab2
Erinaceus europaeus 166 ENSEEUP00000000166 ENSEEUG00000000193 eriEur1
Felis catus 11977 ENSFCAP00000010724 101086616 ENSFCAG00000011551 MLYCD felCat3
Fugu rubripes 2781 ENSTRUP00000002781 101073602 ENSTRUG00000001188 mlycd fr2
Gallus gallus 8520 ENSGALP00000008807 415812 ENSGALG00000005494 MLYCD galGal3
Gasterosteus aculeatus 17633 ENSGACP00000018215 ENSGACG00000013794 mlycd gasAcu1
Gorilla gorilla 23175 ENSGGOP00000007832 101136977 ENSGGOG00000008007 MLYCD gorGor3
Homo sapiens 39762 ENSP00000262430 23417 ENSG00000103150 MLYCD hg19,GRCh37
Ixodes scapularis 8650 ISCW010433-PA ISCW010433 IscaW1
Linepithema humile 14603 LH17056-PA 1.2
Loxodonta africana 9480 ENSLAFP00000007175 100658143 ENSLAFG00000008543 loxAfr3
Macropus eugenii 760 ENSMEUP00000000768 ENSMEUG00000000820 Meug_1.0
Microcebus murinus 6389 ENSMICP00000006398 ENSMICG00000007016 micMur1
Monodelphis domestica 17343 ENSMODP00000018567 100027732 ENSMODG00000014843 MLYCD monDom5
Mus musculus 40015 ENSMUSP00000095970 56690 ENSMUSG00000074064 Mlycd mm9
Myotis lucifugus 2708 ENSMLUP00000002711 102417575 ENSMLUG00000002980 MLYCD myoLuc1
Nasonia vitripennis 6623 NV16716-PA 1.2
Nematostella vectensis 9693 e_gw.147.57.1 Nemve1
Ochotona princeps 14498 ENSOPRP00000005205 101527134 ENSOPRG00000005665 OchPri2.0
Ornithorhynchus anatinus 4059 ENSOANP00000017962 100077493 ENSOANG00000011336 ornAna1
Ornithorhynchus anatinus 4060 ENSOANP00000028461 100077493 ENSOANG00000022305 ornAna1
Oryzias latipes 18869 ENSORLP00000019743 ENSORLG00000015765 mlycd oryLat2
Otolemur garnettii 8326 ENSOGAP00000008326 100947044 ENSOGAG00000009296 MLYCD otoGar1
Pan troglodytes 19752 ENSPTRP00000014340 468127 ENSPTRG00000008403 MLYCD panTro2
Pediculus humanus 7874 PHUM479110-PA 8239436 PHUM479110 PhumU1
Pogonomyrmex barbatus 13812 PB23812-PA 1.2
Pongo abelii 19290 ENSPPYP00000008570 100431443 ENSPPYG00000007594 ponAbe2
Procavia capensis 11690 ENSPCAP00000000433 ENSPCAG00000000479 proCap1
Pteropus vampyrus 10249 ENSPVAP00000006603 ENSPVAG00000006998 pteVam1
Rattus norvegicus 13840 ENSRNOP00000019923 85239 ENSRNOG00000014522 Mlycd rn4
Rhesus macaque 32845 ENSMMUP00000012891 714605 ENSMMUG00000009849 rheMac2
Taeniopygia guttata 7859 ENSTGUP00000004476 100221257 ENSTGUG00000004352 taeGut1
Taeniopygia guttata 5765 ENSTGUP00000015051 ENSTGUG00000014688 taeGut1
Tetraodon nigroviridis 4239 ENSTNIP00000011656 ENSTNIG00000008807 mlycd tetNig2
Tupaia belangeri 12320 ENSTBEP00000012304 ENSTBEG00000014212 tupBel1
Tursiops truncatus 8933 ENSTTRP00000008215 101333859 ENSTTRG00000008669 turTru1
Xenopus tropicalis 15934 ENSXETP00000028968 100145491 ENSXETG00000013233 mlycd xenTro2

multiple sequence alignment in CLUSTALW format


Nematostella_vectensis|27223   ------------------------------------------------------------
Caenorhabditis_elegans|10573   ------------------------------------------------------------
Daphnia_pulex|24329            ------------------------------------------------------------
Branchiostoma_floridae|42309   ------------------------------------------------------------
Ixodes_scapularis|8636         ------------------------------------------------------------
Pediculus_humanus|8030         ATGGAAGATGATTGTAAGTATCCGGATATATTTTCTAATGAGGACTTTGTTCAAAGAAGA
Nasonia_vitripennis|4128       ------------ATGATGATGAAGCCACCAAGCTCCGTTTTCCAACTGCCTGGATTTCTA
Danio_rerio|11244              ------ATGACACCTTTCCACTTAAGTACAGTCGCGCGATCTTTGCTAAAGTCGTATCGA
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          ---------CGCCGCTTCTCT---------------------------------------
Fugu_rubripes|21650            ------------------------------------------------------------
Tetraodon_nigroviridis|4258    TGGCGACACCGGACGCTCCTCAAAGCAGTCCTTCGAGCTTCGGACGTCGGCTTTTGGCGC
Xenopus_tropicalis|2763        ------------------------------------------------------------
Erinaceus_europaeus|216        ---------ATGAGAGGCCTCGGGCCAAGCCTGGCGGCCCGGCGCCTCATCCGTCTGTGG
Dasypus_novemcinctus|4090      ---------ATGCGAGGCCTCGGGCCGGGCCTGGCGGCGTGGCGTCTGCTCCCGCTGCGG
Otolemur_garnettii|9673        ------------------------------------------------------------
Monodelphis_domestica|5421     ---------ATGAGAGGCCTGGGGCCCGGACTGTCAGCGCAAAGGCTCCTGCGGCTCCGG
Macropus_eugenii|821           ---------ATGAGAGGCCTGGGGCCGGGCCTGTCAGCTCAAAAGCTCCTGGGGCTACGG
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      ------------------------------------------------------------
Gallus_gallus|4163             ------------------------------------------------------------
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       ------------------------------------------------------------
Tupaia_belangeri|14197         ------------------------------------------------------------
Microcebus_murinus|7543        ------------------------------------------------------------
Procavia_capensis|12495        ---------ATGCGAGGCCTCGGGCCAGGTCTGACAGCGCGGCGCTTCTTGTCGCTGGGA
Echinops_telfairi|15061        ---------ATGCGGGGCCTCGGGCCA------GTGGCGCGCTCTCTGCTGTTGCTGCGG
Bos_taurus|8430                ---------ATGCGAGTCCTCGGGCCAGGCTTGTCTGCCGGGCGCCTCCTCCGGCTGCGG
Tursiops_truncatus|9453        ------------------------------------------------------------
Dipodomys_ordii|10310          ---------ATGAGAGGCCTCGGGCCAGGCCTGGCGGCGCGGCGCCTCCTCCCGCTGCGC
Loxodonta_africana|22105       ---------ATGTGGGGCTTTCGGCCAGGTTTAACCGCGCGGCGCTTCTTCTCGCTGCGG
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        ---------ATGCGAAGCCTGGGCCCCGGCTTGACGACCCGGCGGTTCCTTCCGCTGCGG
Pteropus_vampyrus|10878        ---------ATGCTTGGCCTCCGATCAAGTCTGACGACGCGGTGCTTCCTCACGCTGAGG
Myotis_lucifugus|3021          ---------ATGCGAGGCCTCGGGCCAGGTCTGGCGGTGCGGCGACTCCTCCCGCTGCGG
Cavia_porcellus|6308           ---------ATGCGGGGCTTCGGGCCAGGGCTGACCACGCGGAATCTCCTCCCGCTGCGG
Canis_familiaris|23275         ---------ATGCGAGGCCTGGGGCCGGCGCTGACGGCGCGGCGCCTCTTCCCGCTGCGG
Mus_musculus|42855             ---------ATGCGAGGCCTCGGGCCAGGCTTGAGGGCTCGGCGCCTGCTCCCACTGCGG
Rattus_norvegicus|17390        ---------ATGAGAGGCTTGGGGCCAAGCTTGAGGGCTCGGCGCCTGCTCCCACTGCGG
Felis_catus|10871              ------------------------------------------------------------
Equus_caballus|18610           ------------------------------------------------------------
Callithrix_jacchus|9355        ---------ATGCGAGGCCTCGGGCCAGGTCTGACAGCCAGGCGTCTTCTCCCGCTGCGG
Pongo_abelii|10961             ------------------------------------------------------------
Rhesus_macaque|25536           ---------ATGAGAGGCCTCGGGCCAGGCTTGACGGCCAGGCGTCTCCTCCCGCTGCGG
Homo_sapiens|32504             ---------ATGCGAGGCTTCGGGCCAGGCTTGACGGCCAGGCGTCTCCTCCCGCTGCGG
Pan_troglodytes|14856          ---------ATGCGAGGCCTCGGGCCAGGCTTGACGGCCAGGCGTCTCCTCCCGCTGCGG
Gorilla_gorilla|29937          ---------ATGCGAGGCCTCGGGCCAGGCTTGACGGCCAGGCGTCTCCTCCCGCTGCGG
Apis_mellifera|35463           ------------------------------------------------------------
Linepithema_humile|8515        ---------ATGTTTGGAAAGCTTTTCTCCGAACTTCTGCCAGTTATTCGACGTTGCAGA
Pogonomyrmex_barbatus|2952     ------------------------------------------------------------
                                                                                           

Nematostella_vectensis|27223   ------------------------------------------------------------
Caenorhabditis_elegans|10573   ---------------------------ATGCTTCGTCGATATTCACATTTTTACTCGATT
Daphnia_pulex|24329            ------------------------------------------------------------
Branchiostoma_floridae|42309   ------------------------------------------------------------
Ixodes_scapularis|8636         ------------------------------------------------------------
Pediculus_humanus|8030         ------------------------------------------------------------
Nasonia_vitripennis|4128       CGACGCTGCAGTAATCTAAACTCTTTTCATACAAAATTAAATACAAAGCTA---------
Danio_rerio|11244              CACAGAGCTGTACTAAAAACAATCCACGGACTCCGACTCTGGGATTTTCAAAGCATGCAT
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          ------------------------------------------------------------
Fugu_rubripes|21650            ------------------------------------------------------------
Tetraodon_nigroviridis|4258    TGGTACTCGACACCACTACGA---------------------------------------
Xenopus_tropicalis|2763        ------------------------------------------------------------
Erinaceus_europaeus|216        CTGCCGACAGTGCAGCCGCAA---------TTCCGGCTGTCTAGCGGCCGG---------
Dasypus_novemcinctus|4090      CTGCCTCCGCGGCCGCCCGCG---------CTCCGGCTGCGGAGCGGGCGG------GCG
Otolemur_garnettii|9673        ------------------------------------------------------------
Monodelphis_domestica|5421     ------CCCCGGCTTCCCACCCGGCCCCGGCCACGACGACTTGGGGGCCCC---------
Macropus_eugenii|821           CTCCGCTCTCGGCTTCCGACCCGGCTCCGGCTGGCGGCTTGGGCC---------------
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      ------------------------------------------------------------
Gallus_gallus|4163             ---------------------------------------GGCCCGTGTCGGGGCACGGCG
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       ------------------------------------------------CGGGGCCCGCGC
Tupaia_belangeri|14197         ------------------------------------------------------------
Microcebus_murinus|7543        ------------------------------------------------------------
Procavia_capensis|12495        CTCCCTCCCCGGCTGCCGCGACTGTCCGGGGCCCGGCTGTCAAGCGGGCCG------GCG
Echinops_telfairi|15061        CTCTGCCCGCGGCCGCCTGGA---------GCCCGCCTGTCCTACGGTCAG------GCA
Bos_taurus|8430                CTACCCCCGCGGCAGCCGCAGCCGCCAGGACCCCGGCTGTCGAgcgggcgg------ccg
Tursiops_truncatus|9453        ------------------------------------------------------------
Dipodomys_ordii|10310          TTCCCCCCGAGGCCGCCGCGGCCCCCGGGGCCCCGGCTGTCCAGCGGGCCTCCGGCGGCG
Loxodonta_africana|22105       CTACTTCCCCGGCCGCCGCGGCCGCCCAGGGCGCGGCTGTCAAGCGGGCCG------GCG
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        TTCACCCAGGGGGCGCCCGGGCGCACAGAGGACCAGATGTCCAGTGGACCC---------
Pteropus_vampyrus|10878        CTGCCCCTGAGGCTGCCCCGA---------CTCCGGCTGTTAACTGTGCAG------GCG
Myotis_lucifugus|3021          TTACCCCCGCGGCCGCCCGGG---------CCCCGGCTGTCGAGCCGGCCG---------
Cavia_porcellus|6308           TTTGCCCCGCGGCCGCCGCGGCCTCCAGGGCCCCTGCTGTCGAGC---------------
Canis_familiaris|23275         GTGTCGAGCGGGGCGGCGGCG---------------------------------------
Mus_musculus|42855             TccccgccgcggcctccggggccccggggACGTCGGCTGTGCGGCGGGCTC---------
Rattus_norvegicus|17390        TACCCGCCGCGGCCTCCGGGGCCTCGGGGACCTAGGCTGTGCAGC---------------
Felis_catus|10871              ------------------------------------------------------------
Equus_caballus|18610           ------------------------------------------------------------
Callithrix_jacchus|9355        TTTCCCCCGCGGCCGCCCGGG---------CCCCGGCTGATAAGCGGGCAG---------
Pongo_abelii|10961             ------------------------------------------------------------
Rhesus_macaque|25536           TTTAccccgcggccgcccggg---------ccccggcTGGCTAGCGGGCAG---------
Homo_sapiens|32504             TTgcccccgcggccgcccggg---------ccccggctggcgagcgggcag---------
Pan_troglodytes|14856          TTTcccccgcggccgcccggg---------ccccggctggcgagcgggcag---------
Gorilla_gorilla|29937          TTCCCCCCGCGGCCGCCCGGG---------CCCCGGCTGGCGAGCGGGCAG---------
Apis_mellifera|35463           ------------------------------------------------------------
Linepithema_humile|8515        TTCAGGACTGAATTAAATTCCGTCGATGCATTGAAGTGGAGTATTAAACGTGAATATGGA
Pogonomyrmex_barbatus|2952     ------------------------------------------------------------
                                                                                           

Nematostella_vectensis|27223   ------------------------------------------------------------
Caenorhabditis_elegans|10573   CGATATTCTTCCACATTATTATCTACTTTAGACGGACTCACAAATCGAACAAGTGGAGAT
Daphnia_pulex|24329            ------------------------------------------------------------
Branchiostoma_floridae|42309   ------------ATGTTCACGGCAACCATCTCACAGATG---GTCACGGAGATCATCGGA
Ixodes_scapularis|8636         ------------------------------------------------------------
Pediculus_humanus|8030         ---------------CTAAGCACATTTGAAGACGTTCAAGTATGCATTTCTTTACTTAAA
Nasonia_vitripennis|4128       ---------AAACCTCACACAGAGGGGGAAGAGAATGCT---ATCAACAAAGATCTCGAG
Danio_rerio|11244              CCACGCTCCTCCATCGCAGGGCACGAACTCATGGAGGAGATCCTGAGGAAGACTGTGGCC
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          ------GTCCGTGTTCGCGCGTCGGGGATGGAGGAGATC---CTGGCGAGGGTTGTCGTG
Fugu_rubripes|21650            ---------------------------ATGGATGAGATA---CTCGCTAGGATCGTTGCA
Tetraodon_nigroviridis|4258    ------------GGCGGCGCCCCGGGCATGGATGAGATA---CTCGCCAGGGTCGTTCCA
Xenopus_tropicalis|2763        ------------------------ACCATGGATGAGTTG---CTGAGCAGGTCTGTGCCC
Erinaceus_europaeus|216        CCGGCCGACTCGTCCCTGGAGCGGGCCATGGACGAGCTG---CTGCTCCGCGCCGTGCCA
Dasypus_novemcinctus|4090      GGGCCGGCCGGCGCCCTGGAGCGGGCCATGGACGAGCTG---CTGCGCCGCGCCGTGCCG
Otolemur_garnettii|9673        ------------------------------------------------------------
Monodelphis_domestica|5421     ------GGGGCTACCCTGGAACGGGCAATGGATGAACTG---CTGGGCCGCACTGTGCCT
Macropus_eugenii|821           ---CCCGGAGCGACCCTGGAACGGGCAATGGATGAACTG---CTGGGCCGCACCGTGCCG
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      ------------------------------------------------------------
Gallus_gallus|4163             GGCTGCGGTGCCGCCTCCGACGTAAGCATGGAGGAGCTG---CTGAGCCGCTCCGTGCCG
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       CGCCTCTCGTCGGGCGCTGCCCCGGgcatggaggagctg---ctgcgCCGCTCGGTGCCG
Tupaia_belangeri|14197         ------------------------------------------------------------
Microcebus_murinus|7543        ------------------------------------------------------------
Procavia_capensis|12495        GCGGCGGCCGGCGCTCTGGAGCGAGCCATGGACGAGCTG---CTGCGCCGTGCCGTGCCG
Echinops_telfairi|15061        ACGACGGCCGGCGCCCTGGAGCGCGCCATGGACGAGCTG---CTGCGGCGCGCCGTGCCC
Bos_taurus|8430                gcggcggccggcgcccTGGAGCGGGCCATGGACGAGCTG---CTGCACCGCGCCGTGCCC
Tursiops_truncatus|9453        ------------------------------------------------------------
Dipodomys_ordii|10310          GCGGCGGCCGGAGCCTCGGAGCGGGCCATGGAGGAGCTG---CTGCGCCGCGCCGTGCCG
Loxodonta_africana|22105       GAGACGGTCGGCGCCCTGGAACGGGCCATGGATGAGCTG---CTGCGCCGCGCCGTGCCG
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        ---GATGCCCGCGCCTTCGAGCGGCCCATGGAGAATTTG---CTGTGCCGACTGTTCCCG
Pteropus_vampyrus|10878        ---GTGGTGGGT------------GCCATGGACGAGCTG---CTTCACCGCGCGGTACCC
Myotis_lucifugus|3021          ACGGTGGCGGGCGCCCTGGACCGGGCCATGGACGAGCTG---CTGCGCCGCGCCGTGCCC
Cavia_porcellus|6308           ---------AGCTCCCTGACGCGGGCCATGGACGAGCTG---CTTCGCCGCGCCGTGCCG
Canis_familiaris|23275         GCGGCGGCGGGCGCCCCGGAGCGGGCCATGGACGAGCTG---CTGCGCCGCGCCGTGCCC
Mus_musculus|42855             ---------------GCGGCCAGCGCCATGGACGAGCTG---CTGCGGCGAGCCGTGCCC
Rattus_norvegicus|17390        ---------GGGCTCACGGCTAGCGCCATGGACGAGCTG---CTACGGCGAGCCGTGCCA
Felis_catus|10871              ------------------------------------------------------------
Equus_caballus|18610           ------------------------------------------------------------
Callithrix_jacchus|9355        ---GCGGCCGGCGCCCTGGAGCGGGCCATGGACGAGCTG---CTGCGCCGCGCGGTGCCG
Pongo_abelii|10961             ------------------------------------------------------------
Rhesus_macaque|25536           ---GCGACTGGCGCCCTGGAGCGGGCCATGGACGAGCTG---CTGCGCCGCGCGGTGCCG
Homo_sapiens|32504             ---gcggccggcgcccTGGAGCGGGCCATGGACGAGCTG---CTGCGCCGCGCGGTGCCG
Pan_troglodytes|14856          ---gcggccggcgcccTGGAGCGGGCCATGGACGAGCTG---CTGCGCCGCGCGGTGCCG
Gorilla_gorilla|29937          ---GCGGCCGGCGCCCTGGAGCGGGCCATGGACGAGCTG---CTGCGCCGCGCGGTGCCG
Apis_mellifera|35463           ------------------------------------------------------------
Linepithema_humile|8515        AAGTCATCCACTTTGTATGCCGAAACGAACAGTGCGTTGCCTGTGGACGAGGAACTGCAA
Pogonomyrmex_barbatus|2952     ------------------------------------------------------------
                                                                                           

Nematostella_vectensis|27223   ------------------------------------------------------------
Caenorhabditis_elegans|10573   AAGTTACTCACTTAT---------------------------------------AGCGAG
Daphnia_pulex|24329            ------------------------------------------------------------
Branchiostoma_floridae|42309   CCTAAA---------GAAGCTGGACTGAAAAAGCCAACGATACCTGAGGGGAAAACCAGG
Ixodes_scapularis|8636         ------------------------------------------------------------
Pediculus_humanus|8030         GAAGTTTTGGAGTACCGTAAAAAAAATATAAGCAGCTGGATTGTAGAAAGTAAAGTAAAA
Nasonia_vitripennis|4128       GAAATTATAGACTTCAAAACAAGAAATACTAGCAGCTGGGTCATAGAAACAAAAGTGAAC
Danio_rerio|11244              CCATTGCCCAGCTACGAGATGAGAGACAAATCTCCACCTCCACCCGAATCCAACAGTTTG
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          CCTTTACCTTCCTACGAAACGAGAGATAAATCCCCGCCTCCCCCCGAGTCCAACAGCTTG
Fugu_rubripes|21650            CCACTGCCCACATATGAAACGAGAGACAAATCCCCTCCTCCTCCAGAATCGAATAGTTTG
Tetraodon_nigroviridis|4258    CCACTGCCCACATATGAAACGAGAGACAAATCCCCGCCACCTCCAGAATCGAGCAGTTTG
Xenopus_tropicalis|2763        CCTCTGCCCCCCTATGAAACTAAAGAAAAATGCCCAGCGCCCTCTGAGATCCAGAGCATT
Erinaceus_europaeus|216        GCCGCGCCGCCCTACGAGCTGCGCGAGAAGACGCCGGCGCCCGCCGAGGGCCAGTGCGCG
Dasypus_novemcinctus|4090      CAGACGCCGGCCTACGAGCTGCGCGAGAAGACGCCGGCGCCGGCCGAGGGCCAGTGCGCC
Otolemur_garnettii|9673        ------------------------------------------------------------
Monodelphis_domestica|5421     CAGGCCCCGGCCTATGAACTCCGAGAAAAAACACCCGCCCCAGCCGAGGCTCAGTGCGCT
Macropus_eugenii|821           CAG---CCGGCCTACGAGCTCCGGGACCAGACGCCCGCCCCGGCCGAGGGTCAGTGCGCT
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      ---------------------------------------------GAGTTGCGGGGCGAG
Gallus_gallus|4163             CCGCTGCCGCCCTACGAGACCAAGGAGAAGGCGCCGCCCCCGGCGGAGCTGCGCGGCGCG
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       CCGCTGCCGCCCTACGAGACCAAGGAGAAAGCACCGCCGCCCGCCGAGCTGCGCGGCGCG
Tupaia_belangeri|14197         ------------------------------------------------------------
Microcebus_murinus|7543        ------------------------------------------------------------
Procavia_capensis|12495        GCGACGCCTGTCTACGAGCTGCGCGAGAAGACTCCGGCGCCGGCCGAGGGCCAGTGCGCG
Echinops_telfairi|15061        GCCACGCCGGCGTACGAGCTGCGCGAGAAGACGCCGGCGCCCGCCGAGGGCCAGTGCGCC
Bos_taurus|8430                GCGATGCCGGCCTATGAGCTGCGCGAGAAGACCCCGGCGAGGGCGGAGAACCAGTGCGCA
Tursiops_truncatus|9453        ------------------------------------------------------------
Dipodomys_ordii|10310          CCGACGCCGACCTACGAGCTGCGCGAGAAGACGCCGGCGCCCGCCGAGGCGCAGTGCGCC
Loxodonta_africana|22105       GCCACGCCGGTCTACGAGCTGCGCGAGAAGACGCCGGCGCCGGCCGAGGGCCAGTGCGCG
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        ACACTG---GCCTACGAGCTGCGCGAGAAGACGCCGGCGCCCGCCGAGGGGCAGTGCGCC
Pteropus_vampyrus|10878        GCGACGCCATCCTACGAGCTGCGCGAGAAGACCCCGGCGCCGGCGGAGGGCCAGTGCGCG
Myotis_lucifugus|3021          GCGACGCCGGTCTACGAGCTGCGGGAGAAGACGCCGGCGCCCGCCGAGGGCCAGTGCGCG
Cavia_porcellus|6308           CAGACGCCGGCCTACGAGCTGCGCGAGAAGACCCCTGCGCCCGCTGAGGGCCAGTGCGCC
Canis_familiaris|23275         GCCACGCCGGCCTACGAGCTGCGCGAGAAGACGCCGGCGCCGGCCGAGGGCCAGTGCGCG
Mus_musculus|42855             CCGACGCCGGCCTACGAGCTGCGCGAGAAGACGCCGGCGCCCGCCGAGGGCCAGTGCGCC
Rattus_norvegicus|17390        CCCACGCCGGCCTACGAGCTGCGCGAGAAGACGCCGGCCCCGGCCGAGGGGCAGTGCGCG
Felis_catus|10871              ------------------------------------------------------------
Equus_caballus|18610           ------------------------------------------------------------
Callithrix_jacchus|9355        CCGACGCCGGCCTACGAGCTGCGCGAAAAGACGCCGGCGCCCGCCGAGGGTCAGTGCGCG
Pongo_abelii|10961             ------------------------------------------------------------
Rhesus_macaque|25536           CCGACACCGGCCTACGAGCTGCGCGAGAAAACACCGGCGCCCGCCGAGGGTCAGTGCGCG
Homo_sapiens|32504             CCGACGCCGGCCTACGAGCTGCGCGAGAAGACACCGGCGCCCGCCGAGGGTCAGTGCGCG
Pan_troglodytes|14856          CCGACGCCGGCCTACGAGCTGCGCGAGAAGACACCGGCGCCCGCCGAGGGTCAGTGCGCG
Gorilla_gorilla|29937          CCGACGCCGGCCTACGAGCTGCGCGAGAAGACACCGGCGCCCGCCGAGGGTCAGTGCGCG
Apis_mellifera|35463           ------------------------------------------------------------
Linepithema_humile|8515        GAAATTTTTCAATTTAGAGACACCAAGATTAGCAACTGGATCATAGAGAACAAGACACAT
Pogonomyrmex_barbatus|2952     ------------------------------------------------------------
                                                                                           

Nematostella_vectensis|27223   ------------------------------------------------------------
Caenorhabditis_elegans|10573   AAGTTTTCCAAATTATATGCCAATTCCACGCCAGAAACT------CGAAAATCGATTTTC
Daphnia_pulex|24329            ------------------------------------------------------------
Branchiostoma_floridae|42309   CACTTATGCGATGTGTACAACTCCCTGTCAACAGAAGAC------AAGGCGACGTTCCTA
Ixodes_scapularis|8636         ------------------------------------------------------------
Pediculus_humanus|8030         CAACTATGTAGTTTTTACAAATGTTTAATTAAAAATCAT------AGAAATGAATTTATT
Nasonia_vitripennis|4128       AGTCTGTGTTTAAAATATAATATTTTAACAAAGGATGAG------CGAGCCAAGTTTCTA
Danio_rerio|11244              GAGTTCATGCATTTTTACAAGAGTTTAGAGAAAGAGCAG------AGGCTGGAGTTCCTC
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          GAGTTTATGCACTTCTACAGAAGTTTAGACAAAGTT---------AAAGCTGAGTTCCTG
Fugu_rubripes|21650            GAGTTTATGCACTTCTACAACGGTCTCTTCAAGGAAGAC------AAGCTCAGTTTCCTC
Tetraodon_nigroviridis|4258    GAGTTTATGCAGTTTTACAAGAGTATCTACAAGGAAGAT------AAGCTCAGGTTCCTC
Xenopus_tropicalis|2763        AACTTTATGCAGTATTACCGGGCGCTGGATAAGGGGGAC------AGGGCTTCCTTTCTT
Erinaceus_europaeus|216        GACTTCGTCAGCTTCTACGGCGGCCTGGCCGCAGCGGCCGAG---CGCGCCGAGCTGCTG
Dasypus_novemcinctus|4090      GACTTCGTGAGCTTCTACGGCGGCCTGACCGAGGCGGCCGAG---CGCGCCGAGCTGCTG
Otolemur_garnettii|9673        ------------------------------------------------------------
Monodelphis_domestica|5421     GACTTCATGCGTTTCTACGGTGCCCTGGAGGGCGCGAGCCAG---CGGGCCGAGCTGCTG
Macropus_eugenii|821           GATTTCATGCGTTTTTACCGCAGCCTGNNNNNNNNNNNNNNN---NNGGCCGAACTGCTG
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      GAGTTCATGCGCTGCTACGGCGCCCTGGAGGAGGCCGGGGAGGCGCGCGCCGAGGTGCTG
Gallus_gallus|4163             GAGTTCGTGCGGTACTACCGCGGCCTTCCGGCCGGGCCGCCC---CGCGCTGAGCTCCTC
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       GAGTTCGTGCGCTTCTACCGCGCGCTGCAGCCCGGGCCGCCC---CGCGCCGAGCTCCTC
Tupaia_belangeri|14197         ------------------------------------------------------------
Microcebus_murinus|7543        ------------------------------------------------------------
Procavia_capensis|12495        GACTTTGTCAACTTTTACGGTGGCCTTACTGATGTGGCGGAG---CGCGCCGAACTGCTG
Echinops_telfairi|15061        GACTTCGTGAGCTTCTACGGCGGCCTGGGCGACGTGGCCGAG---CGCGCCGAGCTGCTG
Bos_taurus|8430                GACTTTGTGAGCTTCTACGGCGGCCTGGCCGAGACAGCCGAG---CGCGCCGAGCTACTG
Tursiops_truncatus|9453        ------------------------------------------------------------
Dipodomys_ordii|10310          GACTTCGTGAGCTTCTACGGCGGCCTGGCCGAGCTGGGCCCG---CGGGCCGAGCTGCTC
Loxodonta_africana|22105       GACTTTGTCAGCTTCTACGGCGCCCTGGCCGGTGTGGCCGAG---CGGGCCGAGCTTCTG
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        GACTTCGTGAGCTTCTACGGCGGCCTGGCCGAGGTGGCGCAG---CGCGCCGAGCTGCTG
Pteropus_vampyrus|10878        GACTTTGTGAGATTCTACGGCGGCCTGGCCGACGCGGCCGAA---CGCGCCGAGCTGCTG
Myotis_lucifugus|3021          GACTTCGTGAGCTTCTACGGCGGCCTGACCGAGGTGGCCGAG---CGCGCCGAGCTGCTG
Cavia_porcellus|6308           GACTTCGTGAGCTTCTACGGCGGCCTGACCGAGGCGACCCAG---CGCGCCGAGCTCCTG
Canis_familiaris|23275         GACTTCGTGAGCTTCTACGGCGGCCTGGCCGAGGCGGCCGAG---CGCGCCGACCTGCTG
Mus_musculus|42855             GACTTCGTGAGCTTCTACGGCGGCCTGGCCGAGGCGTCCCAG---CGCGCCGAGCTGCTC
Rattus_norvegicus|17390        GACTTCGTGAGCTTTTACGGCGGCCTGGCCGAGGCGGCCCAG---CGCGCCGAGCTGCTC
Felis_catus|10871              ---------------------GGCCTGGCCGAGGCGGCCGAG---CGCGCCGAGCTGCTG
Equus_caballus|18610           ------------------------------------------------------------
Callithrix_jacchus|9355        GACTTCGTGAGCTTCTACGGCGGCCTGGCCGAGACGGCCGAG---CGGGCCGAGCTGCTG
Pongo_abelii|10961             ------------------------------------------------------------
Rhesus_macaque|25536           GACTTCGTGAGCTTCTACGGCGGGCTGGCCGAGACAGCCGAG---CGGGCCGAGCTGCTG
Homo_sapiens|32504             GACTTCGTGAGCTTCTACGGTGGGCTGGCCGAGACGGCCCAG---CGGGCCGAACTGCTG
Pan_troglodytes|14856          GACTTCGTGAGCTTCTACGGTGGGCTGGCCGAGACGGCCCAG---CGGGCCGAACTGCTG
Gorilla_gorilla|29937          GACTTCGTGAGCTTCTACGGTGGGCTGGCCGAGACGGCCGAG---CGGGCCGAACTGCTG
Apis_mellifera|35463           ------------------------------------------------------------
Linepithema_humile|8515        GCGTTATGTGTCAGATATACTGAAAGTAACAAGGAGGAT------CGCCAGCGAATTTTG
Pogonomyrmex_barbatus|2952     ------------------------------------------------------------
                                                                                           

Nematostella_vectensis|27223   ------------------------------------------------------------
Caenorhabditis_elegans|10573   GTAGATCTCGTCACAAACTATGGTGTAAACAAA---------------------------
Daphnia_pulex|24329            ------------------------------------------------------------
Branchiostoma_floridae|42309   CGGGTAGTCTCACAGCAGTTTGGTACAGATCACGATGAAGTACTGAAGGCTGCAGAGGGT
Ixodes_scapularis|8636         ------------------------------------------------------------
Pediculus_humanus|8030         CAAGTTTTATCCAAAGATTATGCCGTCAATCATTATAAAGTATTTCAACTTTCCGAAACA
Nasonia_vitripennis|4128       TCGTCTCTTGCAACTCGATATGCTGTAAACCACGACAAAATATGCCAGCTTGCA------
Danio_rerio|11244              GAGAAGTTGTCTCATGATTTCGGGGTTGATCACAGGTGGGCTTCGGATCTGGCC------
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          ACGAAGCTGTCTCGAGACCACGGAGTGGACCACAAAGGCGTCTCGGAGCTGGCT------
Fugu_rubripes|21650            AACAAACTGTCCCAGGACTTCGGGGTAGACCACAGAGGCGTCTCAGAACTAGCG------
Tetraodon_nigroviridis|4258    AACAAACTGTCCCAGGACTTTGGGGTGGACCACAGAGGCGTGTCAGAGCTGGCGCTG---
Xenopus_tropicalis|2763        GGCAAGTTGGCTACTGAGTTTGGGGTGGACCATACGCAAGTGACCGAACTAAGCAGCAAA
Erinaceus_europaeus|216        GGTCGCCTGGCGCGGGGCTTCGGCGTGGACCACGGCCTGGTGGCCGAGCAGAGCGCCGGC
Dasypus_novemcinctus|4090      GGCCGCCTGGCGCGGGGCTTCGGCGTGGACCACGGCCAGGTGGCCGAGCAGAGCGCCGGC
Otolemur_garnettii|9673        ------------------------------------------------------------
Monodelphis_domestica|5421     GGCCGCCTGGCGCGGGGCTTCGGCGTGGACCACGGACAGGTGGCGGAGCAGAGCGCGGGA
Macropus_eugenii|821           AGCCGCCTG---CGGGGCTTCGGTGTAGACCACGGGCAGGTGGCGGAGCACAGCGCGGGC
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      GGCCGCCTGGCCAGGGACTTCGGCGTGGAGCACGGGCGCGTGGCCGAGGCCTGCGCGGAG
Gallus_gallus|4163             ACCCGCCTGGCCCGCGACTTCGGCGTGGACCACGGGCGGGTGGCGGAGTTCAGCGCCAAA
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       AGCCGCCTGGCCCGCGACTTCGGCGTGGAGCACGGGCGGGTGGCCGAGGCCGCCGCCAAG
Tupaia_belangeri|14197         ------------------------------------------------------------
Microcebus_murinus|7543        ---------------GGCTTTCACGTGGACCACGTCCAGGTACTCGAACAGAGCGACATC
Procavia_capensis|12495        CGCCGCTTGGCGCAGAGCTTCGGCGTGGACCACAGCCAGGTGGCGGAGCAGAGCGCCGGT
Echinops_telfairi|15061        GGTCGCCTGGCGAAGGGCTTCGGCGTGGACCACGGCCAGGTGGCCGAGCAGAGCGCCGGC
Bos_taurus|8430                GGCCGCCTGGCGCGCGGCTTCGGCGTGGACCACAGCCAGGTGGCCGAGCAGAGCGCCGGT
Tursiops_truncatus|9453        ------------------------------------------------------------
Dipodomys_ordii|10310          GCCCGCCTGGCGCAGGGCTTCGGCGTGGACCACGGCCAGGTGGCCGAGCAGAGCGCCGGG
Loxodonta_africana|22105       GGCCGCCTCGCGCAGGGCTTCGGCGTGGACCACAGCCAGGTGGCCGAGCAGAGCGCCGGC
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        GGCCGCCTGGCGCAGGGCTTCGGCGTGGACCACGGCCAGGTGGCCGAGCAGAGCGCCGGC
Pteropus_vampyrus|10878        GGCCGCCTGGCGCAGGGCTTCGGCGTGGACCACGGCCAGGTGGCAGAGCAAAGCGCCGGC
Myotis_lucifugus|3021          AGCCGCCTGGCGCAGGGCTTCGGCGTGGACCACGGCCAGGTGGCCGAGCAGAGCGCCGGC
Cavia_porcellus|6308           GGCCGCCTGGCGCAGGGCTTCGGCGTGGACCACGGCCAGGTGGCCGAGCAGAGCGCCGGC
Canis_familiaris|23275         AGCCGCCTGGCGCGCGGCTTCGGCGTGGACCACGGCCAGGTGGCCGAGCAGAGCGCCGGC
Mus_musculus|42855             GGCCGCCTGGCTCAGGGCTTCGGCGTGGACCACGGCCAGGTGGCCGAGCAGAGCGCCGGG
Rattus_norvegicus|17390        GGCCGCCTGGCTCAGGGCTTCGGCGTGGATCACGGCCAGGTAGCGGAGCAGAGCGCCGGA
Felis_catus|10871              AGCCGCCTGGCGCGGGGCTTCGGCGTGGACCACGGCCAGGTGGCCGAGCAGAGCGCCGGC
Equus_caballus|18610           ------------------------------------------------------------
Callithrix_jacchus|9355        GGCCGCCTGGCGCGGGGCTTCGGGGTGGACCATGGCCAGGTGGCCGAGCAAAGCGCCGGC
Pongo_abelii|10961             ------------------------------------------------------------
Rhesus_macaque|25536           GGCCGCCTGGCGCGGGGCTTCGGTGTGGACCACGGCCAGGTGGCGGAGCAGAGCGCCGGC
Homo_sapiens|32504             GGCCGCCTGGCGCGGGGCTTCGGCGTGGACCACGGCCAGGTGGCGGAGCAGAGCGCCGGC
Pan_troglodytes|14856          GGCCGCCTGGCGCGGGGCTTCGGCGTGGACCACGGCCAGGTGGCGGAACAGAGCGCCGGC
Gorilla_gorilla|29937          GGCCGTCTGGCGCGGGGCTTCGGCGTGGACCACGGCCAGGTGGCGGAGCAGAGCGCCGGT
Apis_mellifera|35463           ------------------------------------------------------------
Linepithema_humile|8515        CGCATACTGGCTTCACAATATGCTGTGCAACATAACAATATATGCCAAGTAGCA------
Pogonomyrmex_barbatus|2952     ------------------------------------------------------------
                                                                                           

Nematostella_vectensis|27223   ------------------------------------------------------------
Caenorhabditis_elegans|10573   ---------------------------GAAGCCCTAAATCATGCGATTTCTCTATATTCT
Daphnia_pulex|24329            ---------------------------------------------------ATGATCAAA
Branchiostoma_floridae|42309   CTA------------------CCACAAGCAAAGGAGAAAAGTGAAGGTGCCTTGCTGAAG
Ixodes_scapularis|8636         ------------------------------------------------------------
Pediculus_humanus|8030         TTAGCAAAATGCAGTAATATATCTGAAAGTGATGCTAAATCTGATGCTAAAATTTTAAAA
Nasonia_vitripennis|4128       ---------AAA---AGATTAGCTTGCAACGAGCCAAACAATCCAAACCAACTGATCTCA
Danio_rerio|11244              ---------GCA---AAGTTGCTGGAGGCTCAGGTGCGGGATGTGGCCACCATCCTGCAG
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          ---------GTG---AAGCTGCTGGACACTCAGCAGCGCGACCTGGCAACCATCTTGCAG
Fugu_rubripes|21650            ---------CTG---AAGCTCTTGGACACTCAGCTGCGAGATTTGGCGACCATTCTGCAA
Tetraodon_nigroviridis|4258    ---------------AAGCTCTTGGACACTCAGCTGCGAGATTTGGCGACCATTCTGCAA
Xenopus_tropicalis|2763        GTG---------------GTACAAGCCCAGCAGAAGAGGGATATGGGAACTGTTCTGCAG
Erinaceus_europaeus|216        GTC------CTG---CAGCTGCGC---GAGCAACCGCGGGAGGCGGCCGTGCTGCTACAG
Dasypus_novemcinctus|4090      GTG------CTG---CAGCTGCGC---CAGCAGCCTCGGGAGGCGGCCGTGCTGCTGCAG
Otolemur_garnettii|9673        ------------------------------------------------------------
Monodelphis_domestica|5421     GTA------CTG---CGCCTAGCG---CCTCCCCCGCGAGAGCCTGGCGCCCTCCTTCAC
Macropus_eugenii|821           GTG---------------CTGCGCCTAGGCCAGCGGTGGGCGGCCCCGGGGCTCCCGCAG
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      GTGGCACGGCTC---CAGGCCCGGGGAGAGGCCTTAGGCGAGGCCGGGGCGCTGCTCCAG
Gallus_gallus|4163             GTG------TTG---CAGGCCCGG---GAGCAGCAGAGGGAGCTGGGAGCCCTGCTGCAG
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       GTG------CTG---CAGGCCCGC---GAGCAGCGCAGGGAGCCCGGGGCGCTGCTGCAG
Tupaia_belangeri|14197         ------------------------------------------------------------
Microcebus_murinus|7543        GTT------ATC---CAGTTGCAC---CTGCAGCAGCGGAAGGCGCCG---TTGCTGCAG
Procavia_capensis|12495        GTG------CTC---CAGCTGCGC---CAGCAGCCCCGGGAGGCGGCGGTACTGCTGCTG
Echinops_telfairi|15061        GTG------CTG---CAGCTGCGC---CAGCACCCGCGGGAGCCGGCCGTGCTGCTGCTG
Bos_taurus|8430                GTG------CTC---CAGCTGCGC---CAGCAGCCGCGGGAGGCAGCCGTGCTGCTGCAG
Tursiops_truncatus|9453        ------------------------------------------------------------
Dipodomys_ordii|10310          CTG------CTC---CAGCTGCGC---CAGCAGCCGCGCGAGGCGGCCGCGCTGCTGCAG
Loxodonta_africana|22105       GTG------CTC---CAGGTGCGC---CAGCAGCAGCGGGAGGCGGCGGTACTGCTGCTG
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        GTG------CTG---CAGCTGCGC---CAGCAGCCCCGGGAGGCGGCCGTGCTGCTGCAG
Pteropus_vampyrus|10878        GTG------CTC---CAACTGCGC---CAGCAACCGCGGGAGGCGGCCGTGTTGCTGCAG
Myotis_lucifugus|3021          GTG------CTC---CAGCTGCGC---GAGCAGCCGCGGGAGGCGGCCGTGCTGCTGCAG
Cavia_porcellus|6308           GTG------CTC---CAGCTGCGA---GAGCAGCCGCGGGAGGCGGCCGTGCTGCTGCAG
Canis_familiaris|23275         GTG------CTC---CAGCTGCGC---GAGCAGCCGCGGGAGGCGGCCGTGCTGCTGCAG
Mus_musculus|42855             GTG------CTG---CAGCTGCGC---CAGCAGGCGCGCGAGGCGGCCGTGCTGCTGCAG
Rattus_norvegicus|17390        GTG------CTG---CAGCTGCGC---CAGCAGTCGCGCGAGGCGGCCGTGCTGCTGCAG
Felis_catus|10871              GTG------CTC---CAGCTGCGC---CAGCAGCCGCGGGAGGCGGCCGTGCTGCTGCAG
Equus_caballus|18610           ------------------------------------------------------------
Callithrix_jacchus|9355        GTG------CTC---CAGCTGCGC---CAGCAGCAGCGGGAGGCCGCGGTGCTGCTCCAG
Pongo_abelii|10961             ------------------------CAGCAGCAGCCGGAAGGCGGGCGGTGGCTTTTGCAG
Rhesus_macaque|25536           GTG------CTC---CAGCTGCGC---CAGCAGCAGCGGGAGGCGGCGGTGCTGCTGCAG
Homo_sapiens|32504             GTG------CTC---CATCTGCGC---CAGCAGCAGCGGGAGGCGGCGGTGCTGCTGCAG
Pan_troglodytes|14856          GTG------CTC---CATCTGCGC---CAGCAGCAGCGGGAGGCGGCGGTGCTGCTGCAG
Gorilla_gorilla|29937          GTG------CTC---CATCTGCGC---CAGCAGCAGCGGGAGGCGGCGGTGCTGCTGCAG
Apis_mellifera|35463           ---------------------------------------------------ATGATTTCT
Linepithema_humile|8515        ---------AAG---AAGTTAGTCTGTACTGAGCCTGAAAATGAAAGGCAAATGATCAAT
Pogonomyrmex_barbatus|2952     ---------------------------------------------------ATGATTGTT
                                                                                           

Nematostella_vectensis|27223   ---GAGGACCGCCTT------------CGTCAGGTGCTTGAGCCACACTACATCCAGCTG
Caenorhabditis_elegans|10573   AAGAATGATCAAATGTACCCGGAAGTAAGAACATCAGCAACAGCTTCTTATGTGAATTTG
Daphnia_pulex|24329            GCCGAAGATAACTTA------------CGCAACACACTTGCCGTTGAACAGAATTGGATG
Branchiostoma_floridae|42309   GCGGAGGAGAGACTA------------CAGGCAGCGCTGGTACCCAGGTACCATGACCTG
Ixodes_scapularis|8636         ------------------------------------------------------------
Pediculus_humanus|8030         AATGAAGATCAACTT------------AGAACAATTCTTACACCTCAATATTCATGGCTT
Nasonia_vitripennis|4128       AGAGAGCGAGCTCTA------------AAAGATGCCCTAACACCTCCGTATCATTGGCTG
Danio_rerio|11244              GTGGAGGACAGGCTA------------CGGTACAGTTTGACACCCCGGTACCGACAGCTG
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          GTCGAAGACCGGCTC------------CGTTACAGTCTGACGCCCCGTTACAAGCAGCTG
Fugu_rubripes|21650            GCAGAAGACAGGCTG------------AGATACAGCTTGACTCCCCGATATAAACAGCTT
Tetraodon_nigroviridis|4258    GCGGAAGACAGGCTG------------CGGTACAGCTTGACTCCCCGATACAAACAACTG
Xenopus_tropicalis|2763        GTGGAGGACAGACTA------------AGATACTACCTCACTCCTCAATACAAAGTATTG
Erinaceus_europaeus|216        GCGGAGGACCGGCTG------------CGCTACGCGCTGGTGCCGCGCTACCGCGGCCTG
Dasypus_novemcinctus|4090      GCGGAGGACCGGCTG------------CGCTACGCGCTGGTGCCGCGCTACCGCGGCCTC
Otolemur_garnettii|9673        ------------------------------------------------------------
Monodelphis_domestica|5421     GCGGAGGACCGGCTT------------CGCTATGCACTTGTACCGCGCTATCGCGGTCTC
Macropus_eugenii|821           GCGGAGGACCGGCTC------------CGCTACGCGCTCGTGCCGCGCTACCGAGGCCTC
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      GGCGAGGGCCGGCTC------------CGGCGCCTCCTCACGCCGCGCTACCGGGGCCTC
Gallus_gallus|4163             GCCGAGGACCGGCTG------------CGCTACTATCTGAACCCGCGGTACCGGGGGCTG
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       GCCGAGGACCGGCTC------------CGCTACTACCTGAGCCCGCAGTACCGCGGcctc
Tupaia_belangeri|14197         ------------------------------------------------------------
Microcebus_murinus|7543        CCTGAGGACGGGCTG------------CGCTACGCGCTCGTGCCGCGCTACCGCGGCCTC
Procavia_capensis|12495        GCGGAGGATCGGCTG------------CGCTACGCGTTGGTGCCGCGCTACCGCGGCCTC
Echinops_telfairi|15061        GCCGAGGACCGGCTG------------CGCTACGCGCTGGTGCCGCGGTACCGCGGCCTC
Bos_taurus|8430                GCCGAGGACCGGCTG------------CGCTACGCGCTAGTGCCGCGCTACCGCAGCCTC
Tursiops_truncatus|9453        ------------------------------------------------------------
Dipodomys_ordii|10310          GCCGAGGACCGGCTG------------CGCCACGCGCTCGTGCCGCGCTACCGCGGCCTC
Loxodonta_africana|22105       GCTGAGGACCGGCTG------------CGCTACGCTCTGGTGCCGCGCTACCGCGGCCTC
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        GCCGAGGACCGGCTC------------CGCTACGCGCTGGTGCCCCGCTACCGCGGCCTC
Pteropus_vampyrus|10878        GCCGAGGACCGGCTG------------CGCTACGCCCTGGTGCCGCGCTACCGCGGTCTC
Myotis_lucifugus|3021          GCCGAGGACCGGCTG------------CGCTACGCCCTGGTGCCGCGCTACCGCGGCCTC
Cavia_porcellus|6308           GCTGAGGACCGGCTG------------CGCTACGCGCTGGTGCCGCGCTACCGCGGCCTC
Canis_familiaris|23275         GCGGAGGACCGGCTG------------CGCTACGCGCTCGTGCCGCGCTACCGCGGCCTC
Mus_musculus|42855             GCGGAGGACCGGTTG------------CGCTACGCGCTCGTGCCGCGGTATCGCGGCCTC
Rattus_norvegicus|17390        GCAGAGGACCGGCTA------------CGCTATGCCCTCGTGCCGCGATACCGTGGCCTC
Felis_catus|10871              GCCGAGGACCGGCTG------------CGCTACGCGCTGGTCCCGCGCTACCGCGGCCTC
Equus_caballus|18610           ------------------------------------------------------------
Callithrix_jacchus|9355        GCGGAGGACCGGCTG------------CGCTACGCGCTGGTGCCGCGTTACCGCGGCCTC
Pongo_abelii|10961             GCCGAGGACCGGCTG------------CGCACGACGCTGGTGCCGCGCTATCGCGGCCTC
Rhesus_macaque|25536           GCCGAGGACCGGCTG------------CGCTACGCGCTGGTGCCGCGCTACCGCGGCCTC
Homo_sapiens|32504             GCCGAGGACCGGCTG------------CGCTACGCGCTGGTGCCGCGCTATCGCGGCCTC
Pan_troglodytes|14856          GCCGAGGACCGGCTG------------CGCTACGCGCTGGTGCCGCGCTATCGCGGCCTC
Gorilla_gorilla|29937          GCCGAGGACCGGCTG------------CGCTACGCGCTGGTGCCGCGCTATCGCGGCCTC
Apis_mellifera|35463           TATGAACGAAATTTA------------AGAAATGTTTTAACACCAGATTATCAATGGTTG
Linepithema_humile|8515        CATGAAAGAACCCTG------------AAAAATGTTCTTACACCTGCATATCAGTGGCTA
Pogonomyrmex_barbatus|2952     CATGAGAAAACCTTG------------AAGAATGTACTTACACCTGCATATCATTGGTTA
                                                                                           

Nematostella_vectensis|27223   CTTTCCCACATCAGCCGACTT---GAGGGCGGAGTCAAGTTTATTGTGGACATGCGCAGT
Caenorhabditis_elegans|10573   ATAAAATCAATTGGAAATTTA---CCGGGAGGAGTTATGCAAGTCTGTGAAATGAGGGCT
Daphnia_pulex|24329            TTATCCATTTTAGCGAGACAA---GAGGGCGGCATTAAGTTTCTTATAGATATACGAGCG
Branchiostoma_floridae|42309   TTTGTGCAGATCGGTCGACTG---GAGGGCGGAGTCAAACATCTGGTGGACATGAGAGCA
Ixodes_scapularis|8636         ---------------------------------------------------ATGAGGGAA
Pediculus_humanus|8030         TTTTTGAATATTGGAAAACTT---GAGAAAGGAGTCAAATTCTTAGTCGACCTTAGGACT
Nasonia_vitripennis|4128       TTTGCACGAGTTGGAAGACTG---GAACATGGAGTCAAATTTCTTGTAGATTTAAGAGCA
Danio_rerio|11244              CTCACCCACATCAGCAGGGTG---CAGGGCGGGGTGAAGTTTCTGGTGGACCTCAGGGCA
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          CTTTGTCACATAAGCAGGGTC---GAAGGTGGTGTGAAGTTTCTGGTCCAGTTTGCAAGA
Fugu_rubripes|21650            TTCAACCACATCAGCAAGGCC---GAAGGAGGAGTGAAGTTTCTTGTGGACCTCCGAGCA
Tetraodon_nigroviridis|4258    TTCAACCACATCAGCAAGGCC---GAAGGGGGGGTGAAGTTTCTGGTCGACCTACGAGCC
Xenopus_tropicalis|2763        TTTTCTCATATCAGTAAGCTG---GAAGGGGGAATGAAGTTTCTGGTGGATTTGAGAGCT
Erinaceus_europaeus|216        TTCCACCACATCAGCAAGCTG---GACGGCGGCGTGCGCTTCCTGGTGCAGCTGCGGGCC
Dasypus_novemcinctus|4090      TTCCACCACATCAGCAAGCTG---GACGGCGGCGTGCGCTTCCTGGTGCAGCTGCGGGCC
Otolemur_garnettii|9673        ------------------------------------------------------------
Monodelphis_domestica|5421     TTCCAGCACATCAGCAAGCTG---GAGGGTGGAGTGCGCTTCCTGGTCCAGCTGCGCGCA
Macropus_eugenii|821           TTCCAGCACCTCAGCAAGCTG---GAGGGCGGAGTGCGCTTCCTGGTCCAACTGCGCGCA
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      TTCCTCCAACTGGGCCGCAAAGGGGAGGGCGGCCTCCGCTTCCTGGTCCGACTCCGCCGG
Gallus_gallus|4163             TTCCAGCACCTGGGTCGCCTG---GAGGGCGGACTGCGCTTCCTGGTGGAGCTGAGGGGA
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       ttccagcagctgggcCGCCTG---GAGGGCGGGCTGCGCTTCCTCGTGGAGCTCAGGGCC
Tupaia_belangeri|14197         ------------------------------------------------------------
Microcebus_murinus|7543        TTCCACCACGTCAGCAAGCTG---GACGGCGGCGTGCGCTTCCTCGTGCGCCTGCGGGCC
Procavia_capensis|12495        TTTCACCACATCAGCAAGCTG---GACGGCGGCGTGCGCTTCCTGGTGCAGCTGCGGGCC
Echinops_telfairi|15061        TTCCGCAACATCAGCAAGCTG---GACGGCGGCGTGCGCTTCCTGGTGTGCCTGCGCGCC
Bos_taurus|8430                TTCCACCACATCAGCAAGATG---GAGGGCGGCGTGCGCTTCCTGGTGCGGCTGCGGGCC
Tursiops_truncatus|9453        ------------------------------------------------------------
Dipodomys_ordii|10310          TTCCGCCTCATCGGCCGGCTG---GACGGCGGCGCGCGCTTCCTGGTGCGGCTGCGCGCG
Loxodonta_africana|22105       TTCCACCACATCAGCAAGCTG---GACGGCGGCGTGCGCTTCCTGGTGCAGCTGCGGGCC
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        TTCCACCACATCAGCAAGCTG---GACGGCGGCGTGCGCTTCCTGGTGCAGCTGCGCGCG
Pteropus_vampyrus|10878        TTCCACCACATCAGCAAGCTG---GACGGCGGCGTACGCTTCCTGGTGCAGCTGCGGGCC
Myotis_lucifugus|3021          TTCCACCACATCAGCAAGCTG---GACGGCGGCGTGCGCTTCCTGGTGCAGCTGCGGGCC
Cavia_porcellus|6308           TTCCATCACATCAGCAAGCTG---GACGGAGGCGTGCGCTTCCTGGTGCGGCTGCGGGCA
Canis_familiaris|23275         ---CACCACATCAGCAAGCTG---GACGGCGGCGTGCGCTTCCTGGTGCGGCTGCAGGCC
Mus_musculus|42855             TTCCATCACATCAGCAAGCTG---GACGGCGGCGTGCGCTTCTTGGTGCAGCTGCGGGCC
Rattus_norvegicus|17390        TTCCACCACATCAGTAAGCTG---GACGGCGGCGTGCGCTTCCTGGTACAGCTGCGGGCC
Felis_catus|10871              TTCCACCACATCAGCAAGCTG---GACGGCGGCGTGCGCTTCCTGGTGCGGCTGCGGGCC
Equus_caballus|18610           ------------------------------------------------------------
Callithrix_jacchus|9355        TTTCACCACATCAGCAAGCTG---GACGGCGGCGTGGGCTTCCTGGTGCAGCTGCGGGCC
Pongo_abelii|10961             TTCCACCACATCAGCAAGCTG---GACGGCGGCGTGCGCTTCCTGGTGCAGCTGCGGGCC
Rhesus_macaque|25536           TTCCACCACATCAGCAAGCTG---GACGGCGGCGTGCGCTTCCTGGTGCAGCTGCGGGCC
Homo_sapiens|32504             TTCCACCACATCAGCAAGCTG---GACGGCGGCGTGCGCTTCCTGGTGCAGCTGCGGGCC
Pan_troglodytes|14856          TTCCACCACATCAGCAAGCTG---GACGGCGGCGTGCGCTTCCTGGTGCAGCTGCGGGCC
Gorilla_gorilla|29937          TTCCACCACATCAGCAAGCTG---GACGGCGGCGTGCGCTTCCTGGTGCAGCTGCGTGCC
Apis_mellifera|35463           TTTATTATGATTGGAAGACTT---GAAAATGGTGTGAAATTTCTTGTTGATTTAAGGACA
Linepithema_humile|8515        TTTGTCATTATGGGAAGATTG---CAGTATGGTGTGAAATTTTTGGTTGATTTAAGAACG
Pogonomyrmex_barbatus|2952     TTTGTTATTATAGGCAGATTG---CAGCATGGCGTCAAGTTTTTGGTTGATTTAAGAACT
                                                                                           

Nematostella_vectensis|27223   GACCTGCAGGATGGTCTTACG---AGCGAGACTCAGCTCACAGCTCGTCAGGAGCTACAG
Caenorhabditis_elegans|10573   AATATTTTGGCACTTCTAAAA---CGGGAAACTGACAAAACTACAACATCATATCTCCGT
Daphnia_pulex|24329            GATGTGCTGTCACCAGATGCA------------------ACCAATTCGGTTGTTTTGAGG
Branchiostoma_floridae|42309   GACACACTGGACCTCCTGTCT------------TCAGTAAAAGACAGTGCAGAGCTGCGG
Ixodes_scapularis|8636         GACCTTCTGGATCTAATCTCGTCGTCGCAGCTGGAAAGTCCTTCCTCCTACGACGTTCGA
Pediculus_humanus|8030         GATGTATTGGAACTAATCGCTGAAAAAAATTCGGAAGTTGATAGTACAGTAGAACTGCAG
Nasonia_vitripennis|4128       AATGTCTTAGATTTAATAAGCCATTGTACAAAGGATTCAGAAGATATTTTACATCTTAGT
Danio_rerio|11244              GATCTCATCGAGTTCGCATCC---------TCAAAAATTAGTGACAGCCCACATATGAGG
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          GATTTGCTTGAAATGAAGTCT------GACCTTAGCTTGGAGGAAAAGGCCTGCTTTGAA
Fugu_rubripes|21650            GATGTGCTTGAAATAATCTCA---------TCTAAAGCTAGCGAGAGTCCAGATATCAGG
Tetraodon_nigroviridis|4258    GATGTGCTTGAAATAATCTCA---------TCTAAAGCTAGCGAGACTCCAGATATCCGG
Xenopus_tropicalis|2763        GACATTTTAGAGAGCTTAGCA---------GCTAAACTCGCAGATGGTCCTCACATTAGG
Erinaceus_europaeus|216        GACCTGCTGGAGGCTCAGGCC---------CTCAAGTTAGTGGAGGGGCCGCACGTCCGG
Dasypus_novemcinctus|4090      GACCTGCTCGAGGCGCAGGCC---------CTCAAGCTGGTAGAGGGGCCGCACGTC---
Otolemur_garnettii|9673        ------------------------------------------------------------
Monodelphis_domestica|5421     GATCTCCTCGAGGCACAAGCC---------CTGAAGATAGCCGAGGGGCCTCACGTCCGG
Macropus_eugenii|821           GACCTGCTAGAGGCGCAGGCC---------CTGAAGATAGCCGAGGGGCCGCACGTCCGG
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      GATCTCCTCGCCGCCCTCGGC---------ACCACCAACGCCCCGGCCCCGCACCTCCGG
Gallus_gallus|4163             GACCTGGTGGAGGGGCTGGCG---------AGCAAGGCGGTGGATGGGCCTCACGTCAAG
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       GACCTGATGGAGGGGCTGGCC---------AGCAAGGCGGTGGATGGGCCCCACGTCAAG
Tupaia_belangeri|14197         ------------------------------------------------------------
Microcebus_murinus|7543        GACCTGCTGGAGGCGCAGGCC---------CTCAGGCTGGTGGAGGGGCCGGACGTCCGG
Procavia_capensis|12495        GACCTGCTACAGGCGCAAACC---------CTCAAGCTGGTAGAGGGGCCACACTTACGG
Echinops_telfairi|15061        GACCTGCTGCAGGCGCAGACG---------CTCAAGCTGCTGGAGGGGCCGCACCTGCGG
Bos_taurus|8430                GACCTGCTCGAGGCGCAAGCC---------CTCAAGCTAGTGGACGGGCCGCACGTCCGG
Tursiops_truncatus|9453        ------------------------------------------------------------
Dipodomys_ordii|10310          GACCTGCTGGAGGCGCAGGCG---------CTCAAGCTGGTGGAGGGGCCGCACGTCCGG
Loxodonta_africana|22105       GACCTCCTCCAGGCGCAGTCC---------CTGAAGCTGGTGGAGGGGCCGCACGTCCGG
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        GACCTGCTGGAGGCGCAGGCC---------CTCAAGCTGGTGGAGGGGCCACACGTCCGG
Pteropus_vampyrus|10878        GACCTGCTCGAGGCGCAGGCC---------CTCAAGCTGGTGGAGGGGCCGCACGTCCGG
Myotis_lucifugus|3021          GACCTGATCGAGGCGCAGGCC---------CTCAAGCTGGTGGAGGGGCCGCACGTCCGG
Cavia_porcellus|6308           GACCTGCTCGAGGCGCAGGCG---------CTGAAGCTGGTGGAGGGGCCACACGTCCGG
Canis_familiaris|23275         GACCTGCTCGAGGCGCAGGCG---------CTCAAGCTGCTGGAGGGCCCGCACGTCCGG
Mus_musculus|42855             GATCTGCTGGAGGCGCAGGCC---------CTCAAGCTGGTGGAGGGGCCGCACGTCCGG
Rattus_norvegicus|17390        GATCTGTTGGAGGCGCAGGCC---------CTCAAGCTGGTGGAAGGGCCGCACGTCCGG
Felis_catus|10871              GACCTGCTCGAGGCGCAGGCG---------CTCAAGCTGGTGGAGGGGCCGCACGTCCGG
Equus_caballus|18610           ---------------------------------------------------------CAG
Callithrix_jacchus|9355        GACCTGCTCGAGGCGCAGGCC---------CTCAAACTGGTGGAGGGGCCACACGTCCGG
Pongo_abelii|10961             GATCTGCTGGAGGCGCAGGCC---------CTTAAGCTGGTGGAGGGGCCGGACGTCCGG
Rhesus_macaque|25536           GACCTGCTCGAGGCTCAGGCC---------CTCAAGCTGGTGGAGGGGCCGGACGTCCGG
Homo_sapiens|32504             GACCTGCTGGAGGCGCAGGCC---------CTCAAGCTGGTGGAGGGGCCGGACGTCCGG
Pan_troglodytes|14856          GACCTGCTGGAGGCGCAGGCC---------CTCAAGCTGGTGGAGGGGCCGGACGTCCGG
Gorilla_gorilla|29937          GACCTGCTGGAGGCGCAGGCC---------CTCAAGCTGGTGGAGGGGCCGGACGTCCGG
Apis_mellifera|35463           GATATATTAGAATTAATATTA------AAAATTAAAGATACAGATGAAAGTATTGCAATA
Linepithema_humile|8515        GATGTTCTTGAACTAATGTCA------GAAGTGAAAGATTCTGATGAAAGCATAGTGATA
Pogonomyrmex_barbatus|2952     GATGTCCTGGAATTAATGTCA------GAAGTAAAAGATACTGATGAAAGTGTAATAATA
                                                                                           

Nematostella_vectensis|27223   ---GCGCTCAGCACATCAATCAAGCATCTTCTTGCACAGTGGTTCTCTGTCGGTCTGCTG
Caenorhabditis_elegans|10573   ---CACATTGAACTGGCCACTAGAGAAGTATTAACTTCATGGTTTTCTTTAGGAAATCTA
Daphnia_pulex|24329            ---TCTTTGAGCAATGCCATCCGTGATCTAATTGCCCCATGCTTCGGAATCGATATGCTT
Branchiostoma_floridae|42309   ---AGCTTCAGCTCGTGTTTGAGAGAGATGCTGTCTCATTGGTTCTCAGCAGGGCTGCTA
Ixodes_scapularis|8636         ---CACATGAATACCATTTTGAAGGAACTCTTATCGCTCTGGTTCACCGTTGGCTTCATG
Pediculus_humanus|8030         ---CAACTAAATTCAACCTTAAGAGATTTGCTATCTTTATGGTTTTCAATAGGTTTTTTA
Nasonia_vitripennis|4128       ---CAGATGGATGCCACTCTGAAACAAATGTTATTTTTGTGGTTTTCTGTAGGATTTATG
Danio_rerio|11244              ---GACCTGAACAGCACTCTGAAGGCTCTTCTGTCTGAATGGTTCTCTGTTGGGCTCCTC
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          ATGGACCTTAGCGGCACTTTGAAGAGCCTGCTGTCTGAGTGGTTCTCAGTCGGTCTGCTC
Fugu_rubripes|21650            CAGGACCTCAATGGCACTTTGAAGAGCTTGCTGTGTGAGTGGTTCTCCGTTGGTCTGCTC
Tetraodon_nigroviridis|4258    ---GACCTCAGTGGCACCCTGAAGAGCTTGCTGTGTGAGTGGTTCTCTGTCGGTCTGCTC
Xenopus_tropicalis|2763        ---GAAATGAATGGGGTGCTAAAATGCATGCTTTCGGAGTGGTTCTCTGTAGGATTTCTT
Erinaceus_europaeus|216        ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dasypus_novemcinctus|4090      ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Otolemur_garnettii|9673        ---GAAATGAGTGGGGTGCTGAAAGGCATGCTCTCAGAGTGGTACTCTGCCGGGTTCCTG
Monodelphis_domestica|5421     ---GAAATGAATGGAGTGCTGAAGAACATGCTCTCAGATTGGTTTTCTACAGGATTTTTA
Macropus_eugenii|821           ---GAAATGAATGGAGTGCTGAAGAACATGCTCTCAGATTGGTTTTCTACAGGATTTTTA
Ornithorhynchus_anatinus|23987 ---------------------------ATGCTCTCAGAGTGGTTTTCTGTAGGATTCCTA
Anolis_carolinensis|17353      ---GAAATGAACAGTGTGCTAAAGGATATGCTGTCGGAGTGGTTTTCCACAGGTTTCCTC
Gallus_gallus|4163             ---GAAATGAGTGGTGTTCTAAAGAACATGCTCTCAGAGTGGTTTTCAACAGGATTCCTA
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       ---GAGATGAATGGAGTTCTCAAGAACATGCTCTCAGAGTGGTTCTGCACGGGATTCCTC
Tupaia_belangeri|14197         ---GAAATGAACGGGGTGCTCAAGAGCATGCTCTCAGAGTGGTTCTCCTCGGGGTTCCTG
Microcebus_murinus|7543        ---GAGATGAACGGGGTGCTGAAAGGCATGCTCTCGGAGTGGTTTTCCTCAGGGTTCCTG
Procavia_capensis|12495        ---GAGATGGATGGGGTGCTGAAAAGCATGCTCTCAGAGTGGTTCTCTTCCGGGTTCCTC
Echinops_telfairi|15061        ---GAGATGGACGGCGTGCTGAAGAGCATGCTCACCGAGTGGTTCTCCTCGAGCTTCCTC
Bos_taurus|8430                ---GAAATGAACGGGGTGCTGAAAAACATGCTCTCAGAGTGGTTTTCCTCGGGGTTCCTG
Tursiops_truncatus|9453        ---GAAATGAACGGGGTGCTGAAAAGCATGTTCTCAGAATGGTTTTCTTCCGGGTTCCTG
Dipodomys_ordii|10310          ---GAGATGAATGGGGTGCTGAAAGCCATGCTGTCAGAGTGGTTTTCTTCGGGCTTCCTG
Loxodonta_africana|22105       ---GAAATGGACGGGGTGCTGAAAAGCATGCTCTCAGAATGGTTCTCTTCTGGGTTCCTC
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        ---GAGATGAACGGGGTCCTCAAAGGAATGCTCTCAGAGTGGTTTTCGTCAGGGTTCCTG
Pteropus_vampyrus|10878        ---GAAATGAATGGAGTGCTGAAAGGCATGCTGTCAGAATGGTTTTCTTCAGGGTTCCTA
Myotis_lucifugus|3021          ---GAAATGAATGGTGTGCTGAAAGGCATGCTCACGGAGTGGTTTTCTTCAGGATTCCTA
Cavia_porcellus|6308           ---GAGATGAACGGGGTGCTAAAAAGCATGCTCTCAGAATGGTTCTCTTCAGGGTTCCTG
Canis_familiaris|23275         ---GAGATGAATGGAGTGCTGAAGGCTATGCTCTCAGAGTGGTTCTCTTCGGGCTTCCTA
Mus_musculus|42855             ---GAAATGAACGGAGTGCTCAAAAGCATGCTGTCTGAGTGGTTCTCCTCCGGCTTCCTG
Rattus_norvegicus|17390        ---GAAATGAACGGAGTGCTAAAAAGCATGCTGTCCGAGTGGTTCTCCTCTGGCTTCCTG
Felis_catus|10871              ---GAGATGAACGGAGTGCTGAAGGGCATGCTCTCAGAGTGGTTCTCTTCGGGCTTCCTG
Equus_caballus|18610           ---GAGATGAACGGCGTGCTGAAAGGCATGCTCTCAGAATGGTTCTCCTCCGGCTTCCTC
Callithrix_jacchus|9355        ---GAGATGAATGGGGTGCTGAAAGGAATGCTCTCAGAATGGTTTTCCTCCGGGTTCCTT
Pongo_abelii|10961             ---GAAATGAATGGGGTGCTGAAGGGAATGCTGTCAGAATGGTTTTCCTCTGGGTTCCTG
Rhesus_macaque|25536           ---GAAATGAATGGCGTGCTGAAAGGAATGCTCTCAGAATGGTTTTCCTCCGGGTTCCTG
Homo_sapiens|32504             ---GAAATGAATGGGGTGCTGAAAGGAATGCTCTCAGAATGGTTTTCCTCCGGGTTCCTG
Pan_troglodytes|14856          ---GAAATGAATGGGGTGCTGAAAGGAATGCTCTCAGAATGGTTTTCCTCCGGGTTCCTG
Gorilla_gorilla|29937          ---GAAATGAATGGGGTGTTGAAAGGAATGCTCTCAGAATGGTTTTCCTCCGGGTTCCTG
Apis_mellifera|35463           CAGCAATTGAATATTACTCTACGAGATTTATTATTACTTTGGTTTTCAGTAGGATTCTTA
Linepithema_humile|8515        CAGCAGCTAAATCACACCTTGCAAGATTTGTTTTTACTCTGGTTTTCAGTAGGTTTTTTA
Pogonomyrmex_barbatus|2952     CAACAGTTAAATCATACTTTGCAAGATTTGTTCTTGCTCTGGTTCTCTGTGGGTTTCTTC
                                                                                           

Nematostella_vectensis|27223   GACCTTCAACGGGTCACGTGGAATTCACCCTGCAGCATCTCTGAAAAGGTTATCCGTTAC
Caenorhabditis_elegans|10573   AAATTGGAACGACTTACGTGGTCATCTCCTGGAGATATTCTACAGAAAGTCGCCGAATAT
Daphnia_pulex|24329            CAACTGGACCGCGTTTCCTGGTCTTCCCCAGGTAGTCTACTGCAACATGTTTCCGAAGGC
Branchiostoma_floridae|42309   CATCTTCAGAGGATAACATGGGAGTCATCATGTGATATCCTACAGAAGATTAGTGAGTAC
Ixodes_scapularis|8636         AAGTTGGAGCGCATCACTTGGCAGTCTTCTTGTGAGATGTTACAGAAGATCTCGGACTAT
Pediculus_humanus|8030         CAACTTCAAAGAGTTACTTGGAATTCACCATGTGAGATGCTTCAAAAAATTTCTGAGTAT
Nasonia_vitripennis|4128       AAAGTTGAACGGGTGACTTGGCAAACCTCGTGTGACATTTTACAAAAAGTTTCTGACTAT
Danio_rerio|11244              CGACTTGAAAGAATCACTTGGCAGTCCCCATGCGAAATCCTTCAGAAGATCAGCCAGTAC
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          AGGCTGGAGAGGATCACCTGGCAGTCTCCATGCGAGATCCTGCAGAAGATCAGCCAGTAT
Fugu_rubripes|21650            CGGCTGGAACGAATCACCTGGAAGTCCCCCTGTGAGGTTCTGCAGAAGATCAGTCAGTAT
Tetraodon_nigroviridis|4258    CGACTGGAGCGCATCACCTGGCAGTCCCCCTGTGAGATCCTGCAGAAGATCAGCCAGTAT
Xenopus_tropicalis|2763        AACCTGGAGAGGATAACCTGGCAGTCCCCATGCGAAGTGTTGCAAAAGATCAGTGAGTAT
Erinaceus_europaeus|216        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCT
Dasypus_novemcinctus|4090      NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCC
Otolemur_garnettii|9673        AGCCTAGAACGCGTCACCTGGCACTCATCCTGTGAAGTGCTTCAGAAAATCAGTGAGTCT
Monodelphis_domestica|5421     AACCTGGAACGTGTTACCTGGCATTCTCCTTGTGAAGTTCTACAAAAAATCAGTGAGTGT
Macropus_eugenii|821           AACCTGGAACGTGTTACCTGGCACTCACCTTGTGAAGTACTACAAAAAATCAGTGAGTGT
Ornithorhynchus_anatinus|23987 AACCTGGAACGTGTTACCTGGCATTCACCTTGTGAACTTCTGCAGAAGATTAGTGAATGT
Anolis_carolinensis|17353      AGCTTGGAACGAGTTACGTGGCAGTCGCCTTGTGAGATACTGCAGAAGATTAGTGATAGT
Gallus_gallus|4163             AATTTGGAGCGGGTGACGTGGCAGTCACCTTGTGAAGTACTCCAGAAAATCAGTGATTCT
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       AACCTGGAGCGGGTCACCTGGCAGTCACCTTGTGAAGTACTCCAGAAAATTAGTGATTCT
Tupaia_belangeri|14197         AACCTGGAGCGGGTGACCTGGCATTCGCCATGCGAGGTGCTGCAGAAAGTCAGCGANNNN
Microcebus_murinus|7543        AACCTGGAACGCGTCACCTGGCATTCCTCGTGTGAGGTGCTGCAGAGAGTCAGTGAGTCC
Procavia_capensis|12495        AACCTAGAACGGGTTACTTGGCACTCACCATGTGAAGTACTTCAGAAAATCAGTGAGTCT
Echinops_telfairi|15061        AACCTGGAGCGCGTCACCTGGCACTCGCCGTGCGAGGTGCTGCAAAAGATCAGTGAGTCC
Bos_taurus|8430                AACCTGGAGCGGGTCACCTGGCATTCCCCGTGCGAAGTGCTCCAGAGAATCAGCGAGGCT
Tursiops_truncatus|9453        AACCTGGAGCGGGTCACCTGGCGTTCACCGTGCGAAATGCTGCAGAAAATCAGTGAGGCT
Dipodomys_ordii|10310          AACCTCGAAAGGGTCACCTGGCATTCACCCTGCGAAGTACTTCAGAAGATCAGCGAGGCC
Loxodonta_africana|22105       AACCTAGAACGGGTCACCTGGCATTCACCATGTGAGGTGCTTCAGAAAATCAGTGAGTCC
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        AACCTGGAGCGGGTCACCTGGCATTCGTCGTGTGACGTGCTTCAGAGAATCAGCGAATCT
Pteropus_vampyrus|10878        AACCTAGAACGGGTGACCTGGCATTCGCCATGTGAAGTGCTTCAGCGAGTCAGTGAGTCT
Myotis_lucifugus|3021          AACCTCGAACGGGTGACCTGGCATTCGCCATGTGAAGTGCTTCAGAAAATCAGTGAGTCT
Cavia_porcellus|6308           AACCTGGAGAGAGTCACCTGGCATTCGCCGTGTGAGGTGCTTCAGAAAATCAGTGAGTCT
Canis_familiaris|23275         AGCCTAGAACGGGTCACCTGGCACTCGCCTTGTGAGGTGCTGCAGAAAATCAGTGAGTCG
Mus_musculus|42855             AACCTGGAGCGGGTCACCTGGCACTCACCCTGTGAGGTACTTCAGAAGATCAGCGAGTGT
Rattus_norvegicus|17390        AACCTGGAGCGGGTCACCTGGCACTCGCCCTGTGAGGTGCTTCAGAAGATCAGCGAGTGT
Felis_catus|10871              AGCCTGGAACGGGTCACCTGGCACTCGCCGTGTGAGGTCCTGCAGAAAATCAGCGAGTCT
Equus_caballus|18610           AACCTGGAGCGGGTCACCTGGCACTCGCCCTGCGAGGTGCTGCAGAAGATCAGCGAGTCT
Callithrix_jacchus|9355        AACCTGGAACGTGTTACCTGGCATTCACCATGTGAAGTGCTGCAGAGAATCAGTGAATCG
Pongo_abelii|10961             AACCTAGAACGGGTTACCTGGCATTCACCGTGTGAAGTGCTTCAGAAAATCAGTGAGGCT
Rhesus_macaque|25536           AACCTAGAACGGGTCACCTGGCATTCACCGTGTGAAGTGCTTCAGAAAATTAGTGAGGCT
Homo_sapiens|32504             AACCTAGAACGGGTTACCTGGCATTCACCGTGTGAAGTGCTTCAGAAAATCAGTGAGGCT
Pan_troglodytes|14856          AACCTAGAACGGGTTACCTGGCATTCACCGTGTGAAGTGCTTCAGAAAATCAGTGAGGCT
Gorilla_gorilla|29937          AACCTAGAACGGGTTACCTGGCATTCACCTTGTGAAGTGCTTCAGAAAATCAGTGAGGCT
Apis_mellifera|35463           TATTTAGAAAGAATTACATGGCAAACTTCATGCGATATTTTACAAAAGATTTCAGATTAT
Linepithema_humile|8515        CACATGGAACGTATAACTTGGGAAAGTGCGTGTGACATATTGCAAAAGGTCTCTGATTAC
Pogonomyrmex_barbatus|2952     CACATGGAACGAATAACATGGGAAAGTGCATGTGATATATTACAAAAGGTCTCTGATTAC
                                                                                           

Nematostella_vectensis|27223   GAGGCTGTGCACCCTATCCAGGGCTGGGATGACCTCAAGCGGCGTCTGGCACCTGATAGA
Caenorhabditis_elegans|10573   GAGGCAGTTCATCCAGTTAGAGGACTTTCAGATTTCAGAAAACGTCTTGGTCCGTTGAGA
Daphnia_pulex|24329            GAAGCAGTTCATCCCATGCGGAGCTGGTCCGACCTTAAGAAACGCCTCGGTCCTTATCGG
Branchiostoma_floridae|42309   GAGGCTGTCCACCCCATGAGGAACTGGTCGGACCTGAAGCGGAGGGTGGGGCCCTACAGG
Ixodes_scapularis|8636         GAGGCTGTGCACCCCGTCCGCAACTGGACGGATCTGAAGCGCCGGGTGGGTCCGTACCGG
Pediculus_humanus|8030         GAAGCTGTTCATCCAGTAAGAAGCTGGACAGATCTTAAAAGAAGGGTTGGTCCTTATAGA
Nasonia_vitripennis|4128       GAAGCTATTCACCCTGTGAGGAACTGGGCTGATTTAAAAAAACGAGTTGGGCCATACAGA
Danio_rerio|11244              GAAGCGGTGCACCCTGTGAGAAACTGGACAGATCTGAAGCGCAGAGTAGGGCCAAACCGG
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          GAGGCGGTGCATCCTGTGAGGAACTGGACTGACCTGAAACGCCGGGTGGGTCCATATCGG
Fugu_rubripes|21650            GAGGCTGTGCATCCCATAAGGAACTGGGCTGACCTGAAGCGCAGAGTGGGACCATATCGC
Tetraodon_nigroviridis|4258    GAGGCCGTGCATCCCATGAGGAACTGGGCCGACCTGAAGCGCAGAGTTGGGCCATATCGC
Xenopus_tropicalis|2763        GAAGCAGTCCACCCTGTTCGTAACTGGACGGATATGAAGCGCAGAGTCGGCCCATACAGA
Erinaceus_europaeus|216        GAGGCTGTGCATCCCGTCAAGAACTGGATGGACATGAAGCGGCGTGTGGGACCCTACCGG
Dasypus_novemcinctus|4090      GAGGCCGTGCATCCCGTGAAGAACTGGATGGACATGAAGCGGCGGGTCGGGCCGTACAGG
Otolemur_garnettii|9673        GAGGCCGTGCACCCCGTCCGCAGCTGGATGGACATGAAGCGCCGCGTGGGGCCCTACCGG
Monodelphis_domestica|5421     GAGGCTGTACATCCTGTCAAAAATTGGATGGACATGAAGCGACGTGTTAGTTCATACCGA
Macropus_eugenii|821           GAGGCTGTGCATCCTGTCAAAAATTGGATGGACATGAAGCGACGTGTTAGTTCATACCGA
Ornithorhynchus_anatinus|23987 GAAGCCGTGCACCCTGTTAAAAACTGGATGGATGTAAAACGGCGTGTTGGGCCATACAGA
Anolis_carolinensis|17353      GAAGCTGTGCATCCTGTGAGAAACTGGTTGGACATGAAGCGGCGCGTTGGGTCTTACAGA
Gallus_gallus|4163             GAAGCTGTGCATCCTGTTAGAAACTGGGTTGATATGAAGCGTCGAGTGGGGTCATATAGA
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       GAAGCTGTGCACCCTGTGAGAAACTGGGTTGATATGAAGCGCCGGGTTGGTGCCTACAGA
Tupaia_belangeri|14197         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|7543        GAGGCCGTGCACCCCGTCAAGAGCTGGATGGACTTGAAGCGCCGCGTCGGGCCTTACCGG
Procavia_capensis|12495        GAGGCAGTACACCCTGTGAAAAATTGGATGGATATAAAGCGCCGCGTGGGACCTTACAGA
Echinops_telfairi|15061        GAGGTGGTGCACCCCATAAAAAACTGGATGGACATAAAGCGCCGCGTGGGGCCCTACCGA
Bos_taurus|8430                GAGGCCGTGCACCCCGTGAAAACCTGGATGGACATGAAGCGACGCGTGGGGCCCTATCGG
Tursiops_truncatus|9453        GAGGCTGTGCATCCCGTTAAAAACTGGACGGACATGAAACGGCGCGTGGGGCCCTACAGA
Dipodomys_ordii|10310          GAGGCCGTGCATCCAGTGAAAAACTGGCTGGATATGAAGCGCCGTGTGGGGCCCTATAGG
Loxodonta_africana|22105       GAGGCAGTGCACCCTGTAAGAAATTGGATGGATATAAAGCGCCGCGTCGGACCTTATAGA
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        GAGGCTGTGCACCCCGTGAAGAACTGGATGGACATGAAGCGACGCGTCGGGCCCTACAGG
Pteropus_vampyrus|10878        GAGGCTGTGCATCCTATAAAAAATTGGATGGATCTGAAACGACGTGTCGGCCCTTACAGG
Myotis_lucifugus|3021          GAGGCTGTGCACCCGGTAAAGAATTGGATGGATATAAAACAACGTGTCGGACCATACAGA
Cavia_porcellus|6308           GAGGCCGTGCACCCCATAAAGAGCTGGATGGACATGAAGCAACGCGTCGGGCCCTACAGG
Canis_familiaris|23275         GAGGCTGTGCATCCTGTGAAAAATTGGATGGACATGAAGCGCCGCGTTGGGCCGTACAGA
Mus_musculus|42855             GAGGCTGTGCACCCTGTGAAAAACTGGATGGACATGAAGCGGCGTGTGGGGCCCTACCGG
Rattus_norvegicus|17390        GAGGCTGTGCACCCTGTGAAAAACTGGATGGACATGAAGCGGCGTGTGGGGCCATACCGG
Felis_catus|10871              GAGGCCGTGCATCCTGTAAAAAACTGGATGGATATGAAACGACGCGTCGGGCCTTACAGG
Equus_caballus|18610           GAAGCTGTGCATCCTGTGAAAAGTTGGATGGATATGAAACAGCGCGTGGGACCTTACAGA
Callithrix_jacchus|9355        GAGGCCGTGCATCCTGTAAAAAATTGGATGGACATGAAGCGCCGCGTTGGGCCCTACAGA
Pongo_abelii|10961             GAGGCTGTGCATCCTGTAAAAAATTGGATGGACATGAAGCGCCGCGTTGGGCCCTACAGA
Rhesus_macaque|25536           GAGGCTGTGCATCCTGTAAAAAACTGGATGGACATGAAGCGCCGCGTTGGGCCCTACAGA
Homo_sapiens|32504             GAGGCTGTGCATCCTGTAAAAAACTGGATGGACATGAAGCGCCGCGTTGGGCCCTACAGA
Pan_troglodytes|14856          GAGGCTGTGCATCCTGTAAAAAACTGGATGGACATGAAGCGCCGTGTTGGGCCCTACAGA
Gorilla_gorilla|29937          GAGGCTGTGCATCCTGTAAAAAACTGGATGGACATGAAGCGCCGCGTTGGGCCCTACAGA
Apis_mellifera|35463           GAAGCAATACATCCTATAAAAAATTGGTTAGATTTAAAACAAAGAGTTGGACCATATAGA
Linepithema_humile|8515        GAAGCCATACATCCTATGAGAAATTGGTTGGATTTGAAACGCAGAGTCGGGCCGTATAGA
Pogonomyrmex_barbatus|2952     GAAGCTATACATCCTATAAAAAATTGGTTAGACTTGAAACGTAGAGTTGGACCATATAGA
                                                                                           

Nematostella_vectensis|27223   AGGTGCTACATATTCACCCACCGCTCAATGCCCCAGGAACCCATAGTGGTGCTGCATACC
Caenorhabditis_elegans|10573   CGATGTTTCTATTTTTCCCACGAAGCTCTTCCCCGGAACCCACTTGTGATGGTTCACGTG
Daphnia_pulex|24329            CGATGTTTCATTCTTTTACATCCTGCTTTACCAAAGAAACCATTGGCCATTTTGCACGTC
Branchiostoma_floridae|42309   AGGTGCTTCATCTTCACTCACAGCACCATGCCCAGGGAACCTATGGTGGTCCTGCACACA
Ixodes_scapularis|8636         CGCTGCTATGTCATCACCCACAGCTGCATGCCAGGTGAACCCATCGTGGTGCTTCACACG
Pediculus_humanus|8030         AGATGCTTTGTTTTTCTTCATGGTAGTATGCCTGGTGAACCAATTGTGGTTTTGCACACT
Nasonia_vitripennis|4128       AGATGTTTTATTTTTACTCATCCATCAATGCCCAGAGAACCTCTAGTTCTACTGCACACT
Danio_rerio|11244              AGGTGTTACGCCTTTACCCACGCATCCATGCCCGGAGAACCACTGGTGGTGCTGCATGTT
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          CGTTGTTATGCCTTCACCCACGCTGCCATGCCAGGGGAACCCTTGGTGGTGCTCCATGTG
Fugu_rubripes|21650            CGTTGTTATGCCTTCACCCACGCAGCCATGCCGGGCGAACCCCTGGTCGTGCTCCACGTG
Tetraodon_nigroviridis|4258    CGTTGTTACGCCTTCACCCACGCGGCCATGCCAGGAGAACCTCTGGTCGTGCTCCACGTG
Xenopus_tropicalis|2763        AGATGCTATATGTTTGCTCACAGTGCAATGCCTGGAGAACCACTAATTGTATTACATGTT
Erinaceus_europaeus|216        AGGTGCTTCTTCTTCTCACACTGCTCGACCCCCGAAGAGCCACTGATTGTCCTGCATGTG
Dasypus_novemcinctus|4090      AGATGCTACTTCTTCTCTCACTGCTCGACCCCGGGGGAGCCCCTGGTCGTCCTGCACGTG
Otolemur_garnettii|9673        AGGTGCTACTTCTTTTCCCACTGTTCAGTCCCCGGGGAGCCCCTGGTGGTTCTGCACGTG
Monodelphis_domestica|5421     AGATGCTATTTTTTTTCTCACTGTTCAACACCCGGGGAACCACTGATTGTTTTGCATGTA
Macropus_eugenii|821           AGATGCTTTTTTTTCTCTCACTGTTCAACACCTGGGGAACCACTGATAGTTTTGCACGTG
Ornithorhynchus_anatinus|23987 AGGTGCTATTTTTTTTCGCACTGTTCAACACCCGGGGAGCCTCTGATAGTTTTGCATGTG
Anolis_carolinensis|17353      AGGTGCTATTATTTTGTTCACCGTGCCATACCTGGAGAGCCACTGATTGTGCTGCATGTT
Gallus_gallus|4163             AGATGCTACTTTTTTTCTCACTGTGCAATCCCAGGAGAACCGTTGATAGTCTTGCATGTT
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       AGGTGCTACTTCTTTTCTCACTGTGCCATCCCAGGAGAGCCACTGATTGTCCTGCACGTG
Tupaia_belangeri|14197         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|7543        AGGTGCTACTTCTTCTCCCACTGCTCCACCCCGGGGGAGCCCCTGATCGTCCTGCACGTG
Procavia_capensis|12495        AGATGCTATTTTTTTTCTCACTGTTCGACCCCTGAGGAGCCCCTGGTGGTTCTGCATGTT
Echinops_telfairi|15061        CGCTGCTACTACTTCTCCCACTGCTCCACCCCCGAGGAGCCCCTGGTGGTCCTGCACGTG
Bos_taurus|8430                AGGTGCTACTTCTTCTCTCACTGCTCGACGCCAGGGGAACCCCTGATCGTCCTGCATGTG
Tursiops_truncatus|9453        AGGTGTTACTTCTTCTCTCACTGCTCGACCCCGGGGGAGCCCCTGATCATTTTGCACGTG
Dipodomys_ordii|10310          AGGTGTTACTTCTCTTCTCACTGCTCCACCCCTGGCGACCCCCTGATTGTTTTGTATGTG
Loxodonta_africana|22105       AGATGCTATTTTTTTTCTCACTGTTCCACTCCCGAGGAGCCACTGGTGGTTTTGTACGTG
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        AGGTGTTTCTTCTTCTCTCACTGCTCCACGCCTGGGGAGCCGCTGGTCGTCCTGCACGTG
Pteropus_vampyrus|10878        AGATGTTACTTTTTTTCTCACTGTTCAACCCCCGAGGAGCCCCTAGTGATTTTGCATGTG
Myotis_lucifugus|3021          AGATGTTACTTCTTCTCTCACTGTTCTACTCTCGAGGAGCCTCTGGTGGTCTTGCATGTG
Cavia_porcellus|6308           CGATGCTACTTCTTTTCTCATTGTTCAACGCCCGGGGAGCCCCTGGTCATTTTGTATGTG
Canis_familiaris|23275         AGATGTTACTTCTTTTCTCACTGCACAACCCCCGAGGAACCCTTGATTGTGCTGCACGTG
Mus_musculus|42855             AGATGTTACTTCTTCTCCCACTGCTCCACCCCCGGGGAACCCCTGGTGGTTCTGCATGTG
Rattus_norvegicus|17390        AGGTGTTACTTCTTCTCCCACTGCTCCACCCCCGGGGACCCCCTGGTTGTTCTGCATGTG
Felis_catus|10871              AGGTGTTACTTCTTTTCCCACTGTGCAAGCCCCGAGGAGCCCTTGGTCGTGCTGCACGTG
Equus_caballus|18610           AGATGTTACTTCTTCTCTCACTGTTCCACCCCTGGGGAGCCCCTGGTCGTTTTGCACCTG
Callithrix_jacchus|9355        AGGTGTTACTTCTTTTCTCACTGTTCCACCCCTGGGGAGCCCCTGGTGGTTTTGCACGTG
Pongo_abelii|10961             AGATGTTACTTCTTTTCTCACTGTTCGACCCCTGGGGAGCCCCTGGTCGTTTTGCACGTG
Rhesus_macaque|25536           AGATGTTACTTCTTTTCTCACTGTTCAACTCCTGGGGAGCCCCTGGTCGTTTTGCATGTG
Homo_sapiens|32504             AGGTGTTACTTCTTTTCTCACTGTTCGACCCCTGGGGAGCCCCTGGTCGTTTTGCACGTG
Pan_troglodytes|14856          AGGTGTTACTTCTTTTCTCACTGTTCGACCCCTGGGGAGCCCCTGGTCGTTTTGCACGTG
Gorilla_gorilla|29937          AGGTGTTACTTCTTTTCTCACTGTTCGACCCCTGGGGAGCCTCTGGTCGTTTTGCACGTG
Apis_mellifera|35463           AGATGTTACATTTTCACTCATTTATCTATGCCACGAGAACCTCTTGTTGTATTACATACA
Linepithema_humile|8515        AGATGTTATATATTCACACATCCATCCATGCCAAGAGAGCCTCTTGTTGTGTTGCATACA
Pogonomyrmex_barbatus|2952     AGATGTTACATATTTACACATCCATCCATGCCAAGAGAACCTATCGTTGTGTTACATACA
                                                                                           

Nematostella_vectensis|27223   GCTCTCGAGTAC------------------------------------------------
Caenorhabditis_elegans|10573   GCATTAGTTGAT------------------------------------------------
Daphnia_pulex|24329            GCATTGACAAAC------------------------------------------------
Branchiostoma_floridae|42309   GCACTCACCAAT------------------------------------------------
Ixodes_scapularis|8636         GCGCTCACCAGC------------------------------------------------
Pediculus_humanus|8030         GCTTTGTGCGAT------------------------------------------------
Nasonia_vitripennis|4128       GCTCTATGTGAT------------------------------------------------
Danio_rerio|11244              GCTTTAACTGAG------------------------------------------------
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          GCGCTGACGGAG------------------------------------------------
Fugu_rubripes|21650            GCCCTCACTGAA------------------------------------------------
Tetraodon_nigroviridis|4258    GCCCTCACTGAA------------------------------------------------
Xenopus_tropicalis|2763        GCTCTAATGCAA------------------------------------------------
Erinaceus_europaeus|216        GCTCTGACCAGT------------------------------------------------
Dasypus_novemcinctus|4090      GCTCTGACCAGT------------------------------------------------
Otolemur_garnettii|9673        GCCCTGACCAGC------------------------------------------------
Monodelphis_domestica|5421     GCATTGACCAAT------------------------------------------------
Macropus_eugenii|821           GCATTAACCAAT------------------------------------------------
Ornithorhynchus_anatinus|23987 GCATTGACCAAC------------------------------------------------
Anolis_carolinensis|17353      GCGCTTACGGAT------------------------------------------------
Gallus_gallus|4163             GCATTAACCAGT------------------------------------------------
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       GCACTAACCAGT------------------------------------------------
Tupaia_belangeri|14197         NNNNNNNNNNNN------------------------------------------------
Microcebus_murinus|7543        GCGCTGACCGGC------------------------------------------------
Procavia_capensis|12495        GCCCTGACGAAC------------------------------------------------
Echinops_telfairi|15061        GCCCTGACCCCC------------------------------------------------
Bos_taurus|8430                GCCCTGACCAGC------------------------------------------------
Tursiops_truncatus|9453        GCCCTGACCAGT------------------------------------------------
Dipodomys_ordii|10310          GCGCTGACCAGT------------------------------------------------
Loxodonta_africana|22105       GCCCTGACCAAC------------------------------------------------
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        GCGCTGACCAGT------------------------------------------------
Pteropus_vampyrus|10878        GCACTGACCAGT------------------------------------------------
Myotis_lucifugus|3021          GCACTGACCAGT------------------------------------------------
Cavia_porcellus|6308           GCGCTCACCAGT------------------------------------------------
Canis_familiaris|23275         GCATTGACCGGT------------------------------------------------
Mus_musculus|42855             GCTCTGACTGGT------------------------------------------------
Rattus_norvegicus|17390        GCTCTGACCGGT------------------------------------------------
Felis_catus|10871              GCGCTCACCAGC------------------------------------------------
Equus_caballus|18610           GCCCTGACCAGC------------------------------------------------
Callithrix_jacchus|9355        GCACTGACCGAT------------------------------------------------
Pongo_abelii|10961             GCACTGACTGGT------------------------------------------------
Rhesus_macaque|25536           GCACTGACTGGT------------------------------------------------
Homo_sapiens|32504             GCACTGACTGGT------------------------------------------------
Pan_troglodytes|14856          GCACTGACTGGT------------------------------------------------
Gorilla_gorilla|29937          GCACTGACTGGT------------------------------------------------
Apis_mellifera|35463           GCATTATGTGAT------------------------------------------------
Linepithema_humile|8515        GCATTATGCGAC------------------------------------------------
Pogonomyrmex_barbatus|2952     GCGTTATGTGACATTATACCAGGTTTAATACAAAAAAAATTGTTTTTTGAAACAAAGATA
                                                                                           

Nematostella_vectensis|27223   ------GAGATATCGGATAACATACAGTCC------------------------------
Caenorhabditis_elegans|10573   ------GAGATAGCGGATAGTGTACAAGAA---ATC------------------------
Daphnia_pulex|24329            ------GAGATATCCAACAACATCCATACAATTATTACGCGGAATTTGAGCCAATCATTC
Branchiostoma_floridae|42309   ------CAGATCTCAGATAACATCCAGACC------------------------------
Ixodes_scapularis|8636         ------TCCATCTCGGCCTCCATCCAGCCGGATCGG------------------------
Pediculus_humanus|8030         ------GAAATCGCTTCAAGCATGTCTGGC------------------------------
Nasonia_vitripennis|4128       ------GTTATACCTGATTCAGTAAAAGGT---ATTCAAGATGCTGAAAATCGAATTCTT
Danio_rerio|11244              ------GACATAGCAAATAATATCCAGGGC---ATT------------------------
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          ------GAAATCTCCAATAATATTCAGAGT---ATT------------------------
Fugu_rubripes|21650            ------GACATCTCTGACAACATTCAGAGC---ATT------------------------
Tetraodon_nigroviridis|4258    ------GACATCTCCAACAACATTCAGAGT---ATC------------------------
Xenopus_tropicalis|2763        ------AATATTTCTGGCAGTATCCAGGCA---ATT------------------------
Erinaceus_europaeus|216        ------GACATCTCCAACAATATCCAGGCC---ATA------------------------
Dasypus_novemcinctus|4090      ------GACATCTCCAGCAACATCCAGGCC---ATA------------------------
Otolemur_garnettii|9673        ------GACATCACCAACAACATCCAGGCA---ATA------------------------
Monodelphis_domestica|5421     ------GAGATTACCAACAATATCCAGACA---ATA------------------------
Macropus_eugenii|821           ------GAGATTTCCAACAATATTCAGGCA---ATA------------------------
Ornithorhynchus_anatinus|23987 ------GAAATCTCCAGCAATATCCAGGCA---ATA------------------------
Anolis_carolinensis|17353      ------GAGATTTCCAGCAGCATCCAGGCC---ATC------------------------
Gallus_gallus|4163             ------GATATCTCCAGCAGCATCCAGGCC---ATA------------------------
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       ------GAcatctccagcagcatccagGCC---ATA------------------------
Tupaia_belangeri|14197         ------NNNNNNNNNNNNNNNNNNNNNGCG---ATA------------------------
Microcebus_murinus|7543        ------GACATCACCAGCAACATCCAGGCG---ATA------------------------
Procavia_capensis|12495        ------GACATCACCAGCAACATTCAGNNN---NNN------------------------
Echinops_telfairi|15061        ------GAGATCACCAGCAACATCCAGGCG---ATT------------------------
Bos_taurus|8430                ------GAGATCTCCAGCAGCATCCAGACGATCATA------------------------
Tursiops_truncatus|9453        ------GAGATCTCCAGCAGCATCCAGACCATCATA------------------------
Dipodomys_ordii|10310          ------GACATCACCAACAACATCCAGGCC---ATC------------------------
Loxodonta_africana|22105       ------GATATCACCAGCAACATCCAGGCA---ATA------------------------
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        ------GACATCTCCAGCAACATCCAGGCC---ATA------------------------
Pteropus_vampyrus|10878        ------GAGATCTCCAGCAACATGCAGGCG---ATA------------------------
Myotis_lucifugus|3021          ------GACATCTCCAGCAACATTCAGTCA---ATC------------------------
Cavia_porcellus|6308           ------GACATCTCCAGCAACATCCAGGCC---ATC------------------------
Canis_familiaris|23275         ------GACATCTCCAACAACATCCAGGCC---ATA------------------------
Mus_musculus|42855             ------GACATTTCCAACAACATCCAGGGC---ATT------------------------
Rattus_norvegicus|17390        ------GACATTTCCAACAACATCCAGAGC---ATT------------------------
Felis_catus|10871              ------GAGATCTCCAGCAACATCCAGGCC---ATA------------------------
Equus_caballus|18610           ------GAGATCTCCAGCAACATCCAGGCA---ATC------------------------
Callithrix_jacchus|9355        ------GACATCTCCAGCAATATCCAGGCA---ATC------------------------
Pongo_abelii|10961             ------GACATCTCCAGCAACATCCAGGCA---ATC------------------------
Rhesus_macaque|25536           ------GACATCTCCAGCAACATCCAGGCA---ATC------------------------
Homo_sapiens|32504             ------GACATCTCCAGCAACATCCAGGCA---ATC------------------------
Pan_troglodytes|14856          ------GACATCTCCAGCAACATCCAGGCA---ATC------------------------
Gorilla_gorilla|29937          ------GACATCTCCAGCAACATCCAGGCA---ATC------------------------
Apis_mellifera|35463           ------ATTATACCAGATAGTGTAAAAGAT---ATTGATGGAGCAAAAGTCAGAATTCTT
Linepithema_humile|8515        ------ATTATACCAGATAGTGTGAAAGGA---ATTGAGGAAGCTGAAACTAGAATCCTA
Pogonomyrmex_barbatus|2952     AAGCAGAAAATAAGTAATAGCGTGAAGGGT---ATTGAAGAAGCTGAAATTAGAATTCTA
                                                                                           

Nematostella_vectensis|27223   ------ATTCTTAGTGAACCCGAAGTTGACATCGATGACTGTGAATATGAGCTCGAAAAC
Caenorhabditis_elegans|10573   ------ACAAAAAGAGGAGCACCGACTGGAAAA---------GAA---GAAGATCAA---
Daphnia_pulex|24329            GATTCCGAGACAGATGGTTCCAGGTTGGCAGATATTGGTGTTGAA---GATATAGATCGC
Branchiostoma_floridae|42309   ------ATTGTATCAACCCCCATCCTGGATGAG---------GAG---GATGTGGACAAC
Ixodes_scapularis|8636         ------GCTGAGTCTCAGGCTTCCGACGAATGG---------GAA---GACGACAAGGTC
Pediculus_humanus|8030         ------ATAGAG------------------------------GAG---GATGCGACATGT
Nasonia_vitripennis|4128       GGTAAAGTTATAGTTAATAAAGAAAGAGTTGAA---------GAG---GATAAGACTAAA
Danio_rerio|11244              ------GTAAGAGAGTTTGCCACTCTTGATGCAGAT------GAG---GATGTGAATAAA
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          ------GTCCGTGAGTTTGCTACCCTGGACTCAGAA------GAG---GATGTCAACAAG
Fugu_rubripes|21650            ------GTTCGTGAGTTTACCACCCTTCAGTCCACA------GAA---GATGTAAACAAG
Tetraodon_nigroviridis|4258    ------GTTCGCGAGTTTGCCACGCTTCATGCC---------GAGGAGGACGTAAATAAG
Xenopus_tropicalis|2763        ------GTGAAAGATATTCCTTCTTCTGAGGCT---------GAA---GACGGAAACAAG
Erinaceus_europaeus|216        ------GTAAAGGATTGCCCTCCATCAGATACA---------GAA---GAGAAGAACAAA
Dasypus_novemcinctus|4090      ------GTGAAAGAATCCCCTCCCTCAGAACCA---------GAG---GACAAGAACAGA
Otolemur_garnettii|9673        ------GTGAAGGAATGCCCTCCATCAGAAACA---------GAG---GAGAAGAGCAGA
Monodelphis_domestica|5421     ------GTGAAAGAGTTTTGTCCTCCAGAAACA---------GAA---GACAAAAACAAA
Macropus_eugenii|821           ------GTGAAAGAGTTTTCTCCTCCGGAAATA---------GAA---GATAAAAACAAA
Ornithorhynchus_anatinus|23987 ------GTGAAAGAATTTTCTTCTCCGGAAACA---------GAA---GATTCCAACAAA
Anolis_carolinensis|17353      ------GTGAAAGAGGCCCCTTCCCTAGAAGTG---------GAG---GATGCGAACAAA
Gallus_gallus|4163             ------GTGAAAGAAGTGGAGCCTTTAGAAACA---------GAA---GATGCAGACAAA
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       ------GTGAAAGAAGTGCCACCTTTAGAGACA---------GAA---GATACAGACAAA
Tupaia_belangeri|14197         ------GTGAAGGAGGCCCCGCCCTCAGAGACG---------GAG---GAGAAGACCCAG
Microcebus_murinus|7543        ------GTGAAGGAAAAGTTTCCGTCCGCAACC---------GAG---GAGAAGAACAGA
Procavia_capensis|12495        ------NNNNNNNNNNNNNNNNNNNNNNNNNNN---------NNN---NNNNNNNNNNNN
Echinops_telfairi|15061        ------GTGAAGGACTGCCCCCCCTCAGAGACA---------GAG---GACAAGAACCAC
Bos_taurus|8430                ------GTAAAGGAGTGCCCCCCATCAGAGACG---------GAG---GAGCGGAACAAG
Tursiops_truncatus|9453        ------GTGAAGGAGAGTCCCACGTCGGAGACG---------GAG---GAGCGGGACAAG
Dipodomys_ordii|10310          ------GTAAAGGATTGCCCTCTTTCGGAGACA---------GAG---GACAAGAACAAG
Loxodonta_africana|22105       ------GTGAAGGAATGTCCTCCCTCAGAAGCC---------GAA---GATAAGAACAAA
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        ------GTGAAGGAGCAGCCTCCGTCCGAGGCC---------GAG---GACAAGGACAGG
Pteropus_vampyrus|10878        ------ATGAAGGAGTGTCCTCCGTCGGAAACG---------GAG---GAAAAGAACAAA
Myotis_lucifugus|3021          ------GTGAAGGAGTGTCCTCCGGCAGAAACA---------GAG---GAGAAGAACAAA
Cavia_porcellus|6308           ------GTGAAGGAGCAGCCCCTGTCGGAGACC---------GAG---GAGAGGGACAGG
Canis_familiaris|23275         ------GTGAAGGAGTGTCCTCCCTCGGAGACG---------GAG---GACAGGAGTAAG
Mus_musculus|42855             ------GTGAAGGAGTGCCCTCCGACTGAAACC---------GAG---GAGAGGAACAGG
Rattus_norvegicus|17390        ------GTGAAAGAGTGCCCTCCGTCTGAAACA---------GAG---GAGAAGAACCGG
Felis_catus|10871              ------GTGAAGGAGTGTCCCCCGTCGGAGACG---------GAG---GAGGGGAGCCAG
Equus_caballus|18610           ------GTGAAGGAGCATCCTCCGTCAGAGACA---------GAG---GAGAAGAACAAG
Callithrix_jacchus|9355        ------GTGAAGGAAAGTCCTCCATCAGAAACA---------GAA---GAGAAAAACAGA
Pongo_abelii|10961             ------GTGAAAGAACGTCCTCCATCAGAAACA---------GAA---GAGAAGAACAAA
Rhesus_macaque|25536           ------GTGAAGGAATGTCCTCCATCAGAAACG---------GAA---GAGAAGAACAGA
Homo_sapiens|32504             ------GTGAAGGAACATCCTCCATCAGAAACA---------GAA---GAGAAGAACAAA
Pan_troglodytes|14856          ------GTGAAGGAACATCCTCCATCAGAAACA---------GAA---GAGAAGAACAAA
Gorilla_gorilla|29937          ------GTGAAGGAACGTCCTCCATCAGAAACA---------GAA---GAGAAGAACAAA
Apis_mellifera|35463           GGTAATCTAAAAAAAGAGATAACATTTTTAGAA---------GAA---GATAAAAACAAA
Linepithema_humile|8515        GGAAGTGCAAAAAAACATTTGACATTCTTAGAA---------GAA---GACAAATCGAAG
Pogonomyrmex_barbatus|2952     GGAAGTGCAAAGAAAAATATAACGTTTTTAGAA---------GAA---GACAAATCAAAA
                                                                                           

Nematostella_vectensis|27223   AGAACCACAGCGATTTTCTACTCCATATGTTCGACACAGAAAGGCCTGGCAGGG------
Caenorhabditis_elegans|10573   ---ACAACTGCAATTTATTATTCAATCACTTCTACACAGCCTGGTCTTTCTGGT------
Daphnia_pulex|24329            GTAAACACAGCAATATTTTACAGCATCAGCTCAACTCAAAAAGGCCTCGCAGGG------
Branchiostoma_floridae|42309   ATCAACACTGCCATCTTTTACTCCATCACCTCTACACAGAAAGGTCTCCAGGGA------
Ixodes_scapularis|8636         ATCAAGGCGGCTATTTTCTACTCAATCTCTTCCACTCAGAAAGGTCTGCAGGGC------
Pediculus_humanus|8030         GTTAAAGCTGCTGTGTTTTATTCCATAAGTTCAACCCAAAAAGGATTGCAAGGA------
Nasonia_vitripennis|4128       ATAAAAGCAGCTATATTTTATTCTATATCGTCAACTCAAGTTGGTCTACAAGGC------
Danio_rerio|11244              ATCAACGCCGCCATCTTCTACTCCATCTCTTCCACCCAGGCCGGACTGCAGGGG------
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          ATAAATTCTGCCATCTTTTATTCCATCTCCTCAACCCAGGCGGGTCTGCAAGGA------
Fugu_rubripes|21650            ATAAATTCAGCCATTTTCTACTCCATCACCTCCACCCAGCCCGGCCTGCAGGGA------
Tetraodon_nigroviridis|4258    ATAAATGCGGCGATTTTCTACTCTATCACCTCCACGCAGCCCGGCCTGCAGGGA------
Xenopus_tropicalis|2763        ATACAGTCAGCCATATTTTATTCTATAAGTTTAACACAGCAAGGCCTGCAAGGA------
Erinaceus_europaeus|216        ATTGCCACCGCCATCTTCTACTCCATCAGCCTGACACAGCCAGGACTGCAGGGT------
Dasypus_novemcinctus|4090      ATTGCTGCTGCGATTTTTTACTCCATCAGCTTGACCCAGCAAGGGCTGCAAGGC------
Otolemur_garnettii|9673        ATTGCTGCTGCCATCTTTTACTCCATCAGTTTGACCCAGCAGGGACTGCAGGGG------
Monodelphis_domestica|5421     ATTGTCACTGCGATTTTCTATTCTATCAGTTTGACCCAGCAAGGTCTACAAGGT------
Macropus_eugenii|821           ATTGTCACTGCAATTTTCTATTCCATCAGTTTGGCCCAGCAAGGCCTACAAGGT------
Ornithorhynchus_anatinus|23987 ATTGTGGCAGCAATC---------------------------------------------
Anolis_carolinensis|17353      ATCACCACAGCCATTTTCTATTCCATCAGTTCGACTCAACAAGGGCTGCAGGGT------
Gallus_gallus|4163             ATTACAACAGCAATTTTCTACTCAATCAGTTTGACTCAGCAAGGACTGCAGGGA------
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       ATCACAACAGCAATTTTCTACTCCATCAGTTTGACTCAGCAGGGCCTGCAGGGG------
Tupaia_belangeri|14197         ATCGCCGCGGCCATCTTCTACTCCATCAGTCTGACCCAGCAAGGGCTGCAGGGC------
Microcebus_murinus|7543        ATCTTT---GCCATCTTCTATTTCATCTCCTTGAAACAACCAGGCCAGCCCGGG------
Procavia_capensis|12495        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------
Echinops_telfairi|15061        ATCACCACCGCCATCTTCTACTCCATCAGCCTGACGCAGCAGGGCCTGCAGGGG------
Bos_taurus|8430                ATCACCACGGCCATCTTCTACTCGCTGAGCCTAACCCAGCAGGGGCTGCAGGGC------
Tursiops_truncatus|9453        ATCACCACAGCCGTCCTATACTCGCTGAGCCTGACCCAGCAGGGGCTGCAGGGC------
Dipodomys_ordii|10310          ATTGCTGCGGCCATCTTCTACTCCATCAGCCTGATCCAGCAGGGACTGCAGGGT------
Loxodonta_africana|22105       ATCATCGCCGCGATTTTTTACTCCATCAGTTTGACCCAGCAAGGTCTACAGGGT------
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        ATTGCCTCTGCCATCTTCTACTCCATCAGCCTGACGCAGCAGGGGCTCCAGGGG------
Pteropus_vampyrus|10878        ATCGCCGCCGCCATCTTCTATTCCCTCAGTCTGGCCCAGCAAGGACTGCAGGGG------
Myotis_lucifugus|3021          ATTGCCGCCGCCATATTTTATTCCATCAGTCTGACCCAGCAAGGCCTGCAGGGG------
Cavia_porcellus|6308           ATCGCCGCTGCCATCTTCTACTCCATCAGCCTCACGCAGCAGGGACTGCAGGGC------
Canis_familiaris|23275         ATCTCTGCGGCCATCTTCTACTCCATCAGCCTGACACAGCCTGGACTGCAAGGT------
Mus_musculus|42855             ATCGCCGCTGCCATCTTCTACTCCATCAGCCTGACCCAGCAGGGCCTGCAGGGG------
Rattus_norvegicus|17390        ATCGCTGCTGCTGTCTTCTACTCCATCAGCCTGACCCAGCAGGGCCTGCAGGGC------
Felis_catus|10871              ATCTCTGCGGCCATCTTCTACTCCATCAGCCTGACGCAACCCGGACTGCAGGGG------
Equus_caballus|18610           ATTGCCGCTGCCATCTTCTATTCCATCAGCCTGACGCAGCAGGGCCTGCAGGGG------
Callithrix_jacchus|9355        ATTGCTGCTGCCATCTTTTATTCTATCAGTTTGACCCAGCAGGGACTCCAGGGG------
Pongo_abelii|10961             ATTGCTGCTGCCATCTTTTATTCCATCAGTTTGACCCAGCAGGGACTCCAAGGG------
Rhesus_macaque|25536           ATTGCTGCTGCGATCTTTTATTCCATCAGTTTGACCCAGCAGGGACTCCAAGGG------
Homo_sapiens|32504             ATCACTGCTGCGATCTTTTATTCCATCAGCTTGACCCAGCAGGGACTCCAAGGG------
Pan_troglodytes|14856          ATTGCTGCTGCGATCTTTTATTCCATCAGCTTGACCCAGCAGGGACTCCAAGGG------
Gorilla_gorilla|29937          ATTGCTGCTGCGATCTTTTATTCCATCAGCTTGACCCAGCAGGGACTCCAAGGG------
Apis_mellifera|35463           ATAAAAACTGCAATATTTTATTCAATAACTTCCACACAGAAAGGATTACAAGGT------
Linepithema_humile|8515        ATAAAAGCAGCAATATTTTATTCTATAGCATCTACGCAAAAAGGATTGCAGGGC------
Pogonomyrmex_barbatus|2952     ATAAAAGCGGCAATATTTTATTCTATAGTATCTACTCAAAAAGGATTGCAGAAATTACAT
                                                                                           

Nematostella_vectensis|27223   GTGGACTTGGGGAACTTTCTCATCAAA------------CACGTGGTCCGCGAGCTTCAA
Caenorhabditis_elegans|10573   ATTGATCTCGGAAATATGCTCATCAAG------------AAAGTCGCCACTAAACTTCAA
Daphnia_pulex|24329            ATAGATTTAGGTCAATCTTTGATAAAA------------AGAGCTCTTCGGGAGTTACAA
Branchiostoma_floridae|42309   GTTGAACTTGGAAACTACCTCATCAAG------------CGGGTTGTACGGGAACTGCAG
Ixodes_scapularis|8636         ATAGAGCTGGGCAAGTACCTGATCAAG------------GGGGTCGTGAAGGAAGTCAAG
Pediculus_humanus|8030         ATAGAACTAGGGAATTATTTAATTAAA------------AGTGTTGTTCATGAATTGCAA
Nasonia_vitripennis|4128       ATTGAGTTGGGAAATTATTTGATAAAA------------GAAGTAGCAAAACATATAACT
Danio_rerio|11244              GTGGAGCTGGGCAATTACCTGATCAAG------------AGGGTGGTCCGAGAACTACAG
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          GTGGAGCTTGGCAACTACCTCATCAAG------------AAGGTGGTGCGCGAACTGCAG
Fugu_rubripes|21650            GTGGAGCTGGGGAACTACCTCATCAAG------------AGGGTGGTCCGAGAACTTCAG
Tetraodon_nigroviridis|4258    GTGGAGCTGGGGAACTACCTGATCAAG------------AGGGTGGTCCGAGAGCTTCAG
Xenopus_tropicalis|2763        GTGGAACTTGGGAACTACCTTATCAAG------------CGGGTAGTAAAGGAGCTGCAG
Erinaceus_europaeus|216        GTGGAGCTGGGTGGTTTCCTCATCAAG------------AGGGTGGTGAAGGAGTTGCAG
Dasypus_novemcinctus|4090      GTCGAGCTAGGAACCTTCCTCATTAAA------------CGAGTGGTCAAGGAGCTGCAG
Otolemur_garnettii|9673        GTAGAGCTGGGGACATTCCTGGTGAAG------------CGTGTCATCAAGGAGCTGCAG
Monodelphis_domestica|5421     GTTGAATTGGGAAGTTTCCTTATAAAA------------CGAGTTGTTAAGGAATTGCAG
Macropus_eugenii|821           GTTGAGTTGGGAAGTTTCCTTATAAAA------------CGAGTTGTTAAGGAACTGCAG
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      GTGGAGCTGGGGAGCCACCTGATCAAG------------CGGGTTGTGGCAGAACTGCAG
Gallus_gallus|4163             GTGGAACTTGGGACTTACCTCATCAAA------------CGTGTGGTAAAGGAGCTGCAG
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       GTGGAACTTGGGACTCACCTCATCAAA------------AGAGTTGTCAAAGAGCTGCAG
Tupaia_belangeri|14197         GTGGAGCTGGGGACCTTCCTCATAAAG------------CGGGTTGTCAAGGAGCTGCAG
Microcebus_murinus|7543        GTGGAGCTGTCATGCCTTATCCTA---------------CGACTCTTCAAGGAGCTGCAG
Procavia_capensis|12495        NNNNNNNNNNNNNNNNNNNNNNNNNNN------------NNNNNNNNNNNNNNNNNNNNN
Echinops_telfairi|15061        ATCGAGCTCGGCACCTTCCTAATCAAG------------CGGGTCATAAAGGAGCTGCGG
Bos_taurus|8430                GTGGAGCTGGGCGCCTTCCTCATCAAG------------CGGGTGGTGAAGGAGCTGCAG
Tursiops_truncatus|9453        GTGGAGCTGGGCGCCTTCCTCATCAAG------------CGGGTGGTGAAGGAGCTGCAG
Dipodomys_ordii|10310          GTGGAGCTGGGAACGTTCCTCATAAAG------------CAGGTGGTCAGGGAGCTGCAG
Loxodonta_africana|22105       GTTGAGCTAGGAAAGTTCCTTGTAAAA------------CGTGTCATAAAGGAGCTGCAG
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        GTGGAGCTGGGAACGTTCCTCATAAAG------------CGGGTCGTCAAAGAGCTGCAG
Pteropus_vampyrus|10878        GTGGAACTGGGGTCCTTTCTCATAAAG------------CGAGTGGTGAAGGAGCTGCAG
Myotis_lucifugus|3021          GTGGAGCTGGGAACCTTCCTCATAAAG------------CGCGTGGTAAAGGAGCTGCAG
Cavia_porcellus|6308           GTCGAGCTGGGCACTTTCCTCGTAAAG------------CGCGTCCTCAAGGAGCTGCAG
Canis_familiaris|23275         GTGGAGCTGGGCACTGTCCTGGTCAAG------------CGAGTGCTCAAGGAGCTGCAG
Mus_musculus|42855             GTGGAGCTCGGGACCTTCCTCATAAAG------------AGAGTGGTCAAGGAGCTGCAG
Rattus_norvegicus|17390        GTGGAGCTCGGCACCTTCCTCATAAAG------------CGAGTGGTCAAGGAGCTGCAG
Felis_catus|10871              GTAGAGCTGGGCACCTTCCTCGTCAAG------------CGAGTGCTCAAGGAGCTGCAG
Equus_caballus|18610           GTGGAGCTGGGCACCTTCCTCATCAAG------------CGGGTGGTCAAGGAGCTGCAG
Callithrix_jacchus|9355        GTGGAGCTGGGAACATTCCTCATAAAA------------CGAGTCATCAAGGAGTTGCAG
Pongo_abelii|10961             GTGGAGCTGGGAACATTCCTCATAAAG------------CGAGTCGTCAAGGAGTTGCAG
Rhesus_macaque|25536           GTGGAGCTGGGAACATTCCTCATAAAG------------CGAGTCGTCAAGGAGTTGCAG
Homo_sapiens|32504             GTGGAGCTGGGAACATTCCTCATAAAG------------CGAGTCGTCAAGGAGTTGCAG
Pan_troglodytes|14856          GTGGAGCTGGGAACATTCCTCATAAAG------------CGAGTCGTCAAGGAGTTGCAG
Gorilla_gorilla|29937          GTGGAGCTGGGAACATTCCTCATAAAG------------CGAGTCGTCAAGGAGTTGCAG
Apis_mellifera|35463           ATTGAACTTGGTAATTATTTAATAAAA------------GAAGTGGCAAAAGAAGTGATA
Linepithema_humile|8515        ATTGAGCTCGGTAATTACCTTATAAAA------------GAAGTGGTCAATGAGATCAGA
Pogonomyrmex_barbatus|2952     ATAGCTCTAAGAGGATATCCTTGCAGGGGATTGAATTGGAAAGTGGCGAGCGAGATTACG
                                                                                           

Nematostella_vectensis|27223   CACGAGTTTCCTAATATTACCCAGTATGCAACGCTTTCGCCTATCCCAGGGTTCCGTGCG
Caenorhabditis_elegans|10573   AAAGATGTTCCATCAGTCACAACTCATTCAACATTATCTCCGATTCCTGGTTTCCGACCT
Daphnia_pulex|24329            ACGGAAATTCCATCTCTACAGCAACATTCAACGCTTTCTCCCATACCGGGCTTCCGGTCT
Branchiostoma_floridae|42309   GCAGAGTTTCCTAAGATGACCCAGTTCTCGTCCCTCTCCCCCATCCCCGGCTTCCGTGAT
Ixodes_scapularis|8636         GCAGAGTTTCCCCACATCCAGGATTTCTCTTCCCTCTCGCCCATCCCCGGCTTCAAGAAC
Pediculus_humanus|8030         ATTGAATTTCCTCAAATGACTCAATTTTCTAGTTTGTCCCCTATTCCTAATTTTAAAACA
Nasonia_vitripennis|4128       GCAGAATTCCCAATGATAGACCAACTTTCTAGTTTATCACCTATACCAAATTTCCGAGTA
Danio_rerio|11244              AGCGAGTTTCCACACATGGCCCAGTTCTCCAGTCTGTCTCCGATCCCTGGCTTCTCCTTA
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          AGCGAGTTCCCTCACATGGCTCAGTTCTCCAGTCTGTCTCCCATCCCGGGCTTCTCTGTT
Fugu_rubripes|21650            AGTGAGTTTCCTCAGATGGCCCAGTTCTCCAGCCTCTCTCCGATCCCAGGCTTCTGCACC
Tetraodon_nigroviridis|4258    AGTGAGTTTCCGCACATGGCCCAGTTCTCCAGCCTGTCTCCGATCCCCGGCTTCTGCACC
Xenopus_tropicalis|2763        GTAGAGTTCCCTCAGATTCTAGAGTTTTCAAGCCTTTCTCCAATCCCGGGCTTTACAAAA
Erinaceus_europaeus|216        AGAGAGTTTCCTCACCTCGGGGCATTTTCAAGTCTGTCTCCTATACCTGGGTTCACCAAG
Dasypus_novemcinctus|4090      AAGGAGTTCCCCCACCTCGGGACGTTTTCGAGTCTGTCGCCCATACCTGGGTTCACCAAG
Otolemur_garnettii|9673        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Monodelphis_domestica|5421     AGGGAATTTCCTCACCTTGAAACTTTTTCAAGTCTGTCACCTATACCTGGATTCACCAAA
Macropus_eugenii|821           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      ATGGAGTTCCCCCAGATCAAGGTCTTTTCTACTCTGTCTCCCATCCCGGGCTTCACCAAG
Gallus_gallus|4163             AAAGAACTTCCTCAGATAAAAACTTTCTCCACTCTGTCGCCTATCCCTGGCTTCACAAAG
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       AAAGAACTTCCTCAGATAGAAGCTTTTTCCACACTTTCACCTATCCCAGGATTCACAAAA
Tupaia_belangeri|14197         AGAGAGTTTCCTCACCTCGGGGCGTTCTCAAGTCTGTCGCCCATCCCTGGGTTCACCAAG
Microcebus_murinus|7543        AAAGACTTTCCTCACCTGGGGACGTTCTCGAGTCTGTCGCCTATACCTGGGTTCACCAAA
Procavia_capensis|12495        AAAGAGTTTCCTCATCTTGCAGTATTTTCAAGTTTGTCACCTATACCTGGGTTCACCAAG
Echinops_telfairi|15061        ------------------------------------------------------------
Bos_taurus|8430                AAGGAGTTCCCCGCGCTGGGCGCCTTCTCCAGCCTGTCTCCCATCCCCGGCTTCACCAAG
Tursiops_truncatus|9453        AAGGAGTTTCCTCACCTGGGGACGTTTTCAAGTCTGTCCCCTATCCCCGGGTTCACCAAG
Dipodomys_ordii|10310          AAGGAGTTCCCTCACCTGGGGGCGTTCTCCAGCCTGTCGCCCATCCCCGGCTTCACCAAG
Loxodonta_africana|22105       AAAGAGTTTCCTCACCTTGGAGCATTTTCAAGTCTGTCACCTGTACCTGGATTCACCAAG
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        AAAGAGTTTCCTCAC---GGGGCCTTCTCGAGTCTGTCACCCATCCCTGGTTTCACCAAG
Pteropus_vampyrus|10878        AAAGAGTTTCCTCACGTTGGGACATTTTCAAGCCTGTCTCCTATACCTGGATTCACCAAA
Myotis_lucifugus|3021          AAAGAGTTTCCTCACCTTGGGACATTTTCAAGTCTGTCTCCTATCCCTGGCTTCACCAAA
Cavia_porcellus|6308           AAAGAGTTCCCGCACCTGGGGGCCTTTTCCAGCCTGTCGCCCATACCCGGATTCACCAAA
Canis_familiaris|23275         AAAGAGTTTCCTCATCTTGGGACATTTTCAAGCCTGTCTCCTATACCTGGATTCACCAAG
Mus_musculus|42855             AAGGAATTTCCTCAGCTGGGGGCCTTTTCAAGCCTGTCGCCTATCCCTGGATTCACCAAG
Rattus_norvegicus|17390        AAGGAGTTTCCTCATCTGGGGGCCTTTTCCAGCCTGTCACCTATACCCGGATTCACCAAG
Felis_catus|10871              AGAGAGTTTCCTCATCTCGGGACGTTCTCAAGTCTGTCTCCTATCCCCGGCTTCACCAAG
Equus_caballus|18610           AAAGAGTTTCCTCACCTTGGGACGTTTTCAAGCCTGTCTCCTATACCCGGATTCACCAAG
Callithrix_jacchus|9355        AGAGAGTTTCCTCACCTTGAGGTGTTTTCAAGTCTGTCACCTATA---------------
Pongo_abelii|10961             AGAGAGTTTCCTCACCTTGGGGTGTTTTCGAGTCTGTCACCTATACCTGGATTCACCAAA
Rhesus_macaque|25536           CGAGAGTTTCCTCACCTTGGAGTGTTTTCGAGTCTGTCACCTATACCTGGATTCACCAAA
Homo_sapiens|32504             AGAGAGTTTCCTCACCTTGGGGTGTTTTCAAGTCTGTCACCTATACCTGGTTTCACCAAA
Pan_troglodytes|14856          AGAGAGTTTCCTCACCTTGGGGTGTTTTCGAGTCTGTCACCTATACCTGGTTTCACCAAA
Gorilla_gorilla|29937          AGAGAGTTTCCTCACCTTGGGGTGTTTTCGAGTCTGTCACCTATACCTGGTTTCACCAAA
Apis_mellifera|35463           TCAGAATTTCCTATGATTCATGAATTATCTTCATTATCACCAATACCTAACTTTAGAACA
Linepithema_humile|8515        ACTGAATTTCCAGCTGTGCAACAATTGTCTAGCTTATCACCGATACCAAACTTTAAGAGT
Pogonomyrmex_barbatus|2952     ACTGAATTTCCAGCTGTGCAACAATTGTCCAGCTTATCACCGATACCACATTTTAAGACT
                                                                                           

Nematostella_vectensis|27223   TGGTTGACTTTGGAGCTAAAAGAC------------------------------------
Caenorhabditis_elegans|10573   TGGCTTATCAGAAATCTGAAAGGG------------------------------------
Daphnia_pulex|24329            TGGCTGCTTCAGCAGCTTCGGGAA------------------------------------
Branchiostoma_floridae|42309   TGGTTGGTTGGAGAGATCAACAAGGTGCTAGGCTCTACAGAGTCTTCCTCATCAGAAGAC
Ixodes_scapularis|8636         TGGCTTGTTTCGGAAGTCCACAAG------------------------------------
Pediculus_humanus|8030         TGGCTGATAGACAAAGTAAAATTT------------------------------------
Nasonia_vitripennis|4128       TGGCTTCTAGATAGAATGAAAAGA------------------------------------
Danio_rerio|11244              TGGCTCCAAGGGGCTTTGGGACAG------------------------------------
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          TGGCTTCAGGGCCTCTTGAATCAG------------------------------------
Fugu_rubripes|21650            TGGCTCCAAGGCCTGCTCGGCCAG------------------------------------
Tetraodon_nigroviridis|4258    TGGCTGCAAGGCTTGTTGGGCCAG------------------------------------
Xenopus_tropicalis|2763        TGGCTGTTGGGAGCTTTGAGCTCT------------------------------------
Erinaceus_europaeus|216        TGGCTTCTGGGGCTCCTGAGCTCA------------------------------------
Dasypus_novemcinctus|4090      TGGCTCCTGGGGTCCCTGAACACA------------------------------------
Otolemur_garnettii|9673        NNNNNTCTGGGGCTTCTACACTCA------------------------------------
Monodelphis_domestica|5421     TGGCTTCTTGGAACACTGAGCTCT------------------------------------
Macropus_eugenii|821           NNNNNNNNNNNNNNNNNNNNNNNN------------------------------------
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      TGGCTCGTCGGCCTCCTTTCCTCA------------------------------------
Gallus_gallus|4163             TGGCTCGTCGGTCTCCTCTCCTCA------------------------------------
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       TGGCTCGTTGgtctcctctcctcc------------------------------------
Tupaia_belangeri|14197         TGGCTTCTGGGGCTCCTGAACTCG------------------------------------
Microcebus_murinus|7543        TGGCTTCTGGGGCTTCTGAACTCT------------------------------------
Procavia_capensis|12495        TGGCTTCTGGGCTTTTTAAGCTCA------------------------------------
Echinops_telfairi|15061        ------------------------------------------------------------
Bos_taurus|8430                TGGCTCCTGGGGCTACTCAAGTCC------------------------------------
Tursiops_truncatus|9453        TGGCTTCTGGGGCTGCTGAAGTCA------------------------------------
Dipodomys_ordii|10310          TGGCTTCTGGGGCTCCTGAGCCTG------------------------------------
Loxodonta_africana|22105       TGGCTCCTGGGCTTGCTAAGCTTG------------------------------------
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        TGGCTGCTGGGGCTCCTGAGCTCG------------------------------------
Pteropus_vampyrus|10878        TGGCTTCTGGGGCTCCTGAAATCG------------------------------------
Myotis_lucifugus|3021          TGGCTCCTGGGGCTTCTGAACTCA------------------------------------
Cavia_porcellus|6308           TGGCTCCTGGGGCTTCTGGGCTCG------------------------------------
Canis_familiaris|23275         TGGCTTCTCGGACTCCTGAGCTCA------------------------------------
Mus_musculus|42855             TGGCTGCTGGGCCTCCTGAATGTG------------------------------------
Rattus_norvegicus|17390        TGGCTGCTGGGCCTTCTGAATGTG------------------------------------
Felis_catus|10871              TGGCTTCTGGGGCTCCTGAACTCA------------------------------------
Equus_caballus|18610           TGGCTCCTGGGGGTCCTGAACGCG------------------------------------
Callithrix_jacchus|9355        ------------------------------------------------------------
Pongo_abelii|10961             TGGCTTCTGGGGCTTCTGAACTCG------------------------------------
Rhesus_macaque|25536           TGGCTTCTGGGGCTTCTGAACTCG------------------------------------
Homo_sapiens|32504             TGGCTTCTGGGGCTTCTGAACTCG------------------------------------
Pan_troglodytes|14856          TGGCTTCTCGGGCTTCTGAACTCG------------------------------------
Gorilla_gorilla|29937          TGGCTTCTGGGGCTTCTGAACTCG------------------------------------
Apis_mellifera|35463           TGGTTTTTGGAAAAAATAAAACAA------------------------------------
Linepithema_humile|8515        TGGTTGCTGGATAAACTGAAACAA------------------------------------
Pogonomyrmex_barbatus|2952     TGGCTATTTGATAAACTGAAACAA------------------------------------
                                                                                           

Nematostella_vectensis|27223   ---------GCTATTGAAAACAAAGGTACAAATCGTCATTCGTTTGAAACTTCTTATGTT
Caenorhabditis_elegans|10573   ------------------AATTCAGAATATCCTTCAATTATGAATGAAAAGGTTGTCAAT
Daphnia_pulex|24329            ---------------ACTGAACGTGGGCGAAAAACAGTTTTAACTGATTTTAATTGGAGT
Branchiostoma_floridae|42309   AGTGGGGTTGATGGTCCTTCATCTACAGCTCCAACCCTCCTGACTTCAGCTGAGCTTCAG
Ixodes_scapularis|8636         ---------------ATCATCAAAGGCCAGCCGGAAAGCAGGAAGCTCCTAAATCAGCGT
Pediculus_humanus|8030         ---------------GCAGAAAAAGGTTCAAATGACATTTTACTACATGATGAAATAATT
Nasonia_vitripennis|4128       ---------GATATC---------------AATACAGTTTTTACTAAAACTGAGCAAGAG
Danio_rerio|11244              ---------CACAAGAAGGAGGGTCGAGCCACAGAGCTCCTCTCTGAGCAGGAGTGGCGG
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          ---------TACAGGAAGGACAACAGGGGCACGGACCTGCTGTCCGAGCACGAGTGGAAG
Fugu_rubripes|21650            ---------TACAGAAAGGAAAGATGTCACCCTGACCTCCTGTCTGAGCAAGAATGGAGG
Tetraodon_nigroviridis|4258    ---------TACAGGAAGGATGGGCGCCACCCCGACATCCTATCTGAGCAAGAATGGAAG
Xenopus_tropicalis|2763        ---------CAGATTAAAGAGTCTGGTAGAACAGAGCTGTTCACTGAAGCAGAATGCAAA
Erinaceus_europaeus|216        ---------CAAGCCAAGGAGCACGGGAGAAACGAGCTGCTCACAGACTCTGAATGTAAA
Dasypus_novemcinctus|4090      ---------CAAGCAAAGGAGCCGGGGCGGAGCGAGCTCTTCACCGACTACGAGTGCAGA
Otolemur_garnettii|9673        ---------------CACAAAGAGCGGCGGAACGAACTGTTTACAGATTCAGAATGTAAA
Monodelphis_domestica|5421     ---------CAAACTAAAGAACTTGGGAGGAACGAACTCTTTACAGATTCTGAATGTAAC
Macropus_eugenii|821           ---------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCTAAATGTAAT
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      ---------ATGTCTAAGGAAAATGCCCGAAGCAACCCTTTCACGGACCCCGAATATCGA
Gallus_gallus|4163             ---------CAGACAAAAGAACTGGAAAAGAACGAACTTTTTACAGAATCAGAACGCCAG
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       ---------cagacaaaagaaaagggaaggaatgaaCTTTTTACAGAATCTGAATGGCAG
Tupaia_belangeri|14197         ---------CAAGCCAAGGAGCGCGGGCGGAGTGAACTGTTCACGGACTCGGAGTGTAAA
Microcebus_murinus|7543        ---------CAGACGAGAGAGCTGGGGAGGAGCGAGCTCCTCACAGACTCGGAATGCCGC
Procavia_capensis|12495        ---------CAG---AAGGATCATGGGCGTAATCAGCTCTTCACCGACTTTGAATCTAAG
Echinops_telfairi|15061        ------------------------------------------------------------
Bos_taurus|8430                ---------AAAGCCAAGGAGCACGGGCGGAGCGGACTGTTGACGGACTCCGAGAGTCAG
Tursiops_truncatus|9453        ---------AAAGCAAAGGATCACGGGAGGAACGAACTGTTGACAGATTCCGAGTGTAAA
Dipodomys_ordii|10310          ---------CAAGCCAAGGAGCACGGGAAGAACGAACTGTTCACAGACTCGGAGTCCAGG
Loxodonta_africana|22105       ---------CAG---AAGGATCATGGGCGAAGTCAGCTCTTCACCGACTCTGAATCTAAG
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        ---------CAGGCGAAGGAGCGAGGCCGGAGCGAGCTGTTCTCGGACTCTGAGTGCAGG
Pteropus_vampyrus|10878        ---------CAAGCGAAGGAGCACGGGAGGAATGAACTATTCACAGATTCTGAAAGCAAA
Myotis_lucifugus|3021          ---------CAAGCAAAGGATCATGGGAGGAGTGAGTTATTTACAGATTCTGAGTATAAA
Cavia_porcellus|6308           ---------CAGACAAAGGAGCATGGGCGGAACGGCCTGTTCACGGATTCGGAAAGTAAA
Canis_familiaris|23275         ---------CAAGGAAAGGAACACGGGAGGAGTGAACTGTTTACAGATGCCGAATGTAAA
Mus_musculus|42855             ---------CAGGGGAAGGAGCATGGGAGGAACGAACTATTCACAGACTCAGAGTGCCAA
Rattus_norvegicus|17390        ---------CAGGGAAAGGAGTATGGGAGGAACGAGCTGTTCACAGACTCAGAGTGCAAA
Felis_catus|10871              ---------CAAGCAAAGGAACACGGGAGGATTGAACTGCTCACAGATTCCGAATGTAAA
Equus_caballus|18610           ---------CAAGCCAAGGATCACGGGAGGAGTGAACTGTTTGCAGAGTCTGAAAGTAAA
Callithrix_jacchus|9355        ------------------------------------------------------------
Pongo_abelii|10961             ---------CAAACGAAGGAGCACGGGAGGAATGAACTCTTTACAGATTTGGAATGTAAG
Rhesus_macaque|25536           ---------CAAGTGAAGGATCACGGGAGGAATGAACTCTTCACAGATTCGGAGTGTAAG
Homo_sapiens|32504             ---------CAAACGAAGGAGCATGGGAGGAATGAACTCTTTACAGATTCGGAATGTAAG
Pan_troglodytes|14856          ---------CAAATGAAGGAGCATGGGAGGAATGAACTCTTTACAGATTCGGAATGTAAG
Gorilla_gorilla|29937          ---------CAAACGAAGGAGCATGGGAGGAATGAACTCTTTACAGATTCGGAATGTAAG
Apis_mellifera|35463           ------------------------GATATATATAATATTTTCACAAATGAAGAATGTAAT
Linepithema_humile|8515        ------------------------GATGTGGCATTTATATTCACCGCGCAAGAACATGCG
Pogonomyrmex_barbatus|2952     ------------------------GATATAGCATTTATATTTACCGCGCAAGAACATAGA
                                                                                           

Nematostella_vectensis|27223   TCTTTA---------------------AGGCGTAGATTTACA---------GTTTGTTTT
Caenorhabditis_elegans|10573   TGGATT---------------------TCTGATATATCTGAAAGGGAAATGAACGAAGTA
Daphnia_pulex|24329            ACGGCT---------------------CTTCAGTTAATTAAC------AGTACCAAAGAA
Branchiostoma_floridae|42309   AAGGTG---------------------GCGGAGATTGCAGGG------AAGGAAGATGTG
Ixodes_scapularis|8636         GAGCTC---------------------GAGGAGATTGTGGCACCATACCGGGAAGACAGG
Pediculus_humanus|8030         ACTTTA---------------------AAAAAACATCTAAAT---------TCTTCATCG
Nasonia_vitripennis|4128       TCGATAAAATATAATTTGGACTATGATCAAACAATTACGGCA------------ACAAGA
Danio_rerio|11244              GAAGTG---------------------GAGGACGTGACGGGA---GCTGCTCCTGGTGCC
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          GAGGTG---------------------GAGCAGGCCACGGAC---TCGAGTCCGGGGAGC
Fugu_rubripes|21650            GAGGTGGAACTAGCTACAGAATGCCTCGGTAGCAGGCCAGGA---------------ATG
Tetraodon_nigroviridis|4258    GAAGTG---------------------GGACAGGCCACAGAC---TCGGCGCCGGGAACC
Xenopus_tropicalis|2763        GAAATA---------------------GAGGACATTACAGGA---------------GGA
Erinaceus_europaeus|216        GAGATC---------------------TCCGAGCTCACTGGT---------------GGG
Dasypus_novemcinctus|4090      GAGATC---------------------GCCGAGGCCACGGGC---------------GGC
Otolemur_garnettii|9673        GAACTA---------------------TCAGAACTCACTGGT---------------GGC
Monodelphis_domestica|5421     GAAATC---------------------TCAGATATCATAGGT---------------GGC
Macropus_eugenii|821           GAAATC---------------------TCGGATATCTTAGGT---------------GGC
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      GAAATC---------------------GGTGAGATCACCGGG---------------GAC
Gallus_gallus|4163             GAACTA---------------------TCTCAGATCACAGGC---------------GAC
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       GAAATC---------------------TCTGAGATCACTGGG---------------GAC
Tupaia_belangeri|14197         GAAATC---------------------TCTGAGGTCACTGGA---------------GGT
Microcebus_murinus|7543        GAGCTC---------------------TCCGAGCTCACCGGG---------------GGC
Procavia_capensis|12495        GAAATC---------------------TCTGAGATCACTGGC---------------GGG
Echinops_telfairi|15061        ------------------------------------------------------------
Bos_taurus|8430                GAGATC---------------------GCCGAGCTCACGGGC---------------GGC
Tursiops_truncatus|9453        GAAATC---------------------TCCAAGATCACGGGC---------------GGT
Dipodomys_ordii|10310          GACATC---------------------GCCGAAGCCACGGGC---------------GGC
Loxodonta_africana|22105       GATATC---------------------TCCGAGATCACTGGC---------------GGG
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        GAGCTC---------------------GCTGAGCTCACCGGG---------------GAC
Pteropus_vampyrus|10878        GAAATC---------------------TCAGAGATCACAGGC---------------GGT
Myotis_lucifugus|3021          GAAATT---------------------TCTGCGGTCACAGGG---------------GGT
Cavia_porcellus|6308           GAGCTC---------------------GGCGAGGCTGTGGGC---------------GGC
Canis_familiaris|23275         GAAATC---------------------TCTGAGATCACAGGC---------------GGT
Mus_musculus|42855             GAAATC---------------------TCAGCGGTTACCGGC---------------AAC
Rattus_norvegicus|17390        GAAATC---------------------GCAGAGGTCACGGGC---------------GAC
Felis_catus|10871              GAAATC---------------------TCGGAGATCCTAGGT------------------
Equus_caballus|18610           GAGATC---------------------TCCGAGATCCTAGGT---------------GGT
Callithrix_jacchus|9355        ------------------------------------------------------------
Pongo_abelii|10961             GAAATC---------------------TCGGAGATCACAGGT---------------GGC
Rhesus_macaque|25536           GAAATC---------------------TCGGAGATCACAGGT---------------GGC
Homo_sapiens|32504             GAAATC---------------------TCGGAGATCACAGGT---------------GGC
Pan_troglodytes|14856          GAAATC---------------------TCGGAGATCACAGGT---------------GGC
Gorilla_gorilla|29937          GAAATC---------------------TCGGAGATCACAGGT---------------GGC
Apis_mellifera|35463           TCTATA---------------------CAAGAAATTTTAAAA------------GAAAAA
Linepithema_humile|8515        ATTATG---------------------AAAGATATTCTAAAA------------ACAGAA
Pogonomyrmex_barbatus|2952     ATTGCA---------------------AAAGATATTTTGCAA------------ACAGAA
                                                                                           

Nematostella_vectensis|27223   ATGCTATTGTTATTGTTTCAGGAGTTGATCGAGAGAGATAACTGGCACAAAGACCAAGAT
Caenorhabditis_elegans|10573   GAAGCAACCGAAACTCTACTGAAAGTCATAAGCAATGAAAAA------ACGAAAAAGGAG
Daphnia_pulex|24329            AATCCGCTCGGGATGCTCCGTAGTTTGCTAGTCGATAGTTCATGGATGAGGGAAGAAGCG
Branchiostoma_floridae|42309   TCACCATTGGTCACACTGAAGAAACTTCTACAGACCAACCAGTGGATGGGAGCAGAGTCC
Ixodes_scapularis|8636         GAACCCCTTGAGGCTTTCCTGAGGCTGCTCAGGAACAATGGCTGGTACCAGGTACCAGAG
Pediculus_humanus|8030         GACTTTTGGAAAGATTTTAAAAAAATTTTACTTTCGAATGCTTGGGCAGAAGATAAAAAT
Nasonia_vitripennis|4128       GATCTGCATTTAGATTTAAAAAAGATTTTCAACAATTCTCTTTGGGGAAATGACAAAAGA
Danio_rerio|11244              CCGGCTCTGGAGGCCCTGCGCAGACTCATCAGCACCAGCGAGTGGATTCACTCTGACCGT
Gasterosteus_aculeatus|23283   ------------------------------------------------------------
Oryzias_latipes|18991          CAGGCCACCGAGGCGCTCCGTAAACTCATCAGCAGCGGAGAGTGGATGCGCTCAGAGAGG
Fugu_rubripes|21650            CCTGCTACCGAGGCCCTCCGCAAACTAATCGGAACTGGTGAATGGATGCATTCTGAGCTC
Tetraodon_nigroviridis|4258    GCCGCCACCGAGGCCCTCCGCAAGCTGATCGGCACCGGCGAGTGGATGCATTCCGAGCGC
Xenopus_tropicalis|2763        CCGCTTTCCGAATCTTTAAAACGTCTTTTTACAAGCAGTGAATGGATGAGGTGTGAAAGA
Erinaceus_europaeus|216        CCGGCCCTCGAGACCCTCAAGGGTCTTCTCAGCAGCAACGACTGGGCCAAGTCAGAAAAG
Dasypus_novemcinctus|4090      CCTGTGAGCGAGACGCTCAGGGCCTTTCTCGGCAGCAGTGAGTGGGTGAAGTCGGAGAAG
Otolemur_garnettii|9673        CCCATCACTGAGACTCTCAAGGGTCTTCTGGGCAGCAGTGAATGGGTGAAGTCCGAGAAG
Monodelphis_domestica|5421     CCCATTAGTGAAACTCTGAAGATACTTTTAACTAGCAATGAGTGGGTGAAATCTGAAAAA
Macropus_eugenii|821           CCCATTACTGAAACTTTG---ATTTTTTTTAACAGTAGCGAATGCGTGAAATCTGAAAAA
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      CCCGTGACCGAAACCCTCAAACGCCTGTTGACGAACAATGAGTGGGTGAGGTCTGAGAGA
Gallus_gallus|4163             TGTACTACTGAAACACTAAAGAAGCTCTTAAATAACAACGAATGGGTACGATCAGAAAAA
Taeniopygia_guttata|17863      ------------------------------------------------------------
Taeniopygia_guttata|1636       CCCACCGGCAACACGCTAAAGAAACTCTTGAACACCAACGAGTGGGTGAGGTCAGAAAAG
Tupaia_belangeri|14197         CCCGTCAACGAAACACTCAAGGCCTTTCTCAGCAGCAACGAGTGGGTGTCCTCGGAGAGG
Microcebus_murinus|7543        CCCGCCAGCGAGACGCTCAAGGCCCTTCTCGGCAGCAGCGAGTGGGCCAAGTCCGAGAAG
Procavia_capensis|12495        CCCATCACTGAGACGCTCAAAGCCTTCCTCAGCAGCCCCGAGTGGGTGAAGTCTGAGAAA
Echinops_telfairi|15061        ------------------------------------------------------------
Bos_taurus|8430                CCCGCGCTTGAAACGCTGCAGACGCTGCTGAGCAGCAGCGAGTGGGCGCAGTCGGAGCAG
Tursiops_truncatus|9453        CCCGTGAATGAGACCCTCAAGACCATTCTCAGCAGCAGCGAGTGGGTCCAGTCTGAGCAG
Dipodomys_ordii|10310          CCCGCTCACGAGACCCTCAGGGCCTACCTGAGCAGCAACGAGTGGGTGAAGTCGGCGAAG
Loxodonta_africana|22105       CCCATCAACGAGACCCTCAAGGTCTTCCTCAGCAGCCACGAGTGGGTGAGGTCTGAGAAA
Ornithorhynchus_anatinus|23986 ------------------------------------------------------------
Ochotona_princeps|16626        CCTGTGCACGAGACCCTCAGGGGTCTCCTCAGCAGCAGCGAGTGGGCCAAGTCGGAGAAG
Pteropus_vampyrus|10878        CCCGTGAATGAGACCCTCGAGGTCATTCTCAGCAGCAACGAATGGATAAAGTCTGAAACG
Myotis_lucifugus|3021          CCCCTTAATGAGACCCTTAAGGCCCTTCTCAGCAGTAACGAGTGGGTGAAGTCCGAGAAG
Cavia_porcellus|6308           CCCGTGCCCGAGACCCTCAAGGTCCTCCTGAGCGGCAGCGAGTGGGCACAGTCGGAGAAG
Canis_familiaris|23275         CCCATTAATGAGACCCTCAAGGTCCTTCTCAGCAGCAGCGAGTGGATCAAGTCTGAAAAG
Mus_musculus|42855             CCTGTTCACGAGAGCCTCAAGGGGTTCCTGAGCAGTGGTGAGTGGGTGAAGTCAGAGAAG
Rattus_norvegicus|17390        CCTGTTCACGAGAGCCTCAAGGGTCTCCTGAGCAGTGGTGAGTGGGCGAAGTCTGAGAAG
Felis_catus|10871              CCCGTTAACGAGACCCTCAAGGTCTCGCTCAGCAGCAGCGAGTGGGTGAAGTCTGAGAAG
Equus_caballus|18610           CCCGTTAATGAGACCCTTAAGGCCCTTCTCAGCAGCAACGAGTGGGTGCAGTCCGAGAGG
Callithrix_jacchus|9355        ------------------------------------------------------------
Pongo_abelii|10961             CCCATTAATGAGACCCTCAAGCTCCTCCTCAGCAGCAGCGAGTGGGTGCAGTCGGAGAAG
Rhesus_macaque|25536           CCCACTAACGAGACCCTCAAGCTCCTCCTCGGCAGCAGCGAGTGGGTGCAGTCGGAGACC
Homo_sapiens|32504             CCCATTAACGAGACCCTCAAGCTCCTCCTCAGCAGCAGCGAGTGGGTGCAGTCGGAGAAG
Pan_troglodytes|14856          CCCATTAACGAGACCCTCAAGCTCCTCCTCAGCAGCAGCGAGTGGGTGCAGTCGGAGAAG
Gorilla_gorilla|29937          CCCATTAACGAGACCCTCAAGCTCCTCCTCAGCAGCAGCGAGTGGGTGCAGTCGGAGAAG
Apis_mellifera|35463           GATATAGCTTTTGGTTTAAAAAAAATTTTGAATAATTCATTATGGACTCATAATATTAAA
Linepithema_humile|8515        GAGATAGTATCAGTCCTGAAAAAAGTTCTCAGTACTTCATTATGGACAGGAGATAAGCAG
Pogonomyrmex_barbatus|2952     AATGTGGTACCAACCTTAAGAAAGACTCTACACACTTCATTATGGACAGAGGATAAACAG
                                                                                           

Nematostella_vectensis|27223   ATCATAGACTGTATCAAGGCCCCTTTAATGAGGCTGGGAACGAGA---TATTTGTATGAA
Caenorhabditis_elegans|10573   CAGCTCAATGCAATCCAGCACATTTTGATGTACGCGTGTGCTCAT---TATCTTTGTAAT
Daphnia_pulex|24329            AAAGCTAAATTGATGGAAAATCCCTTAATGCGTCTCTGTGCTCAT---TATCTGTTTGTG
Branchiostoma_floridae|42309   ATGGTGGAGGTACTGAAGGATCCACTTATGAGATTATGTGCA------------------
Ixodes_scapularis|8636         CTGGTGCAGCGGTTGGAAGCACCTCTCATGCGCCTGTGTGCCTTC---TACCTCTACCAC
Pediculus_humanus|8030         TTAGTTTCGCTTCTAGAGAAACCATTGATGAGGCTTTGTGCTCGA---TATCTATTTATT
Nasonia_vitripennis|4128       TTATCGTCAACTTTGCGAGAACCGATGTTGCGAGCTTGCGCATTC---TATTTATACAAA
Danio_rerio|11244              CTGGTTCGTGCTTTGGAGCCTGCGCTCATGCGGCTCTGTGCTTGG---TATCTGTTTGGT
Gasterosteus_aculeatus|23283   ---------------------------ATGCGCCTGTGTGCCTGG---TACCTGTACGGG
Oryzias_latipes|18991          CTAAGCGGTGTGCTGGAGCCCGTCCTGATGCGTCTTTGCGCCTGG---TACCTGTACGGG
Fugu_rubripes|21650            CTGTCCAGAGTTTTGGAGCCCGTCCTAATGCGCCTCTGCGCCTGG---TACCTCTACGGG
Tetraodon_nigroviridis|4258    CTGTCCCGAGTCCTGGAGCCCGCCCTGATGCGTCTCTGCGCCTGG---TACCTCTACGGG
Xenopus_tropicalis|2763        CTTGTGAATGCTTTAGAGACACCTCTTATGCGGCTTTGTGCTTGG---TACCTGTATGGA
Erinaceus_europaeus|216        CTGTCCAGGGCACTGCAGGCCCCCCTGATGCGGCTCTGTGCCTGG---TACCTGTATGGG
Dasypus_novemcinctus|4090      CTGGTGCGGGCGCTGCAGGCCCCGCTGATGCGGCTCTGCGCCTGG---TACCTGTACGGA
Otolemur_garnettii|9673        CTGGTGCGGGCGCTGCAGACCCCGCTGATGCGGCTGTGCGCCTGG---TACCTGTATGGG
Monodelphis_domestica|5421     CTGGTCAAGGTGTTACAATCCCCTTTGATGAGACTCTGTGCTTGG---TATTTATATGGA
Macropus_eugenii|821           CTGGTCAAAATGTTCGAATTTCCTTTGGTGAGATTT------TGGGGTTACTTATGTGGA
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      CTGGTCCGGGCGCTACAGGCACCGCTCTTGAGGCTGTGCGCCTGG---TATTTGTACGGG
Gallus_gallus|4163             TTAGTCAACGCGCTCCATTCACCGCTTATGAGACTGTGTGCCTGG---TATTTGTATGGG
Taeniopygia_guttata|17863      ---------------------------ATGAGACTCTGTGCCTGG---TACTTGTATGGG
Taeniopygia_guttata|1636       CTGAGTGAGGTGCTGCATTCCCCCCTGATGAGACTCTGTGCCTGG---TACTTGTATGGG
Tupaia_belangeri|14197         CTGGTCAGGGCGCTGCAGGCCCCGCTGATGAGGCTCTGCGCCTGG---TACCTGTACGGG
Microcebus_murinus|7543        CTGGTCCGGGCGCTGCAGGCCCCGCTTATGCGGTTGCGCCCTTGG---TACCTGTAC---
Procavia_capensis|12495        CTGGTGCGGACGCTGCAGGCGCCCTTGATGAGACTTTGTGCCTGG---TACTTGTACGGT
Echinops_telfairi|15061        ------------------------------------------------------------
Bos_taurus|8430                CTGGCGCGGGCACTGCAAGCCCCGCTGATGCGGCTGTGCGCCTGG---TACCTGTACGGG
Tursiops_truncatus|9453        CTGGTCCGGGCGCTCCAGGCCCCCCTGATGCGGCTCTGCGCCTGG---TACCTGTACGGG
Dipodomys_ordii|10310          CTGGTTTGCGCGCTGCAGGCGCCCCTCATGAGGCTGTGTGCCTGG---TACCTGTACGGT
Loxodonta_africana|22105       CTGGTGCGGACACTGCAGGCGCCCTTGATGAGGCTCTGTGCCTGG---TACTTGTATGGC
Ornithorhynchus_anatinus|23986 ---------------------------ATGCGGCTCTGTGCCTGG---TACCTGTTCGGG
Ochotona_princeps|16626        CTGGTCCGGGCGCTGCAGGCACCCCTGATGAGGCTGTGCGCCTGG---TACCTGTATGGA
Pteropus_vampyrus|10878        CTGGTCAGGGTGCTGCAGGCCCCCCTGATGAGGCTCTGTGCCTGG---TACCTGTACGGA
Myotis_lucifugus|3021          CTGGCCAAGGCGCTCCAGGCCCCCTTGATGAGGCTCTGTGCCTGG---TACCTGTATGGA
Cavia_porcellus|6308           CTGGTGCAGGCGCTCCAGGCGCCGCTGATGCGGCTCTGCGCTTGG---TACCTGTACGGC
Canis_familiaris|23275         CTGGTCAGGGCACTCCAGGCCCCTTTGATGAGGCTCTGTGCGTGG---TACTTATTTGGA
Mus_musculus|42855             CTGACGCAGGCGCTGCAGGGGCCACTAATGAGGCTGTGTGCCTGG---TACCTGTACGGT
Rattus_norvegicus|17390        CTGGCACAGGCACTGCAGGGGCCACTGATGAGACTGTGTGCCTGG---TACCTTTACGGT
Felis_catus|10871              CTGGTCAGGGTGCTGCAGGCCCCCTTGATGAGGCTCTGTGCCTGG---TACTTGTACGGG
Equus_caballus|18610           CTGGTGAGGGCGCTGCAGGCCCCCTTGATGCGGCTCTGCGCGTGG---TACCTCTATGGG
Callithrix_jacchus|9355        ------------------------------------------------------------
Pongo_abelii|10961             CTGGTGCGGGCGCTGCAGACTCCGCTGATGAGGCTGTGCGCCTGG---TACCTGTATGGA
Rhesus_macaque|25536           CTGGTGCGGGCGCTGCAGACTCCGCTCATGAGGCTGTGCGCCTGG---TACCTGTATGGA
Homo_sapiens|32504             CTGGTGCGGGCGCTGCAGACTCCGCTGATGAGGCTGTGCGCCTGG---TACCTGTATGGA
Pan_troglodytes|14856          CTGGCGCGGGCGCTGCAGACTCCGCTGATGAGGCTGTGCGCCTGG---TACCTGTATGGA
Gorilla_gorilla|29937          CTGGTGAGGGCGCTGCAGACTCCGCTGATGAGGCTGTGCGCCTGG---TACCTGTACGGA
Apis_mellifera|35463           ATAAGTGAAGTTTTAAAAAAGCCATTACTTCGAGCATGTGCTTGG---TATTTATATAAA
Linepithema_humile|8515        TTGTCAGAATTTTTGAAAGATCCATTACTCCGAGCATGTGCTTGG---TACTTGTACAAA
Pogonomyrmex_barbatus|2952     TTATCAACATTTTTAAAAGAGCCATTACTCCGTGCATGTGCATGG---TACTTGTATAAA
                                                                                           

Nematostella_vectensis|27223   GAAAAAAGAAGAGGTTTTGCTTTTGATCAAGTC---------------------GGGGCC
Caenorhabditis_elegans|10573   GCAAAACGAAATGGAATGGCTTTAAATTCAGTTGCAAACTTCCACATTAGAAACGGCGCA
Daphnia_pulex|24329            GAGAAGAGGCGAGGTTTCGCATTGGACAGTGTTGCTAATTTTCATTTGCGTAATGGAGCC
Branchiostoma_floridae|42309   ------------------------------------------------------------
Ixodes_scapularis|8636         GAGAAGAGGCGCGGCTATGCGCTCAACGGCGTTGCAAATTTCCATCTAAAGAATGGTGCC
Pediculus_humanus|8030         GAAAAGAGAAGAGGTTATGCTTTTGATAGTGTGGCAAACTTTCATTTGAAAAATGGTGCA
Nasonia_vitripennis|4128       GAAAAACGGCGAAATTATGCTCTAAATAATGTTGCTAATTTTCATCTTCGAAATGGAGCC
Danio_rerio|11244              GAAAAACGACGAGGGTACGCTCTCAACCCCGTAGCCAACTTTCACCTTCAGAACGGCGCC
Gasterosteus_aculeatus|23283   GAGAAGAGGCGCGGCTACGCTCTCAACCCGGTGGCCAACTTCCACCTGCAGAACGGCGCC
Oryzias_latipes|18991          GAAAAGAGGCGGGGCTACGCTCTCAACCCGGTGGCCAACTTCCACCTGCAGAACGGGGCC
Fugu_rubripes|21650            GAGAAGAGGCGAGGCAGCGCCCTCAACCCTGTTGCGAACTTTCACCTGCAGAACGGCGCC
Tetraodon_nigroviridis|4258    GAGAAGAGGCGGGGCTACGCCCTCAACCCCGTCGCAAACTTTCACCTGCAGAACGGCGCG
Xenopus_tropicalis|2763        GAAAAGCATCGAGGCTTTGCCCTAAATCCAGTTGCTAACTTTCATCTTCAAAATGGCGCC
Erinaceus_europaeus|216        GAGAAGCACCGAGGCTATGCCCTGAACCCTGTGGCAAACTTCCACCTGCAGAATGGGGCC
Dasypus_novemcinctus|4090      GAGAAGCACCGCGGCTACGCCCTGAACCCCGTCGCCAACTTCCACCTGCAGAACGGGGCG
Otolemur_garnettii|9673        GAGAAGCACCGGGGCTACGCTCTGAACCCTGTGGCCAACTTCCACCTGCAGAACGGGGCA
Monodelphis_domestica|5421     GAAAAACATCGTGGTTATGCTCTCAACCCCGTGGCAAACTTTCATCTGCAGAATGGGGCA
Macropus_eugenii|821           GAGATGCATCATGGCTATGCCCTCAACCCAGTGACAAACTTTCATCTGCAGAATGAAGCA
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      GAGAAGCACCGTGGCCATGCGCTGAACCCCGTGGCGAACTTCCATCTTCAGAACGGAGCC
Gallus_gallus|4163             GAGAAACACCGTGGCTATGCGCTGAACCCAGTAGCAAACTTTCACCTTCAGAATGGCTCC
Taeniopygia_guttata|17863      GAGAAGCACCGAGGTTATGCCCTCAACCCCGTGGCCAATTTCCACCTGCAGAATGGCTCG
Taeniopygia_guttata|1636       GAGAAGCACCGAGGTTATGCCCTCAACCCCGTGGCCAATTTCCACCTGCAGAATGGCTCG
Tupaia_belangeri|14197         GAGAAGCACCGCGGCTACGCCCTGAACCCCGTGGCCAACTTCCACCTGCAGAACGGCGCC
Microcebus_murinus|7543        GAGAAGCACCGAGGCTACGCCCTGAACCCCGTGGCCAACTTCCCCCTGCAGAACGGGGCG
Procavia_capensis|12495        GAGAAGCACCGTGGCTATGCCCTTAACCCCGTTGCCAACTTTCACCTGCAGAACGGGGCC
Echinops_telfairi|15061        ------------------------------------------------------------
Bos_taurus|8430                GAGAAGCACCGGGGCTACGCGCTCAACCCCGTGGCCCACTTCCACCTGCAGAACGGGGCC
Tursiops_truncatus|9453        GAGAAGCACCGGGGCTACGCCCTGAACCCCGTGGCCAACTTCCACTTGCAGAACGGGGCC
Dipodomys_ordii|10310          GAGAAGCACCGCGGCTACGCCCTGAACCCTGTGGCCAACTTCCACCTGCAGAACGGGGCC
Loxodonta_africana|22105       GAGAAGCACCGTGGTTACGCCCTCAACCCTGTCGCCAACTTCCATCTACAGAACGGGGCT
Ornithorhynchus_anatinus|23986 GAGAAGCACCGAGGCTTCGCCCTCAACCCCGTGGCCAACTTTCACCTGCAGAACGGCGCC
Ochotona_princeps|16626        GAGAAGCACCGTGGCTATGCCCTCAACCCCGTGGCCAACTTCCACCTGCAGAACGGGGCC
Pteropus_vampyrus|10878        GAGAAACACCGGGGCTACGCCCTGAACCCCGTGACACACTTCCACCTGCAAAATGGGGCT
Myotis_lucifugus|3021          GAGAAACACCGGGGCTACGCCCTGAACCCCGTGGCAAACTTCCACCTGCAGAACGGGGCT
Cavia_porcellus|6308           GAGAAGCACCGCGGCTATGCCCTCAACCCCGTGGCCAACTTCCACCTGCAGAACGGGGCC
Canis_familiaris|23275         GAAAAGCACCGGGGCTTTGCCCTGAACCCTGTGGCAAACTTCCACCTGCAGAATGGGGCT
Mus_musculus|42855             GAGAAGCACCGAGGCTACGCCCTCAACCCAGTGGCCAACTTCCATCTGCAGAATGGGGCT
Rattus_norvegicus|17390        GAGAAGCACCGAGGCTACGCCCTCAATCCAGTGGCCAACTTCCACCTGCAGAACGGGGCT
Felis_catus|10871              GAGAAGCACCGGGGCTACGCCCTGAACCCCGTGGCCAACTTCCACCTGCAGAACGGGGCC
Equus_caballus|18610           GAGAAGCACCGCGGCTACGCGCTGAACCCCGTGGCGAACTTCCACCTGCAGAACGGGGCG
Callithrix_jacchus|9355        ------------------------------------------------------------
Pongo_abelii|10961             GAGAAGCACCGCGGCTACGCGCTGAACCCGGTGGCCAACTTCCACCTTCAGAACGGGGCG
Rhesus_macaque|25536           GAGAAGCACCGCGGCTACGCGCTGAACCCCGTGGCCAACTTCCACCTGCAGAACGGGGCG
Homo_sapiens|32504             GAGAAGCACCGCGGCTACGCGCTGAACCCCGTGGCCAACTTCCACCTGCAGAACGGGGCG
Pan_troglodytes|14856          GAGAAGCACCGCGGCTACGCGCTGAACCCCGTGGCCAACTTCCACCTGCAGAACGGGGCG
Gorilla_gorilla|29937          GAGAAGCACCGCGGCTACGCGCTGAACCCCGTAGCCAACTTCCACCTGCAGAACGGGGCG
Apis_mellifera|35463           GAAAAAAGACGAAATTATGCTTTAGATAGTGTTGCAAACTTTCATCTTCGTAATGGAGCT
Linepithema_humile|8515        GAGAAAAGACGCGGTTATGCTTTGAACAATGTCGCTAATTTCCATTTACGCAATGGAGCT
Pogonomyrmex_barbatus|2952     GAAAAAAGACGTGGCTATGCCTTAAATAGTGTCGCTAATTTCCATTTACGCAACGGAGCT
                                                                                           

Nematostella_vectensis|27223   ACCATGTGGCGTCTGAACTGGATGGCTGACACCAGCGCACGGGGCCTGCACAACTCTCTT
Caenorhabditis_elegans|10573   GAGTTGTATAGACTGAATTGGAATGGAGATACGAGTCATAGAGGGATCAATAACAGTTTT
Daphnia_pulex|24329            ATGATGTGGAGACTGAATTGGGCATCCGACCTTTCGCCAAGAGGCCTAAAAAATTCATTT
Branchiostoma_floridae|42309   ------------------------------------------------------------
Ixodes_scapularis|8636         GTAATTTGGAGACTCAACTGGCTTGGAGACATCTCTCCAAGGGGACTTTCAGCATCATGT
Pediculus_humanus|8030         GTTTTATGGAGATTAAACTGGTCTGCTGATCTTTCTCCTAGAGGTTTAGGAAATTCTTGC
Nasonia_vitripennis|4128       GTTATGTGGAGAATAAATTGGATGGCTGATCCATCACCAAGAGGAATGGCAAACAGTTGT
Danio_rerio|11244              ACCATGTGGAGGCTAAACTGGCAAGCCGATACAAGCCCAAGAGGAATCGCCAACTCCTGT
Gasterosteus_aculeatus|23283   ACCATGTGGCGGCTCAACTGGAGCGCCGACACCAGCCCCAGGGGCGTGGCAAACTCCTGC
Oryzias_latipes|18991          ACCATGTGGCGGCTTAACTGGCGCGCTGACACCAGCCCCAGAGGCGTGGCCAACTCTTGT
Fugu_rubripes|21650            ACCATGTGGCGAATCAACTGGCTCGCCGACACTAGCCCCAGGGGCGTGGCCAACTCATGT
Tetraodon_nigroviridis|4258    ACCATGTGGCGGATCAACTGGCTCGCCGACACCAGCCCCAGGGGCGTGGCCAACTCGTGC
Xenopus_tropicalis|2763        GTCTTGTGGCGTCTTAACTGGATGGCTGACACCAGTCCTCGTGGAGGAACTGCTTCCTGT
Erinaceus_europaeus|216        GTGATGTGGCGCATCAACTGGATGGCCGATGCCAGCTTCAAGGGTATCACCAGTTCATGC
Dasypus_novemcinctus|4090      GTGATGTGGCGCATCAACTGGATGGCCGACGCCAGCCTCAAAGGCGTCACGGGCTCCTGC
Otolemur_garnettii|9673        GTGCTGTGGCGCATCAACTGGATGGCCGACACCAGCCTAAAGGGCCTTAGCGGCTCCTGC
Monodelphis_domestica|5421     GTGATGTGGCGGATTAATTGGTTGGCAGATTTGAGTCTCAAAGGCACTACTTCATCATGT
Macropus_eugenii|821           ATAATGTGGCACATCAATTGGTTGGCAGATTTAAGCCTCAAAAAT---------------
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      GTGTTGTGGCGCCTGAACTGGATGGCGGACACGAGCCCTCGGGGCATCTCCGCCTCTTGT
Gallus_gallus|4163             GTGTTGTGGCGGATAAACTGGATGGCAGACACGAGCCCTCGGGGCATTGCTGCTGCCTGT
Taeniopygia_guttata|17863      GTGCTCTGGAGGATCAACTGGATGGGGGACACGAGCCCCAGGGGCATCGGGGCCTCCTGT
Taeniopygia_guttata|1636       GTGCTCTGGAGGATCAACTGGATGGGGGACACGAGCCCCAGGGGCATCGGGGCCTCCTGT
Tupaia_belangeri|14197         GTGCTGTGGCGAATCAACTGGATGGCCGACACCAGCTCCCGGGGCCTCGCGGGCTCCTGC
Microcebus_murinus|7543        GTGATGTGGCGCATCAACTGGATGGCGGACACCAGCCCGAAAGGCCTGAGCGGCTCGTGC
Procavia_capensis|12495        GTGATATGGCGTATTAACTGGATGGGCGACATGAGCCTCAGGGGTATCACTGGGTCCTGT
Echinops_telfairi|15061        ------------------------------------------------------------
Bos_taurus|8430                GTGCTCTGGCGCATCAACTGGCTGGCCGACGTCAGCCTCAAGGGCGTCACGGGCGCCTGC
Tursiops_truncatus|9453        GTGATGTGGCGCATCAACTGGATGGCCGACGTCAGCCTCAAGGGCATCACGGGCTCGTGT
Dipodomys_ordii|10310          GTGCTGTGGCGCATCAACTGGATGGCGGACAGCAGCCCCAGGGGCCTCACCAGCTCCTGT
Loxodonta_africana|22105       GTGATGTGGCGTATCAACTGGATGGCCGACGTGAGCCTCAGGGGCATCACCGGGTCCTGC
Ornithorhynchus_anatinus|23986 GTGATGTGGCGCATCAACTGGATGGCAGACACGAGCTTCAGAGGCATCACCGCGTCTTGC
Ochotona_princeps|16626        GTGCTGTGGCGGATCAACTGGATGGCCGACAGCAGCCTGCGCGGCCTCACGGGCTCCTGC
Pteropus_vampyrus|10878        GTGATGTGGCGCATCAACTGGATGGCCGATGTCAGCCTCAAGGGCATCACTGGCTCATGT
Myotis_lucifugus|3021          GTGATGTGGCGCATCAACTGGATGGCAGACCTCAGCTTC---GGCATCACTGGCTCGTGT
Cavia_porcellus|6308           GTGATGTGGCGCATCAACTGGATGGGCGACAGCAGCCCCCGGGGCCTCACCAGCTCGTGC
Canis_familiaris|23275         GTGATCTGGCGCATCAACTGGATGGCCGATGTGAGCCTCAAGGGCATCACTGGCTCCTGC
Mus_musculus|42855             GTGATGTGGCGTATCAACTGGATGGCTGACAGCAGCCTCAAAGGCCTCACCAGCTCATGC
Rattus_norvegicus|17390        GTGATGTGGCGTATCAACTGGATGGCTGACAGCAGCCTCAAAGGCCTCACCAGCTCGTGC
Felis_catus|10871              GTGCTGTGGCGCCTCAACTGGCTGGCCGACACGAGCCTCAAGGGCGTCGCCGGCTCCTGC
Equus_caballus|18610           GTGATGTGGCGCCTCAACTGGATGGCCGACGCCAGCCTCAGGGGCATCTCCAGCTCCTGC
Callithrix_jacchus|9355        ------------------------------------------------------------
Pongo_abelii|10961             GTGTTATGGCGCATCAACTGGATGGCGGATGTGAGCCTCAAAGGCATCACCGGCTCCTGC
Rhesus_macaque|25536           GTGCTGTGGCGCATCAACTGGATGGCGGATGTGAGCCTCAAAGGCATCACCGGCTCCTGC
Homo_sapiens|32504             GTGCTGTGGCGCATCAACTGGATGGCGGATGTGAGCCTCAGAGGCATCACCGGCTCCTGC
Pan_troglodytes|14856          GTGCTGTGGCGCATCAACTGGATGGCGGATGTGAGCCTCAGAGGCATCACCGGCTCCTGC
Gorilla_gorilla|29937          GTGCTGTGGCGCATCAACTGGATGGCGGATGTGAGCCTCAGAGGCATCACCGGCTCCTGC
Apis_mellifera|35463           GTTATGTGGAGAATAAATTGGTTGGCTGATCCTTCACCACGTGGTGTTGGAAACAGTTGT
Linepithema_humile|8515        ATGATGTGGCGAATAAACTGGATGGCTGATCCTTCACCGCGTGGAGTAGCGAATAGTTGC
Pogonomyrmex_barbatus|2952     GTAATGTGGCGAATAAATTGGATGGCCGATCCTTCACCACGTGGAGTAGCAAATAGTTGC
                                                                                           

Nematostella_vectensis|27223   GGACTAATGGTCAACTATAAGTACGTTCTTGAGGACGTGGATAATAACAATCAGCAGTAC
Caenorhabditis_elegans|10573   GGAATTATGGTAAACTACAGATACGATTTGGAGAAGGTTCACGAGAACAGTGCAGCTTAC
Daphnia_pulex|24329            GGTCTGATGATGAACTATAGGTATTATGTGGATGCTTGTGAAAAATATAGTCAACTGTAT
Branchiostoma_floridae|42309   ------------------AGATATTTCCTGGGGGACACGATGAGGAACAGCCAGCGCTAC
Ixodes_scapularis|8636         TCCATCATGGTCAACTACAGGTACTACCTGGATGAAATGGAGACGAACAGACAGAAATAT
Pediculus_humanus|8030         AGTATGATGGTGAATTACAGATATTTTTTAGAAGATACTGAATCCAATAGTAGAGCTTAC
Nasonia_vitripennis|4128       GGTATCATGGTTAATTACAGATACTTTTTAGATGAGACTGAGTTAAACAGCAGAAACTAT
Danio_rerio|11244              GGAATAATGGTCAATTATCGCTACTTTTTGCAAGAGACTGGCACTAACAGCATCGCTTAC
Gasterosteus_aculeatus|23283   GGCATCATGGTGAACTATCGCTACTTCCTGAACGAGACGTCCAAAAACAGCGCCCTCTAC
Oryzias_latipes|18991          GGGATCATGGTGAACTATCGTTATTTCCTGAACGAGACATCCAAGAACAGCGCCCTCTAC
Fugu_rubripes|21650            GGCATCATGGTTAACTATCGTTATTTCCTGAATGACACGTCAAAGAACAGTGCTCTTTAT
Tetraodon_nigroviridis|4258    GGCATCATGGTGAACTATCGTTATTTCCTGAACGACACGTCAAAGAACAGCGTTCTTTAC
Xenopus_tropicalis|2763        GGAATGATGGTGAATTATCGCTACTTTCTGGAAAACACAAGCGCAAACAGTGCTAAATAC
Erinaceus_europaeus|216        AGCCTGATGGTCAACTACCGCTACTTCCTAGAGGAAACAGCCTCCAACAGCACTTCCTAC
Dasypus_novemcinctus|4090      GGGCTGATGGTCAACTACCGCTACTACCTGGAGGAGACGGCGGCCAACAGCACTGCCTAC
Otolemur_garnettii|9673        GGCCTGATGGTCAACTACCGCTACTACCTGCATGAGACGGGCTCCAACAGTACCGCCTAC
Monodelphis_domestica|5421     GGGATGATGGTCAATTATCGATATTTCTTAGAAGAAACTGGCGTCAACAGTGCTGCATAC
Macropus_eugenii|821           ------------------CACTATTTATTAGAGGAAACTGCTGTGAACAGTGCTGCG---
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      GGCATGATGGTCAACTATCGCTACGTTTTGGAGGACACAGCTAGCAACTCTGCCGCTTAC
Gallus_gallus|4163             GGCATGATGGTGAACTACCGGTACTTCTTGGAGGATACAGCCAGTAACAGTGCAGCCTAC
Taeniopygia_guttata|17863      GGCATGATGGTCAACTACAGGTATTTCCTGGAGGAGACAGCCTCCAACAGTGCCCTGTAC
Taeniopygia_guttata|1636       GGCATGATGGTCAACTACAGGTATTTCCTGGAGGAGACAGCCTCCAACAGTGCCCTGTAC
Tupaia_belangeri|14197         GGCCTGATGGTCAACTACCGCTACTACCTGGAGGAGACGGGCCCCAACAGCACCGCCTAC
Microcebus_murinus|7543        GGCCTGATGGTCAACTACCGCTACTACCTGGACGAGACGGGCCCCAACAGCACCGCCTAC
Procavia_capensis|12495        GGCCTGATGGTCAACTACCGCTACTACCTGGAGGAGACAGCCACCCACAGCACTGCCTAC
Echinops_telfairi|15061        ------------------------------------------------------------
Bos_taurus|8430                GGCCTGATGGTCAACTACCGCTACTTCCTAGAGGACACGGCCGCCAACAGCACCGCCTAC
Tursiops_truncatus|9453        GGCCTCATGGTCAATTACCGCTACTTCCTGGAGAACACGGCCACCAACAGGACCACCTAC
Dipodomys_ordii|10310          GGCCTCATGGTCAACTACCGCTACTTCCTGGAGGAGACGAGCACCAACAGCGTGGCCTAC
Loxodonta_africana|22105       GGCCTAATGGTCAACTACCGCTACTACCTGGAGGAGACGGCCACCAACAGCACTGCCTAT
Ornithorhynchus_anatinus|23986 GGGTTGATGGTCAATTACCGATACTTCTTGGAGGAAACAGCCACCAACAGTGCCGCTTAC
Ochotona_princeps|16626        GGCCTCATGGTCAACTACCGCTATTTCCTGGAGGAGACGGCGCCCAACAGCACCGCCTAC
Pteropus_vampyrus|10878        GGCCTGATGGTCAACTACCGATACTTCCTGGAGGAACTGGCCACCAACAGCACCAGCTAC
Myotis_lucifugus|3021          GGCATGATGGTCAACTACCGGTACTTCCTGGAGGAGACGGCCACCAACAGCACCTCCTAC
Cavia_porcellus|6308           GGCCTCATGGCCAACTACCGCTACTTCCCGGAGGAGACGGGCCCCAACAGCACCGCCTAC
Canis_familiaris|23275         GGCCTGATGGTCAACTACCGGTACTACCCAGCAGAGACGGCCACAAACAGCACCAGCTAC
Mus_musculus|42855             GGCCTCATGGTCAACTACCGCTACTACCTGGAGGAGACAGGCCCCAACAGTATCTCCTAC
Rattus_norvegicus|17390        GGCCTCATGGTCAACTACCGTTACTACCTGGAGGAGACCGGCCCCAACAGCATCTCCTAC
Felis_catus|10871              GGCCTGATGGTCAACTACCGGTACTACCCGGAGGAGACGGCCGCCAACAGCACCAGCTAC
Equus_caballus|18610           GGCCTGATGGTCAACTACCGCTACTACCTGGAGGACACGGCCATCAACAGCACCGCCTAC
Callithrix_jacchus|9355        ------------------------------------------------------------
Pongo_abelii|10961             GGCCTGATGGCCAACTACCGCTACTTCCTGGAGGAGACAGGCCCCAACAGCACCTCCTAC
Rhesus_macaque|25536           GGCCTCATGGCCAACTACCGCTACTTCCTGGAGGAGACGGGCCCCAACAGCACCTCCTAC
Homo_sapiens|32504             GGCCTGATGGCCAACTACCGCTACTTCCTGGAGGAGACGGGCCCCAACAGCACCTCCTAC
Pan_troglodytes|14856          GGCCTGATGGCCAACTACCGCTACTTCCTGGAGGAGACGGGCCCCAACAGCACCTCCTAC
Gorilla_gorilla|29937          GGCCTGATGGCCAACTACCGCTACTTCCTGGAGGAGACGGGCCCCAACAGCACCTCCTAC
Apis_mellifera|35463           GGAATTATGGTAAACTATAGATACTATCTACATGAATGTGAAAAACATAGTCAAAATTAT
Linepithema_humile|8515        GGTATAATGGTCAATTAT------------------AGTAATCACAGAAGAAGAGTATGG
Pogonomyrmex_barbatus|2952     GGTATAATGGTCAATTATAGATATTTTCTACAAGATTCTGAAAGAAACAGTCGAAATTAT
                                                                                           

Nematostella_vectensis|27223   TTGCTCAACGGGACTATAGCCGCGTCCAAACCCTTCCTTGAAATACTGGACTCGGAG---
Caenorhabditis_elegans|10573   ACTGAACACAAAAAGATGGCGATTAATCAGAAAGTTTTGGATATCTTC------------
Daphnia_pulex|24329            GCTGAAAAACAGCATATCGAGTCTTCAGAGCAAATT---CGTCTCCTTTCGGGAGTTTCC
Branchiostoma_floridae|42309   ATGGAGGAACAGCACATCGAGGCCTCCCAGCAGGTCATCGACCTCGCACAGGCTGCAGGG
Ixodes_scapularis|8636         CTCGAGCATTTCACCGTCCCTGCCTCGGACATCTTCCTTGAGCACCTGAAGCCTTTA---
Pediculus_humanus|8030         TTAGAAAATTTTAGTATTCCAGCATCTGAACAAATATTAAATTTAGCTGAACAAGCTAAA
Nasonia_vitripennis|4128       ATAGAAAAATATCACATCAAAGCTTCTAACACTGTAATTCATTTAGCAAACGAAGCT---
Danio_rerio|11244              CTGCACAATAAAGTCATCAAGGCCTCGGAGCAGGTGCTGGGACTGGTGTCACAATTT---
Gasterosteus_aculeatus|23283   CTGCAGAACAAGGTCATCAGTGCGTCGGAGCAGCTGGTGGGGCTGGTGTCCCAGTTT---
Oryzias_latipes|18991          CTTCAAAACAAAGTGGTCACGGCTTCAGAACAGGTGCTGGGACTGGTCTCCCAGTTT---
Fugu_rubripes|21650            CTGCAGAACAAGGTTGTCACGGCTTCGGAGCAGGTTTTGGGACTGGTGTCGCAGTTT---
Tetraodon_nigroviridis|4258    CTGCAGAATAAGGTCGTCACGGCTTCGGAGCAGGTTCTGGGACTCGTGTCGCAGTTT---
Xenopus_tropicalis|2763        TTGAGAATGAAACACATAGAGGCCTCTGATCAAGTCCTGAATCTGGTGTCTAAGATG---
Erinaceus_europaeus|216        CTCAGCTCAAAGAACATCAAGGCTTCAGAGCAGGTGCTCAGCCTGGTGGCCCAGTTT---
Dasypus_novemcinctus|4090      CTGGGCTCCAAGAACATCAAAGCGTCCGAGCAGGTGCTCAGCCTCGTGGCCCAGTTC---
Otolemur_garnettii|9673        CTGGGCTCCAGGAACATCAAGGCCTCCGAGCAGGTGCTCAGCCTGGTGGCCCAGTTC---
Monodelphis_domestica|5421     CTAGGAGCCAAGAATATCAAAGCTTCTGAACAGGTTCTAAATTTAGTTTCTCAGTTT---
Macropus_eugenii|821           CTAGAAGTCAAGAATTTCAATGCTTCTGAGCAAGTTCCAAATTTAGTTTCTCGGTTT---
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      CTCGGATCGAAGCACATTGAGGCCTCGGAGCAGGTCCTCTCCTTGGTCGCTCAGTTC---
Gallus_gallus|4163             CTGGGGACAAAAGCCATTAAAGCCTCAGAGCAGGTTCTTTCCTTGGTGTCGCAGTTC---
Taeniopygia_guttata|17863      CTGGGCTCCAAGCAGGTCAGAGCCTCCGAGCAGGTGCTGGCCTTGGTGGCCCAGTTC---
Taeniopygia_guttata|1636       CTGGGCTCCAAGCAGGTTAGAGCCTCCGAGCAGGTGCTGGCCTTGGTGGCCCAGTTC---
Tupaia_belangeri|14197         CTGGGCTCCAAGCACATCAAAGCTTCCGAGCAGGTCCTCAGCCTGGTGGCCCAGTTT---
Microcebus_murinus|7543        CTCGGCTCCAAGAGCATCAAGGCCTCCGAGCAGGTCCTCAGCCTGGTGGCCCAGTTC---
Procavia_capensis|12495        CTGGGCTCAAAGCACATCATGGCCTCTGAGCAGGTCCTCAGCTTGGTGTCCCAGTTC---
Echinops_telfairi|15061        ------------------------------------------------------------
Bos_taurus|8430                CTCGGCTCCAAGAGCATCAAGGCCTCCGAGCAGGTCCTCAGCCTGGTGGCGCAGTTC---
Tursiops_truncatus|9453        CTCAGCTCCAAGAGCATCAAAGCTTCCGAGCAGGTCCTCAGCCTGGTGGCCCAGTTT---
Dipodomys_ordii|10310          CTGGGCTCCAAGACCATCAAAGCTTCCGAGCAGGTCCTGGGCCTGGTGGCCCAGTTC---
Loxodonta_africana|22105       CTGGGCTCAAAGCACATCAAAGCCTCTGAGCAGGTCCTCAGCCTGGTGTCCCAGTTC---
Ornithorhynchus_anatinus|23986 CTGGGGACACAGCACATCAAAGCTTCTGAGCAGGTTCTAAACTTAGTGTCTCAGTTT---
Ochotona_princeps|16626        CTCAGCTGTAAGACCATCAAGGCCTCCGAGCAGGTCCTTAGCCTGGTGGCCCAGTTC---
Pteropus_vampyrus|10878        CTCAGCTCAAAGAACATCAAAGCTTCCGAGCAGGTCCTCAGCCTGGTGGCCCAGTTC---
Myotis_lucifugus|3021          CTCGGCTCAAAGAACATCAAGGCTTCTGAGCAGGTCCTCAACCTGGTGGCCCAGTTC---
Cavia_porcellus|6308           CTGGGCAGCAAGAGCATCAAAGCTTCCGAGCAGGTCCTCAGCCTGGTGGCCCAGTTC---
Canis_familiaris|23275         CTCTGCTCAAAGAACATCAAAGCTTCCGAGCAGGTCCTCAGCCTTGTGGCCCAGTTT---
Mus_musculus|42855             CTGGGCTCCAAGAACATCAAAGCTTCCGAGCAGATCCTCAGCCTGGTAGCCCAGTTC---
Rattus_norvegicus|17390        CTGGGCTCCAAGAACATCAAAGCTTCCGAGCAGATCCTCAGCCTGGTAGCCCAGTTC---
Felis_catus|10871              CTCTGCGCCAAGAACATCAAGGCTTCCGAGCAGGTGCTCAGCCTCGTGGCCCAGTTT---
Equus_caballus|18610           CTCGGCTCCAAGACCATCAAAGCTTCCGAGCAGGTCCTCAGCCTGGTGGCCCAGTTT---
Callithrix_jacchus|9355        ------------------------------------------------------------
Pongo_abelii|10961             CTCGGCTCCAAGAACATCAAAGCCTCTGAGCAGGTCCTCAGCCTAGTGGCCCAGTTT---
Rhesus_macaque|25536           CTCAGCTCCAAGAACATCAAAGCCTCTGAGCAGGTGCTCAGCCTAGTGGCCCAGTTT---
Homo_sapiens|32504             CTCGGCTCCAAGATCATCAAAGCCTCTGAGCAGGTCCTCAGCCTAGTGGCCCAGTTT---
Pan_troglodytes|14856          CTCGGCTCCAAGATCATCAAAGCCTCTGAGCAGGTCCTCAGCCTAGTGGCCCAGTTT---
Gorilla_gorilla|29937          CTCGGCTCCAAGAACATCAAAGCCTCTGAGCAGGTCCTCAGTCTAGTGGCCCAGTTT---
Apis_mellifera|35463           ATTGAAAATTATTTTATAAATGCTTCTGAAGATATAATTAATCTCTCAACACAGTAT---
Linepithema_humile|8515        AGAAACAATTGGAAAGTGCAATCATGT---------------------------------
Pogonomyrmex_barbatus|2952     ATCGAACACTTTGTTATAAATGCTTCAGAAAAT---------------------------
                                                                                           

Nematostella_vectensis|27223   ---------------ACACCTGGGAATACAGCTCGTGTGGAA------------------
Caenorhabditis_elegans|10573   ------------------------------------------------------------
Daphnia_pulex|24329            AACTCGTCAGCAGCTAGCCAAATTTCT------CATTTG---------------------
Branchiostoma_floridae|42309   GGGGCGGACAGTCCAGCTGGGAAGAGT------AATCTG---------------------
Ixodes_scapularis|8636         ---------------CAGTCCTCGCTA---------------------------------
Pediculus_humanus|8030         CAAAAAATAGTATGCAATAGTGACAGTTGGAAATATTTA---------------------
Nasonia_vitripennis|4128       ---------------GAAAAGTTCTTT------TCTACCAAAGTTGCAACTGCCAAAGAA
Danio_rerio|11244              ---------------CAGAGGAACAGC------AAACTC---------------------
Gasterosteus_aculeatus|23283   ---------------CAGAAGAGCAGC------AAACTT---------------------
Oryzias_latipes|18991          ---------------CAGAAGAACAGC------AAACTG---------------------
Fugu_rubripes|21650            ---------------CAGAAGAACAGC------AAACTG---------------------
Tetraodon_nigroviridis|4258    ---------------CAGAAAAACAGC------AAACTG---------------------
Xenopus_tropicalis|2763        ---------------------AACAGT------AAATTA---------------------
Erinaceus_europaeus|216        ---------------CAGAAGCAAAGC------AAACTA---------------------
Dasypus_novemcinctus|4090      ---------------CAGAGGAACAGC------AAACTC---------------------
Otolemur_garnettii|9673        ---------------CAAAAGAACAGC------AAGCTC---------------------
Monodelphis_domestica|5421     ---------------CAGAAACTTAGC------AAGCTT---------------------
Macropus_eugenii|821           ---------------CAGAAACTTAGT------AAACTT---------------------
Ornithorhynchus_anatinus|23987 ------------------------------------------------------------
Anolis_carolinensis|17353      ---------------CAACAGAATAGC------AAACTT---------------------
Gallus_gallus|4163             ---------------CAGCAGAACAGC------AAGCTT---------------------
Taeniopygia_guttata|17863      ---------------CAGCAGAACAGC------AAGCTG---------------------
Taeniopygia_guttata|1636       ---------------CAGCAGAACAGC------AAGCTG---------------------
Tupaia_belangeri|14197         ---------------CAGAAAAACAGC------AAACTC---------------------
Microcebus_murinus|7543        ---------------CAGAAGAACAGC------AAGCTG---------------------
Procavia_capensis|12495        ---------------CAGAAGAACAGC------AAGCTG---------------------
Echinops_telfairi|15061        ------------------------------------------------------------
Bos_taurus|8430                ---------------CAGAAGAACAGC------AAACTC---------------------
Tursiops_truncatus|9453        ---------------CAGAAGAACAGC------AAACTC---------------------
Dipodomys_ordii|10310          ---------------CAGAAGCACAGC------AAGCTC---------------------
Loxodonta_africana|22105       ---------------CAGAAGAATAGC------AAGCTG---------------------
Ornithorhynchus_anatinus|23986 ---------------CAGAAGAATAGC------AAGCTT---------------------
Ochotona_princeps|16626        ---------------CAGAAGAACAGT------AAACTC---------------------
Pteropus_vampyrus|10878        ---------------CAGAAGAACAGC------AAACTT---------------------
Myotis_lucifugus|3021          ---------------CAGAAGAACAGC------AAACTT---------------------
Cavia_porcellus|6308           ---------------CAGAAGAACAGC------AAGCTC---------------------
Canis_familiaris|23275         ---------------CAGAAGAACAGC------AAACTT---------------------
Mus_musculus|42855             ---------------CAGAACAACAGC------AAACTC---------------------
Rattus_norvegicus|17390        ---------------CAGAGCAACAGC------AAACTC---------------------
Felis_catus|10871              ---------------CACAAGAACAGC------AAACTT---------------------
Equus_caballus|18610           ---------------CAGAAGAACAGC------AAACTT---------------------
Callithrix_jacchus|9355        ------------------------------------------------------------
Pongo_abelii|10961             ---------------CAGAGGAACAGC------AAGCTC---------------------
Rhesus_macaque|25536           ---------------CAGAAGAACAGC------AAGCTC---------------------
Homo_sapiens|32504             ---------------CAAAAGAACAGC------AAGCTC---------------------
Pan_troglodytes|14856          ---------------CAAAAGAACAGC------AAGCTC---------------------
Gorilla_gorilla|29937          ---------------CAAAAGAACAGC------AAGCTC---------------------
Apis_mellifera|35463           ---------------AAA---------------AAATTA---------------------
Linepithema_humile|8515        ------------------------------------------------------------
Pogonomyrmex_barbatus|2952     ------------------------------------------------------------
                                                                                           

Nematostella_vectensis|27223   ------------TGA
Caenorhabditis_elegans|10573   ------------TGA
Daphnia_pulex|24329            ------------TGA
Branchiostoma_floridae|42309   ------------TAG
Ixodes_scapularis|8636         ------------TAA
Pediculus_humanus|8030         ------------TGA
Nasonia_vitripennis|4128       GCAGTGGAAGAA---
Danio_rerio|11244              ------------TGA
Gasterosteus_aculeatus|23283   ------------TGA
Oryzias_latipes|18991          ------------TGA
Fugu_rubripes|21650            ------------TGA
Tetraodon_nigroviridis|4258    ------------TGA
Xenopus_tropicalis|2763        ------------TGA
Erinaceus_europaeus|216        ------------TAA
Dasypus_novemcinctus|4090      ------------TAG
Otolemur_garnettii|9673        ------------TAG
Monodelphis_domestica|5421     ---------------
Macropus_eugenii|821           ---------------
Ornithorhynchus_anatinus|23987 ---------------
Anolis_carolinensis|17353      ------------TGA
Gallus_gallus|4163             ------------TAA
Taeniopygia_guttata|17863      ---------------
Taeniopygia_guttata|1636       ------------TAG
Tupaia_belangeri|14197         ------------TGA
Microcebus_murinus|7543        ------------TAG
Procavia_capensis|12495        ------------TGA
Echinops_telfairi|15061        ---------------
Bos_taurus|8430                ------------TAG
Tursiops_truncatus|9453        ---------------
Dipodomys_ordii|10310          ---------------
Loxodonta_africana|22105       ------------TAA
Ornithorhynchus_anatinus|23986 ------------TGA
Ochotona_princeps|16626        ---------------
Pteropus_vampyrus|10878        ---------------
Myotis_lucifugus|3021          ---------------
Cavia_porcellus|6308           ------------TAG
Canis_familiaris|23275         ------------TAA
Mus_musculus|42855             ------------TAG
Rattus_norvegicus|17390        ------------TAG
Felis_catus|10871              ---------------
Equus_caballus|18610           ------------TAA
Callithrix_jacchus|9355        ---------------
Pongo_abelii|10961             ---------------
Rhesus_macaque|25536           ------------TGA
Homo_sapiens|32504             ------------TGA
Pan_troglodytes|14856          ------------TGA
Gorilla_gorilla|29937          ------------TGA
Apis_mellifera|35463           ------------TGA
Linepithema_humile|8515        ------------TAA
Pogonomyrmex_barbatus|2952     ---------------
                                              

multiple sequence alignment in CLUSTALW format


Nematostella_vectensis|9693   ------------------------------------------------------------
Caenorhabditis_elegans|11183  -----------------------------MLRRYSHFYSIRYSSTLLSTLDGLTNRTSGD
Daphnia_pulex|953             ------------------------------------------------------------
Branchiostoma_floridae|1218   --------------------------------------------MFTATISQM-VTEIIG
Ixodes_scapularis|8650        ------------------------------------------------------------
Pediculus_humanus|7874        MEDDCKYPDIFSNEDFVQRR-------------------------LSTFEDVQVCISLLK
Nasonia_vitripennis|6623      ----MMMKPPSSVFQLPGFLRRCSNLNSFHTKLNTKL------KPHTEGEENA-INKDLE
Danio_rerio|3315              --MTPFHLSTVARSLLKSYRHRAVLKTIHGLRLWDFQSMHPRSSIAGHELMEEILRKTVA
Gasterosteus_aculeatus|17633  ------------------------------------------------------------
Oryzias_latipes|18869         ---RRFS-----------------------------------VRVRASGMEEI-LARVVV
Fugu_rubripes|2781            -------------------------------------------------MDEI-LARIVA
Tetraodon_nigroviridis|4239   WRHRTLLKAVLRASDVGFWRWYSTPLR-----------------GGAPGMDEI-LARVVP
Xenopus_tropicalis|15934      ------------------------------------------------TMDEL-LSRSVP
Erinaceus_europaeus|166       ---MRGLGPSLAARRLIRLWLPTVQPQ---FRLSSGR---PADSSLERAMDEL-LLRAVP
Dasypus_novemcinctus|3617     ---MRGLGPGLAAWRLLPLRLPPRPPA---LRLRSGR--AGPAGALERAMDEL-LRRAVP
Otolemur_garnettii|8326       ------------------------------------------------------------
Monodelphis_domestica|17343   ---MRGLGPGLSAQRLLRLR--PRLPTRPRPRRLGGP-----GATLERAMDEL-LGRTVP
Macropus_eugenii|760          ---MRGLGPGLSAQKLLGLRLRSRLPTRLRLAAWA------PGATLERAMDEL-LGRTVP
Ornithorhynchus_anatinus|4060 ------------------------------------------------------------
Anolis_carolinensis|17136     ------------------------------------------------------------
Gallus_gallus|8520            ---------------------------------GPCRGTAGCGAASDVSMEEL-LSRSVP
Taeniopygia_guttata|5765      ------------------------------------------------------------
Taeniopygia_guttata|7859      ------------------------------------RGPRRLSSGAAPGMEEL-LRRSVP
Tupaia_belangeri|12320        ------------------------------------------------------------
Microcebus_murinus|6389       ------------------------------------------------------------
Procavia_capensis|11690       ---MRGLGPGLTARRFLSLGLPPRLPRLSGARLSSGP--AAAAGALERAMDEL-LRRAVP
Echinops_telfairi|11860       ---MRGLGP--VARSLLLLRLCPRPPG---ARLSYGQ--ATTAGALERAMDEL-LRRAVP
Bos_taurus|10371              ---MRVLGPGLSAGRLLRLRLPPRQPQPPGPRLSSGR--PAAAGALERAMDEL-LHRAVP
Tursiops_truncatus|8933       ------------------------------------------------------------
Dipodomys_ordii|9682          ---MRGLGPGLAARRLLPLRFPPRPPRPPGPRLSSGPPAAAAAGASERAMEEL-LRRAVP
Loxodonta_africana|9480       ---MWGFRPGLTARRFFSLRLLPRPPRPPRARLSSGP--AETVGALERAMDEL-LRRAVP
Ornithorhynchus_anatinus|4059 ------------------------------------------------------------
Ochotona_princeps|14498       ---MRSLGPGLTTRRFLPLRFTQGAPGRTEDQMSSGP----DARAFERPMENL-LCRLFP
Pteropus_vampyrus|10249       ---MLGLRSSLTTRCFLTLRLPLRLPR---LRLLTVQ--A-VVG----AMDEL-LHRAVP
Myotis_lucifugus|2708         ---MRGLGPGLAVRRLLPLRLPPRPPG---PRLSSRP---TVAGALDRAMDEL-LRRAVP
Cavia_porcellus|4929          ---MRGFGPGLTTRNLLPLRFAPRPPRPPGPLLSS--------SSLTRAMDEL-LRRAVP
Canis_familiaris|9383         ---MRGLGPALTARRLFPLRVSSGAAA-------------AAAGAPERAMDEL-LRRAVP
Mus_musculus|40015            ---MRGLGPGLRARRLLPLRSPPRPPGPRGRRLCGGL--------AASAMDEL-LRRAVP
Rattus_norvegicus|13840       ---MRGLGPSLRARRLLPLRYPPRPPGPRGPRLCS--------GLTASAMDEL-LRRAVP
Felis_catus|11977             ------------------------------------------------------------
Equus_caballus|20286          ------------------------------------------------------------
Callithrix_jacchus|2263       ---MRGLGPGLTARRLLPLRFPPRPPG---PRLISGQ----AAGALERAMDEL-LRRAVP
Pongo_abelii|19290            ------------------------------------------------------------
Rhesus_macaque|32845          ---MRGLGPGLTARRLLPLRFTPRPPG---PRLASGQ----ATGALERAMDEL-LRRAVP
Homo_sapiens|39762            ---MRGFGPGLTARRLLPLRLPPRPPG---PRLASGQ----AAGALERAMDEL-LRRAVP
Pan_troglodytes|19752         ---MRGLGPGLTARRLLPLRFPPRPPG---PRLASGQ----AAGALERAMDEL-LRRAVP
Gorilla_gorilla|23175         ---MRGLGPGLTARRLLPLRFPPRPPG---PRLASGQ----AAGALERAMDEL-LRRAVP
Apis_mellifera|2047           ------------------------------------------------------------
Linepithema_humile|14603      ---MFGKLFSELLPVIRRCRFRTELNSVDALKWSIKREYGKSSTLYAETNSALPVDEELQ
Pogonomyrmex_barbatus|13812   ------------------------------------------------------------
                                                                                          

Nematostella_vectensis|9693   ------------------------------------------------------------
Caenorhabditis_elegans|11183  KLLTY-------------SEKFSKLYANSTPET--RKSIFVDLVTNYGVNK---------
Daphnia_pulex|953             ------------------------------------------------------------
Branchiostoma_floridae|1218   PK---EAGLKKPTIPEGKTRHLCDVYNSLSTED--KATFLRVVSQQFGTDHDEVLKAAEG
Ixodes_scapularis|8650        ------------------------------------------------------------
Pediculus_humanus|7874        EVLEYRKKNISSWIVESKVKQLCSFYKCLIKNH--RNEFIQVLSKDYAVNHYKVFQLSET
Nasonia_vitripennis|6623      EIIDFKTRNTSSWVIETKVNSLCLKYNILTKDE--RAKFLSSLATRYAVNHDKICQLA--
Danio_rerio|3315              PLPSYEMRDKSPPPPESNSLEFMHFYKSLEKEQ--RLEFLEKLSHDFGVDHRWASDLA--
Gasterosteus_aculeatus|17633  ------------------------------------------------------------
Oryzias_latipes|18869         PLPSYETRDKSPPPPESNSLEFMHFYRSLDKV---KAEFLTKLSRDHGVDHKGVSELA--
Fugu_rubripes|2781            PLPTYETRDKSPPPPESNSLEFMHFYNGLFKED--KLSFLNKLSQDFGVDHRGVSELA--
Tetraodon_nigroviridis|4239   PLPTYETRDKSPPPPESSSLEFMQFYKSIYKED--KLRFLNKLSQDFGVDHRGVSELAL-
Xenopus_tropicalis|15934      PLPPYETKEKCPAPSEIQSINFMQYYRALDKGD--RASFLGKLATEFGVDHTQVTELSSK
Erinaceus_europaeus|166       AAPPYELREKTPAPAEGQCADFVSFYGGLAAAAE-RAELLGRLARGFGVDHGLVAEQSAG
Dasypus_novemcinctus|3617     QTPAYELREKTPAPAEGQCADFVSFYGGLTEAAE-RAELLGRLARGFGVDHGQVAEQSAG
Otolemur_garnettii|8326       ------------------------------------------------------------
Monodelphis_domestica|17343   QAPAYELREKTPAPAEAQCADFMRFYGALEGASQ-RAELLGRLARGFGVDHGQVAEQSAG
Macropus_eugenii|760          Q-PAYELRDQTPAPAEGQCADFMRFYRSLXXXXX-XAELLSRL-RGFGVDHGQVAEHSAG
Ornithorhynchus_anatinus|4060 ------------------------------------------------------------
Anolis_carolinensis|17136     ---------------ELRGEEFMRCYGALEEAGEARAEVLGRLARDFGVEHGRVAEACAE
Gallus_gallus|8520            PLPPYETKEKAPPPAELRGAEFVRYYRGLPAGPP-RAELLTRLARDFGVDHGRVAEFSAK
Taeniopygia_guttata|5765      ------------------------------------------------------------
Taeniopygia_guttata|7859      PLPPYETKEKAPPPAELRGAEFVRFYRALQPGPP-RAELLSRLARDFGVEHGRVAEAAAK
Tupaia_belangeri|12320        ------------------------------------------------------------
Microcebus_murinus|6389       ---------------------------------------------GFHVDHVQVLEQSDI
Procavia_capensis|11690       ATPVYELREKTPAPAEGQCADFVNFYGGLTDVAE-RAELLRRLAQSFGVDHSQVAEQSAG
Echinops_telfairi|11860       ATPAYELREKTPAPAEGQCADFVSFYGGLGDVAE-RAELLGRLAKGFGVDHGQVAEQSAG
Bos_taurus|10371              AMPAYELREKTPARAENQCADFVSFYGGLAETAE-RAELLGRLARGFGVDHSQVAEQSAG
Tursiops_truncatus|8933       ------------------------------------------------------------
Dipodomys_ordii|9682          PTPTYELREKTPAPAEAQCADFVSFYGGLAELGP-RAELLARLAQGFGVDHGQVAEQSAG
Loxodonta_africana|9480       ATPVYELREKTPAPAEGQCADFVSFYGALAGVAE-RAELLGRLAQGFGVDHSQVAEQSAG
Ornithorhynchus_anatinus|4059 ------------------------------------------------------------
Ochotona_princeps|14498       TL-AYELREKTPAPAEGQCADFVSFYGGLAEVAQ-RAELLGRLAQGFGVDHGQVAEQSAG
Pteropus_vampyrus|10249       ATPSYELREKTPAPAEGQCADFVRFYGGLADAAE-RAELLGRLAQGFGVDHGQVAEQSAG
Myotis_lucifugus|2708         ATPVYELREKTPAPAEGQCADFVSFYGGLTEVAE-RAELLSRLAQGFGVDHGQVAEQSAG
Cavia_porcellus|4929          QTPAYELREKTPAPAEGQCADFVSFYGGLTEATQ-RAELLGRLAQGFGVDHGQVAEQSAG
Canis_familiaris|9383         ATPAYELREKTPAPAEGQCADFVSFYGGLAEAAE-RADLLSRLARGFGVDHGQVAEQSAG
Mus_musculus|40015            PTPAYELREKTPAPAEGQCADFVSFYGGLAEASQ-RAELLGRLAQGFGVDHGQVAEQSAG
Rattus_norvegicus|13840       PTPAYELREKTPAPAEGQCADFVSFYGGLAEAAQ-RAELLGRLAQGFGVDHGQVAEQSAG
Felis_catus|11977             ---------------------------GLAEAAE-RAELLSRLARGFGVDHGQVAEQSAG
Equus_caballus|20286          ------------------------------------------------------------
Callithrix_jacchus|2263       PTPAYELREKTPAPAEGQCADFVSFYGGLAETAE-RAELLGRLARGFGVDHGQVAEQSAG
Pongo_abelii|19290            ------------------------------------------------------------
Rhesus_macaque|32845          PTPAYELREKTPAPAEGQCADFVSFYGGLAETAE-RAELLGRLARGFGVDHGQVAEQSAG
Homo_sapiens|39762            PTPAYELREKTPAPAEGQCADFVSFYGGLAETAQ-RAELLGRLARGFGVDHGQVAEQSAG
Pan_troglodytes|19752         PTPAYELREKTPAPAEGQCADFVSFYGGLAETAQ-RAELLGRLARGFGVDHGQVAEQSAG
Gorilla_gorilla|23175         PTPAYELREKTPAPAEGQCADFVSFYGGLAETAE-RAELLGRLARGFGVDHGQVAEQSAG
Apis_mellifera|2047           ------------------------------------------------------------
Linepithema_humile|14603      EIFQFRDTKISNWIIENKTHALCVRYTESNKED--RQRILRILASQYAVQHNNICQVA--
Pogonomyrmex_barbatus|13812   ------------------------------------------------------------
                                                                                          

Nematostella_vectensis|9693   ---------------------EDRL----RQVLEPHYIQLLSHISRL-EGGVKFIVDMRS
Caenorhabditis_elegans|11183  ---------EALNHAISLYSKNDQMYPEVRTSATASYVNLIKSIGNL-PGGVMQVCEMRA
Daphnia_pulex|953             -----------------MIKAEDNL----RNTLAVEQNWMLSILARQ-EGGIKFLIDIRA
Branchiostoma_floridae|1218   L------PQAKEKSEGALLKAEERL----QAALVPRYHDLFVQIGRL-EGGVKHLVDMRA
Ixodes_scapularis|8650        ---------------------------------------------------------MRE
Pediculus_humanus|7874        LAKCSNISESDAKSDAKILKNEDQL----RTILTPQYSWLFLNIGKL-EKGVKFLVDLRT
Nasonia_vitripennis|6623      ---K-RLACNEPNNPNQLISRERAL----KDALTPPYHWLFARVGRL-EHGVKFLVDLRA
Danio_rerio|3315              ---A-KLLEAQVRDVATILQVEDRL----RYSLTPRYRQLLTHISRV-QGGVKFLVDLRA
Gasterosteus_aculeatus|17633  ------------------------------------------------------------
Oryzias_latipes|18869         ---V-KLLDTQQRDLATILQVEDRL----RYSLTPRYKQLLCHISRV-EGGVKFLVQFAR
Fugu_rubripes|2781            ---L-KLLDTQLRDLATILQAEDRL----RYSLTPRYKQLFNHISKA-EGGVKFLVDLRA
Tetraodon_nigroviridis|4239   -----KLLDTQLRDLATILQAEDRL----RYSLTPRYKQLFNHISKA-EGGVKFLVDLRA
Xenopus_tropicalis|15934      V-----VQAQQKRDMGTVLQVEDRL----RYYLTPQYKVLFSHISKL-EGGMKFLVDLRA
Erinaceus_europaeus|166       V--L-QLR-EQPREAAVLLQAEDRL----RYALVPRYRGLFHHISKL-DGGVRFLVQLRA
Dasypus_novemcinctus|3617     V--L-QLR-QQPREAAVLLQAEDRL----RYALVPRYRGLFHHISKL-DGGVRFLVQLRA
Otolemur_garnettii|8326       ------------------------------------------------------------
Monodelphis_domestica|17343   V--L-RLA-PPPREPGALLHAEDRL----RYALVPRYRGLFQHISKL-EGGVRFLVQLRA
Macropus_eugenii|760          V-----LRLGQRWAAPGLPQAEDRL----RYALVPRYRGLFQHLSKL-EGGVRFLVQLRA
Ornithorhynchus_anatinus|4060 ------------------------------------------------------------
Anolis_carolinensis|17136     VARL-QARGEALGEAGALLQGEGRL----RRLLTPRYRGLFLQLGRKGEGGLRFLVRLRR
Gallus_gallus|8520            V--L-QAR-EQQRELGALLQAEDRL----RYYLNPRYRGLFQHLGRL-EGGLRFLVELRG
Taeniopygia_guttata|5765      ------------------------------------------------------------
Taeniopygia_guttata|7859      V--L-QAR-EQRREPGALLQAEDRL----RYYLSPQYRGLFQQLGRL-EGGLRFLVELRA
Tupaia_belangeri|12320        ------------------------------------------------------------
Microcebus_murinus|6389       V--I-QLH-LQQRKAP-LLQPEDGL----RYALVPRYRGLFHHVSKL-DGGVRFLVRLRA
Procavia_capensis|11690       V--L-QLR-QQPREAAVLLLAEDRL----RYALVPRYRGLFHHISKL-DGGVRFLVQLRA
Echinops_telfairi|11860       V--L-QLR-QHPREPAVLLLAEDRL----RYALVPRYRGLFRNISKL-DGGVRFLVCLRA
Bos_taurus|10371              V--L-QLR-QQPREAAVLLQAEDRL----RYALVPRYRSLFHHISKM-EGGVRFLVRLRA
Tursiops_truncatus|8933       ------------------------------------------------------------
Dipodomys_ordii|9682          L--L-QLR-QQPREAAALLQAEDRL----RHALVPRYRGLFRLIGRL-DGGARFLVRLRA
Loxodonta_africana|9480       V--L-QVR-QQQREAAVLLLAEDRL----RYALVPRYRGLFHHISKL-DGGVRFLVQLRA
Ornithorhynchus_anatinus|4059 ------------------------------------------------------------
Ochotona_princeps|14498       V--L-QLR-QQPREAAVLLQAEDRL----RYALVPRYRGLFHHISKL-DGGVRFLVQLRA
Pteropus_vampyrus|10249       V--L-QLR-QQPREAAVLLQAEDRL----RYALVPRYRGLFHHISKL-DGGVRFLVQLRA
Myotis_lucifugus|2708         V--L-QLR-EQPREAAVLLQAEDRL----RYALVPRYRGLFHHISKL-DGGVRFLVQLRA
Cavia_porcellus|4929          V--L-QLR-EQPREAAVLLQAEDRL----RYALVPRYRGLFHHISKL-DGGVRFLVRLRA
Canis_familiaris|9383         V--L-QLR-EQPREAAVLLQAEDRL----RYALVPRYRGL-HHISKL-DGGVRFLVRLQA
Mus_musculus|40015            V--L-QLR-QQAREAAVLLQAEDRL----RYALVPRYRGLFHHISKL-DGGVRFLVQLRA
Rattus_norvegicus|13840       V--L-QLR-QQSREAAVLLQAEDRL----RYALVPRYRGLFHHISKL-DGGVRFLVQLRA
Felis_catus|11977             V--L-QLR-QQPREAAVLLQAEDRL----RYALVPRYRGLFHHISKL-DGGVRFLVRLRA
Equus_caballus|20286          ------------------------------------------------------------
Callithrix_jacchus|2263       V--L-QLR-QQQREAAVLLQAEDRL----RYALVPRYRGLFHHISKL-DGGVGFLVQLRA
Pongo_abelii|19290            --------QQQPEGGRWLLQAEDRL----RTTLVPRYRGLFHHISKL-DGGVRFLVQLRA
Rhesus_macaque|32845          V--L-QLR-QQQREAAVLLQAEDRL----RYALVPRYRGLFHHISKL-DGGVRFLVQLRA
Homo_sapiens|39762            V--L-HLR-QQQREAAVLLQAEDRL----RYALVPRYRGLFHHISKL-DGGVRFLVQLRA
Pan_troglodytes|19752         V--L-HLR-QQQREAAVLLQAEDRL----RYALVPRYRGLFHHISKL-DGGVRFLVQLRA
Gorilla_gorilla|23175         V--L-HLR-QQQREAAVLLQAEDRL----RYALVPRYRGLFHHISKL-DGGVRFLVQLRA
Apis_mellifera|2047           -----------------MISYERNL----RNVLTPDYQWLFIMIGRL-ENGVKFLVDLRT
Linepithema_humile|14603      ---K-KLVCTEPENERQMINHERTL----KNVLTPAYQWLFVIMGRL-QYGVKFLVDLRT
Pogonomyrmex_barbatus|13812   -----------------MIVHEKTL----KNVLTPAYHWLFVIIGRL-QHGVKFLVDLRT
                                                                                          

Nematostella_vectensis|9693   DLQDGLT-SETQLTARQELQ-ALSTSIKHLLAQWFSVGLLDLQRVTWNSPCSISEKVIRY
Caenorhabditis_elegans|11183  NILALLK-RETDKTTTSYLR-HIELATREVLTSWFSLGNLKLERLTWSSPGDILQKVAEY
Daphnia_pulex|953             DVLSPDA------TNSVVLR-SLSNAIRDLIAPCFGIDMLQLDRVSWSSPGSLLQHVSEG
Branchiostoma_floridae|1218   DTLDLLS----SVKDSAELR-SFSSCLREMLSHWFSAGLLHLQRITWESSCDILQKISEY
Ixodes_scapularis|8650        DLLDLISSSQLESPSSYDVR-HMNTILKELLSLWFTVGFMKLERITWQSSCEMLQKISDY
Pediculus_humanus|7874        DVLELIAEKNSEVDSTVELQ-QLNSTLRDLLSLWFSIGFLQLQRVTWNSPCEMLQKISEY
Nasonia_vitripennis|6623      NVLDLISHCTKDSEDILHLS-QMDATLKQMLFLWFSVGFMKVERVTWQTSCDILQKVSDY
Danio_rerio|3315              DLIEFAS---SKISDSPHMR-DLNSTLKALLSEWFSVGLLRLERITWQSPCEILQKISQY
Gasterosteus_aculeatus|17633  ------------------------------------------------------------
Oryzias_latipes|18869         DLLEMKS--DLSLEEKACFEMDLSGTLKSLLSEWFSVGLLRLERITWQSPCEILQKISQY
Fugu_rubripes|2781            DVLEIIS---SKASESPDIRQDLNGTLKSLLCEWFSVGLLRLERITWKSPCEVLQKISQY
Tetraodon_nigroviridis|4239   DVLEIIS---SKASETPDIR-DLSGTLKSLLCEWFSVGLLRLERITWQSPCEILQKISQY
Xenopus_tropicalis|15934      DILESLA---AKLADGPHIR-EMNGVLKCMLSEWFSVGFLNLERITWQSPCEVLQKISEY
Erinaceus_europaeus|166       DLLEAQA---LKLVEGPHVR-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS
Dasypus_novemcinctus|3617     DLLEAQA---LKLVEGPHV--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS
Otolemur_garnettii|8326       ---------------------EMSGVLKGMLSEWYSAGFLSLERVTWHSSCEVLQKISES
Monodelphis_domestica|17343   DLLEAQA---LKIAEGPHVR-EMNGVLKNMLSDWFSTGFLNLERVTWHSPCEVLQKISEC
Macropus_eugenii|760          DLLEAQA---LKIAEGPHVR-EMNGVLKNMLSDWFSTGFLNLERVTWHSPCEVLQKISEC
Ornithorhynchus_anatinus|4060 -----------------------------MLSEWFSVGFLNLERVTWHSPCELLQKISEC
Anolis_carolinensis|17136     DLLAALG---TTNAPAPHLR-EMNSVLKDMLSEWFSTGFLSLERVTWQSPCEILQKISDS
Gallus_gallus|8520            DLVEGLA---SKAVDGPHVK-EMSGVLKNMLSEWFSTGFLNLERVTWQSPCEVLQKISDS
Taeniopygia_guttata|5765      ------------------------------------------------------------
Taeniopygia_guttata|7859      DLMEGLA---SKAVDGPHVK-EMNGVLKNMLSEWFCTGFLNLERVTWQSPCEVLQKISDS
Tupaia_belangeri|12320        ---------------------EMNGVLKSMLSEWFSSGFLNLERVTWHSPCEVLQKVSXX
Microcebus_murinus|6389       DLLEAQA---LRLVEGPDVR-EMNGVLKGMLSEWFSSGFLNLERVTWHSSCEVLQRVSES
Procavia_capensis|11690       DLLQAQT---LKLVEGPHLR-EMDGVLKSMLSEWFSSGFLNLERVTWHSPCEVLQKISES
Echinops_telfairi|11860       DLLQAQT---LKLLEGPHLR-EMDGVLKSMLTEWFSSSFLNLERVTWHSPCEVLQKISES
Bos_taurus|10371              DLLEAQA---LKLVDGPHVR-EMNGVLKNMLSEWFSSGFLNLERVTWHSPCEVLQRISEA
Tursiops_truncatus|8933       ---------------------EMNGVLKSMFSEWFSSGFLNLERVTWRSPCEMLQKISEA
Dipodomys_ordii|9682          DLLEAQA---LKLVEGPHVR-EMNGVLKAMLSEWFSSGFLNLERVTWHSPCEVLQKISEA
Loxodonta_africana|9480       DLLQAQS---LKLVEGPHVR-EMDGVLKSMLSEWFSSGFLNLERVTWHSPCEVLQKISES
Ornithorhynchus_anatinus|4059 ------------------------------------------------------------
Ochotona_princeps|14498       DLLEAQA---LKLVEGPHVR-EMNGVLKGMLSEWFSSGFLNLERVTWHSSCDVLQRISES
Pteropus_vampyrus|10249       DLLEAQA---LKLVEGPHVR-EMNGVLKGMLSEWFSSGFLNLERVTWHSPCEVLQRVSES
Myotis_lucifugus|2708         DLIEAQA---LKLVEGPHVR-EMNGVLKGMLTEWFSSGFLNLERVTWHSPCEVLQKISES
Cavia_porcellus|4929          DLLEAQA---LKLVEGPHVR-EMNGVLKSMLSEWFSSGFLNLERVTWHSPCEVLQKISES
Canis_familiaris|9383         DLLEAQA---LKLLEGPHVR-EMNGVLKAMLSEWFSSGFLSLERVTWHSPCEVLQKISES
Mus_musculus|40015            DLLEAQA---LKLVEGPHVR-EMNGVLKSMLSEWFSSGFLNLERVTWHSPCEVLQKISEC
Rattus_norvegicus|13840       DLLEAQA---LKLVEGPHVR-EMNGVLKSMLSEWFSSGFLNLERVTWHSPCEVLQKISEC
Felis_catus|11977             DLLEAQA---LKLVEGPHVR-EMNGVLKGMLSEWFSSGFLSLERVTWHSPCEVLQKISES
Equus_caballus|20286          -------------------Q-EMNGVLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISES
Callithrix_jacchus|2263       DLLEAQA---LKLVEGPHVR-EMNGVLKGMLSEWFSSGFLNLERVTWHSPCEVLQRISES
Pongo_abelii|19290            DLLEAQA---LKLVEGPDVR-EMNGVLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEA
Rhesus_macaque|32845          DLLEAQA---LKLVEGPDVR-EMNGVLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEA
Homo_sapiens|39762            DLLEAQA---LKLVEGPDVR-EMNGVLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEA
Pan_troglodytes|19752         DLLEAQA---LKLVEGPDVR-EMNGVLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEA
Gorilla_gorilla|23175         DLLEAQA---LKLVEGPDVR-EMNGVLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEA
Apis_mellifera|2047           DILELIL--KIKDTDESIAIQQLNITLRDLLLLWFSVGFLYLERITWQTSCDILQKISDY
Linepithema_humile|14603      DVLELMS--EVKDSDESIVIQQLNHTLQDLFLLWFSVGFLHMERITWESACDILQKVSDY
Pogonomyrmex_barbatus|13812   DVLELMS--EVKDTDESVIIQQLNHTLQDLFLLWFSVGFFHMERITWESACDILQKVSDY
                                                                                          

Nematostella_vectensis|9693   EAVHPIQGWDDLKRRLAPDRRCYIFTHRSMPQEPIVVLHTALEY----------------
Caenorhabditis_elegans|11183  EAVHPVRGLSDFRKRLGPLRRCFYFSHEALPRNPLVMVHVALVD----------------
Daphnia_pulex|953             EAVHPMRSWSDLKKRLGPYRRCFILLHPALPKKPLAILHVALTN----------------
Branchiostoma_floridae|1218   EAVHPMRNWSDLKRRVGPYRRCFIFTHSTMPREPMVVLHTALTN----------------
Ixodes_scapularis|8650        EAVHPVRNWTDLKRRVGPYRRCYVITHSCMPGEPIVVLHTALTS----------------
Pediculus_humanus|7874        EAVHPVRSWTDLKRRVGPYRRCFVFLHGSMPGEPIVVLHTALCD----------------
Nasonia_vitripennis|6623      EAIHPVRNWADLKKRVGPYRRCFIFTHPSMPREPLVLLHTALCD----------------
Danio_rerio|3315              EAVHPVRNWTDLKRRVGPNRRCYAFTHASMPGEPLVVLHVALTE----------------
Gasterosteus_aculeatus|17633  ------------------------------------------------------------
Oryzias_latipes|18869         EAVHPVRNWTDLKRRVGPYRRCYAFTHAAMPGEPLVVLHVALTE----------------
Fugu_rubripes|2781            EAVHPIRNWADLKRRVGPYRRCYAFTHAAMPGEPLVVLHVALTE----------------
Tetraodon_nigroviridis|4239   EAVHPMRNWADLKRRVGPYRRCYAFTHAAMPGEPLVVLHVALTE----------------
Xenopus_tropicalis|15934      EAVHPVRNWTDMKRRVGPYRRCYMFAHSAMPGEPLIVLHVALMQ----------------
Erinaceus_europaeus|166       EAVHPVKNWMDMKRRVGPYRRCFFFSHCSTPEEPLIVLHVALTS----------------
Dasypus_novemcinctus|3617     EAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEPLVVLHVALTS----------------
Otolemur_garnettii|8326       EAVHPVRSWMDMKRRVGPYRRCYFFSHCSVPGEPLVVLHVALTS----------------
Monodelphis_domestica|17343   EAVHPVKNWMDMKRRVSSYRRCYFFSHCSTPGEPLIVLHVALTN----------------
Macropus_eugenii|760          EAVHPVKNWMDMKRRVSSYRRCFFFSHCSTPGEPLIVLHVALTN----------------
Ornithorhynchus_anatinus|4060 EAVHPVKNWMDVKRRVGPYRRCYFFSHCSTPGEPLIVLHVALTN----------------
Anolis_carolinensis|17136     EAVHPVRNWLDMKRRVGSYRRCYYFVHRAIPGEPLIVLHVALTD----------------
Gallus_gallus|8520            EAVHPVRNWVDMKRRVGSYRRCYFFSHCAIPGEPLIVLHVALTS----------------
Taeniopygia_guttata|5765      ------------------------------------------------------------
Taeniopygia_guttata|7859      EAVHPVRNWVDMKRRVGAYRRCYFFSHCAIPGEPLIVLHVALTS----------------
Tupaia_belangeri|12320        XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----------------
Microcebus_murinus|6389       EAVHPVKSWMDLKRRVGPYRRCYFFSHCSTPGEPLIVLHVALTG----------------
Procavia_capensis|11690       EAVHPVKNWMDIKRRVGPYRRCYFFSHCSTPEEPLVVLHVALTN----------------
Echinops_telfairi|11860       EVVHPIKNWMDIKRRVGPYRRCYYFSHCSTPEEPLVVLHVALTP----------------
Bos_taurus|10371              EAVHPVKTWMDMKRRVGPYRRCYFFSHCSTPGEPLIVLHVALTS----------------
Tursiops_truncatus|8933       EAVHPVKNWTDMKRRVGPYRRCYFFSHCSTPGEPLIILHVALTS----------------
Dipodomys_ordii|9682          EAVHPVKNWLDMKRRVGPYRRCYFSSHCSTPGDPLIVLYVALTS----------------
Loxodonta_africana|9480       EAVHPVRNWMDIKRRVGPYRRCYFFSHCSTPEEPLVVLYVALTN----------------
Ornithorhynchus_anatinus|4059 ------------------------------------------------------------
Ochotona_princeps|14498       EAVHPVKNWMDMKRRVGPYRRCFFFSHCSTPGEPLVVLHVALTS----------------
Pteropus_vampyrus|10249       EAVHPIKNWMDLKRRVGPYRRCYFFSHCSTPEEPLVILHVALTS----------------
Myotis_lucifugus|2708         EAVHPVKNWMDIKQRVGPYRRCYFFSHCSTLEEPLVVLHVALTS----------------
Cavia_porcellus|4929          EAVHPIKSWMDMKQRVGPYRRCYFFSHCSTPGEPLVILYVALTS----------------
Canis_familiaris|9383         EAVHPVKNWMDMKRRVGPYRRCYFFSHCTTPEEPLIVLHVALTG----------------
Mus_musculus|40015            EAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEPLVVLHVALTG----------------
Rattus_norvegicus|13840       EAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGDPLVVLHVALTG----------------
Felis_catus|11977             EAVHPVKNWMDMKRRVGPYRRCYFFSHCASPEEPLVVLHVALTS----------------
Equus_caballus|20286          EAVHPVKSWMDMKQRVGPYRRCYFFSHCSTPGEPLVVLHLALTS----------------
Callithrix_jacchus|2263       EAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEPLVVLHVALTD----------------
Pongo_abelii|19290            EAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEPLVVLHVALTG----------------
Rhesus_macaque|32845          EAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEPLVVLHVALTG----------------
Homo_sapiens|39762            EAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEPLVVLHVALTG----------------
Pan_troglodytes|19752         EAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEPLVVLHVALTG----------------
Gorilla_gorilla|23175         EAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEPLVVLHVALTG----------------
Apis_mellifera|2047           EAIHPIKNWLDLKQRVGPYRRCYIFTHLSMPREPLVVLHTALCD----------------
Linepithema_humile|14603      EAIHPMRNWLDLKRRVGPYRRCYIFTHPSMPREPLVVLHTALCD----------------
Pogonomyrmex_barbatus|13812   EAIHPIKNWLDLKRRVGPYRRCYIFTHPSMPREPIVVLHTALCDIIPGLIQKKLFFETKI
                                                                                          

Nematostella_vectensis|9693   --EISDNIQS------------ILSEPEVDIDDCEYELENRTTAIFYSICSTQKGLAG--
Caenorhabditis_elegans|11183  --EIADSVQE-I----------TKRGAPTGK---E-EDQ--TTAIYYSITSTQPGLSG--
Daphnia_pulex|953             --EISNNIHTIITRNLSQSFDSETDGSRLADIGVE-DIDRVNTAIFYSISSTQKGLAG--
Branchiostoma_floridae|1218   --QISDNIQT------------IVSTPILDE---E-DVDNINTAIFYSITSTQKGLQG--
Ixodes_scapularis|8650        --SISASIQPDR----------AESQASDEW---E-DDKVIKAAIFYSISSTQKGLQG--
Pediculus_humanus|7874        --EIASSMSG------------IE----------E-DATCVKAAVFYSISSTQKGLQG--
Nasonia_vitripennis|6623      --VIPDSVKG-IQDAENRILGKVIVNKERVE---E-DKTKIKAAIFYSISSTQVGLQG--
Danio_rerio|3315              --DIANNIQG-I----------VREFATLDAD--E-DVNKINAAIFYSISSTQAGLQG--
Gasterosteus_aculeatus|17633  ------------------------------------------------------------
Oryzias_latipes|18869         --EISNNIQS-I----------VREFATLDSE--E-DVNKINSAIFYSISSTQAGLQG--
Fugu_rubripes|2781            --DISDNIQS-I----------VREFTTLQST--E-DVNKINSAIFYSITSTQPGLQG--
Tetraodon_nigroviridis|4239   --DISNNIQS-I----------VREFATLHA---EEDVNKINAAIFYSITSTQPGLQG--
Xenopus_tropicalis|15934      --NISGSIQA-I----------VKDIPSSEA---E-DGNKIQSAIFYSISLTQQGLQG--
Erinaceus_europaeus|166       --DISNNIQA-I----------VKDCPPSDT---E-EKNKIATAIFYSISLTQPGLQG--
Dasypus_novemcinctus|3617     --DISSNIQA-I----------VKESPPSEP---E-DKNRIAAAIFYSISLTQQGLQG--
Otolemur_garnettii|8326       --DITNNIQA-I----------VKECPPSET---E-EKSRIAAAIFYSISLTQQGLQG--
Monodelphis_domestica|17343   --EITNNIQT-I----------VKEFCPPET---E-DKNKIVTAIFYSISLTQQGLQG--
Macropus_eugenii|760          --EISNNIQA-I----------VKEFSPPEI---E-DKNKIVTAIFYSISLAQQGLQG--
Ornithorhynchus_anatinus|4060 --EISSNIQA-I----------VKEFSSPET---E-DSNKIVAAI---------------
Anolis_carolinensis|17136     --EISSSIQA-I----------VKEAPSLEV---E-DANKITTAIFYSISSTQQGLQG--
Gallus_gallus|8520            --DISSSIQA-I----------VKEVEPLET---E-DADKITTAIFYSISLTQQGLQG--
Taeniopygia_guttata|5765      ------------------------------------------------------------
Taeniopygia_guttata|7859      --DISSSIQA-I----------VKEVPPLET---E-DTDKITTAIFYSISLTQQGLQG--
Tupaia_belangeri|12320        --XXXXXXXA-I----------VKEAPPSET---E-EKTQIAAAIFYSISLTQQGLQG--
Microcebus_murinus|6389       --DITSNIQA-I----------VKEKFPSAT---E-EKNRIF-AIFYFISLKQPGQPG--
Procavia_capensis|11690       --DITSNIQX-X----------XXXXXXXXX---X-XXXXXXXXXXXXXXXXXXXXXX--
Echinops_telfairi|11860       --EITSNIQA-I----------VKDCPPSET---E-DKNHITTAIFYSISLTQQGLQG--
Bos_taurus|10371              --EISSSIQTII----------VKECPPSET---E-ERNKITTAIFYSLSLTQQGLQG--
Tursiops_truncatus|8933       --EISSSIQTII----------VKESPTSET---E-ERDKITTAVLYSLSLTQQGLQG--
Dipodomys_ordii|9682          --DITNNIQA-I----------VKDCPLSET---E-DKNKIAAAIFYSISLIQQGLQG--
Loxodonta_africana|9480       --DITSNIQA-I----------VKECPPSEA---E-DKNKIIAAIFYSISLTQQGLQG--
Ornithorhynchus_anatinus|4059 ------------------------------------------------------------
Ochotona_princeps|14498       --DISSNIQA-I----------VKEQPPSEA---E-DKDRIASAIFYSISLTQQGLQG--
Pteropus_vampyrus|10249       --EISSNMQA-I----------MKECPPSET---E-EKNKIAAAIFYSLSLAQQGLQG--
Myotis_lucifugus|2708         --DISSNIQS-I----------VKECPPAET---E-EKNKIAAAIFYSISLTQQGLQG--
Cavia_porcellus|4929          --DISSNIQA-I----------VKEQPLSET---E-ERDRIAAAIFYSISLTQQGLQG--
Canis_familiaris|9383         --DISNNIQA-I----------VKECPPSET---E-DRSKISAAIFYSISLTQPGLQG--
Mus_musculus|40015            --DISNNIQG-I----------VKECPPTET---E-ERNRIAAAIFYSISLTQQGLQG--
Rattus_norvegicus|13840       --DISNNIQS-I----------VKECPPSET---E-EKNRIAAAVFYSISLTQQGLQG--
Felis_catus|11977             --EISSNIQA-I----------VKECPPSET---E-EGSQISAAIFYSISLTQPGLQG--
Equus_caballus|20286          --EISSNIQA-I----------VKEHPPSET---E-EKNKIAAAIFYSISLTQQGLQG--
Callithrix_jacchus|2263       --DISSNIQA-I----------VKESPPSET---E-EKNRIAAAIFYSISLTQQGLQG--
Pongo_abelii|19290            --DISSNIQA-I----------VKERPPSET---E-EKNKIAAAIFYSISLTQQGLQG--
Rhesus_macaque|32845          --DISSNIQA-I----------VKECPPSET---E-EKNRIAAAIFYSISLTQQGLQG--
Homo_sapiens|39762            --DISSNIQA-I----------VKEHPPSET---E-EKNKITAAIFYSISLTQQGLQG--
Pan_troglodytes|19752         --DISSNIQA-I----------VKEHPPSET---E-EKNKIAAAIFYSISLTQQGLQG--
Gorilla_gorilla|23175         --DISSNIQA-I----------VKERPPSET---E-EKNKIAAAIFYSISLTQQGLQG--
Apis_mellifera|2047           --IIPDSVKD-IDGAKVRILGNLKKEITFLE---E-DKNKIKTAIFYSITSTQKGLQG--
Linepithema_humile|14603      --IIPDSVKG-IEEAETRILGSAKKHLTFLE---E-DKSKIKAAIFYSIASTQKGLQG--
Pogonomyrmex_barbatus|13812   KQKISNSVKG-IEEAEIRILGSAKKNITFLE---E-DKSKIKAAIFYSIVSTQKGLQKLH
                                                                                          

Nematostella_vectensis|9693   VDLGNFLIK----HVVRELQHEFPNITQYATLSPIPGFRAWLTLELKD------------
Caenorhabditis_elegans|11183  IDLGNMLIK----KVATKLQKDVPSVTTHSTLSPIPGFRPWLIRNLKG------------
Daphnia_pulex|953             IDLGQSLIK----RALRELQTEIPSLQQHSTLSPIPGFRSWLLQQLRE------------
Branchiostoma_floridae|1218   VELGNYLIK----RVVRELQAEFPKMTQFSSLSPIPGFRDWLVGEINKVLGSTESSSSED
Ixodes_scapularis|8650        IELGKYLIK----GVVKEVKAEFPHIQDFSSLSPIPGFKNWLVSEVHK------------
Pediculus_humanus|7874        IELGNYLIK----SVVHELQIEFPQMTQFSSLSPIPNFKTWLIDKVKF------------
Nasonia_vitripennis|6623      IELGNYLIK----EVAKHITAEFPMIDQLSSLSPIPNFRVWLLDRMKR------------
Danio_rerio|3315              VELGNYLIK----RVVRELQSEFPHMAQFSSLSPIPGFSLWLQGALGQ------------
Gasterosteus_aculeatus|17633  ------------------------------------------------------------
Oryzias_latipes|18869         VELGNYLIK----KVVRELQSEFPHMAQFSSLSPIPGFSVWLQGLLNQ------------
Fugu_rubripes|2781            VELGNYLIK----RVVRELQSEFPQMAQFSSLSPIPGFCTWLQGLLGQ------------
Tetraodon_nigroviridis|4239   VELGNYLIK----RVVRELQSEFPHMAQFSSLSPIPGFCTWLQGLLGQ------------
Xenopus_tropicalis|15934      VELGNYLIK----RVVKELQVEFPQILEFSSLSPIPGFTKWLLGALSS------------
Erinaceus_europaeus|166       VELGGFLIK----RVVKELQREFPHLGAFSSLSPIPGFTKWLLGLLSS------------
Dasypus_novemcinctus|3617     VELGTFLIK----RVVKELQKEFPHLGTFSSLSPIPGFTKWLLGSLNT------------
Otolemur_garnettii|8326       VELGTFLVK----RVIKELQXXXXXXXXXXXXXXXXXXXXXXLGLLHS------------
Monodelphis_domestica|17343   VELGSFLIK----RVVKELQREFPHLETFSSLSPIPGFTKWLLGTLSS------------
Macropus_eugenii|760          VELGSFLIK----RVVKELQXXXXXXXXXXXXXXXXXXXXXXXXXXXX------------
Ornithorhynchus_anatinus|4060 ------------------------------------------------------------
Anolis_carolinensis|17136     VELGSHLIK----RVVAELQMEFPQIKVFSTLSPIPGFTKWLVGLLSS------------
Gallus_gallus|8520            VELGTYLIK----RVVKELQKELPQIKTFSTLSPIPGFTKWLVGLLSS------------
Taeniopygia_guttata|5765      ------------------------------------------------------------
Taeniopygia_guttata|7859      VELGTHLIK----RVVKELQKELPQIEAFSTLSPIPGFTKWLVGLLSS------------
Tupaia_belangeri|12320        VELGTFLIK----RVVKELQREFPHLGAFSSLSPIPGFTKWLLGLLNS------------
Microcebus_murinus|6389       VELSCLIL-----RLFKELQKDFPHLGTFSSLSPIPGFTKWLLGLLNS------------
Procavia_capensis|11690       XXXXXXXXX----XXXXXXXKEFPHLAVFSSLSPIPGFTKWLLGFLSS------------
Echinops_telfairi|11860       IELGTFLIK----RVIKELR----------------------------------------
Bos_taurus|10371              VELGAFLIK----RVVKELQKEFPALGAFSSLSPIPGFTKWLLGLLKS------------
Tursiops_truncatus|8933       VELGAFLIK----RVVKELQKEFPHLGTFSSLSPIPGFTKWLLGLLKS------------
Dipodomys_ordii|9682          VELGTFLIK----QVVRELQKEFPHLGAFSSLSPIPGFTKWLLGLLSL------------
Loxodonta_africana|9480       VELGKFLVK----RVIKELQKEFPHLGAFSSLSPVPGFTKWLLGLLSL------------
Ornithorhynchus_anatinus|4059 ------------------------------------------------------------
Ochotona_princeps|14498       VELGTFLIK----RVVKELQKEFPH-GAFSSLSPIPGFTKWLLGLLSS------------
Pteropus_vampyrus|10249       VELGSFLIK----RVVKELQKEFPHVGTFSSLSPIPGFTKWLLGLLKS------------
Myotis_lucifugus|2708         VELGTFLIK----RVVKELQKEFPHLGTFSSLSPIPGFTKWLLGLLNS------------
Cavia_porcellus|4929          VELGTFLVK----RVLKELQKEFPHLGAFSSLSPIPGFTKWLLGLLGS------------
Canis_familiaris|9383         VELGTVLVK----RVLKELQKEFPHLGTFSSLSPIPGFTKWLLGLLSS------------
Mus_musculus|40015            VELGTFLIK----RVVKELQKEFPQLGAFSSLSPIPGFTKWLLGLLNV------------
Rattus_norvegicus|13840       VELGTFLIK----RVVKELQKEFPHLGAFSSLSPIPGFTKWLLGLLNV------------
Felis_catus|11977             VELGTFLVK----RVLKELQREFPHLGTFSSLSPIPGFTKWLLGLLNS------------
Equus_caballus|20286          VELGTFLIK----RVVKELQKEFPHLGTFSSLSPIPGFTKWLLGVLNA------------
Callithrix_jacchus|2263       VELGTFLIK----RVIKELQREFPHLEVFSSLSPI-------------------------
Pongo_abelii|19290            VELGTFLIK----RVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNS------------
Rhesus_macaque|32845          VELGTFLIK----RVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNS------------
Homo_sapiens|39762            VELGTFLIK----RVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNS------------
Pan_troglodytes|19752         VELGTFLIK----RVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNS------------
Gorilla_gorilla|23175         VELGTFLIK----RVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNS------------
Apis_mellifera|2047           IELGNYLIK----EVAKEVISEFPMIHELSSLSPIPNFRTWFLEKIKQ------------
Linepithema_humile|14603      IELGNYLIK----EVVNEIRTEFPAVQQLSSLSPIPNFKSWLLDKLKQ------------
Pogonomyrmex_barbatus|13812   IALRGYPCRGLNWKVASEITTEFPAVQQLSSLSPIPHFKTWLFDKLKQ------------
                                                                                          

Nematostella_vectensis|9693   ---AIENKGTNRHSFETSYVSL-------RRRFT---VCFMLLLLFQELIERDNWHKDQD
Caenorhabditis_elegans|11183  ------NSEYPSIMNEKVVNWI-------SDISEREMNEVEATETLLKVISNEK--TKKE
Daphnia_pulex|953             -----TERGRKTVLTDFNWSTA-------LQLIN--STKENPLGMLRSLLVDSSWMREEA
Branchiostoma_floridae|1218   SGVDGPSSTAPTLLTSAELQKV-------AEIAG--KEDVSPLVTLKKLLQTNQWMGAES
Ixodes_scapularis|8650        -----IIKGQPESRKLLNQREL-------EEIVAPYREDREPLEAFLRLLRNNGWYQVPE
Pediculus_humanus|7874        -----AEKGSNDILLHDEIITL-------KKHLN---SSSDFWKDFKKILLSNAWAEDKN
Nasonia_vitripennis|6623      ---DI-----NTVFTKTEQESIKYNLDYDQTITA----TRDLHLDLKKIFNNSLWGNDKR
Danio_rerio|3315              ---HKKEGRATELLSEQEWREV-------EDVTG-AAPGAPALEALRRLISTSEWIHSDR
Gasterosteus_aculeatus|17633  ------------------------------------------------------------
Oryzias_latipes|18869         ---YRKDNRGTDLLSEHEWKEV-------EQATD-SSPGSQATEALRKLISSGEWMRSER
Fugu_rubripes|2781            ---YRKERCHPDLLSEQEWREVELATECLGSRPG-----MPATEALRKLIGTGEWMHSEL
Tetraodon_nigroviridis|4239   ---YRKDGRHPDILSEQEWKEV-------GQATD-SAPGTAATEALRKLIGTGEWMHSER
Xenopus_tropicalis|15934      ---QIKESGRTELFTEAECKEI-------EDITG-----GPLSESLKRLFTSSEWMRCER
Erinaceus_europaeus|166       ---QAKEHGRNELLTDSECKEI-------SELTG-----GPALETLKGLLSSNDWAKSEK
Dasypus_novemcinctus|3617     ---QAKEPGRSELFTDYECREI-------AEATG-----GPVSETLRAFLGSSEWVKSEK
Otolemur_garnettii|8326       -----HKERRNELFTDSECKEL-------SELTG-----GPITETLKGLLGSSEWVKSEK
Monodelphis_domestica|17343   ---QTKELGRNELFTDSECNEI-------SDIIG-----GPISETLKILLTSNEWVKSEK
Macropus_eugenii|760          ---XXXXXXXXXXXXXSKCNEI-------SDILG-----GPITETL-IFFNSSECVKSEK
Ornithorhynchus_anatinus|4060 ------------------------------------------------------------
Anolis_carolinensis|17136     ---MSKENARSNPFTDPEYREI-------GEITG-----DPVTETLKRLLTNNEWVRSER
Gallus_gallus|8520            ---QTKELEKNELFTESERQEL-------SQITG-----DCTTETLKKLLNNNEWVRSEK
Taeniopygia_guttata|5765      ------------------------------------------------------------
Taeniopygia_guttata|7859      ---QTKEKGRNELFTESEWQEI-------SEITG-----DPTGNTLKKLLNTNEWVRSEK
Tupaia_belangeri|12320        ---QAKERGRSELFTDSECKEI-------SEVTG-----GPVNETLKAFLSSNEWVSSER
Microcebus_murinus|6389       ---QTRELGRSELLTDSECREL-------SELTG-----GPASETLKALLGSSEWAKSEK
Procavia_capensis|11690       ---Q-KDHGRNQLFTDFESKEI-------SEITG-----GPITETLKAFLSSPEWVKSEK
Echinops_telfairi|11860       ------------------------------------------------------------
Bos_taurus|10371              ---KAKEHGRSGLLTDSESQEI-------AELTG-----GPALETLQTLLSSSEWAQSEQ
Tursiops_truncatus|8933       ---KAKDHGRNELLTDSECKEI-------SKITG-----GPVNETLKTILSSSEWVQSEQ
Dipodomys_ordii|9682          ---QAKEHGKNELFTDSESRDI-------AEATG-----GPAHETLRAYLSSNEWVKSAK
Loxodonta_africana|9480       ---Q-KDHGRSQLFTDSESKDI-------SEITG-----GPINETLKVFLSSHEWVRSEK
Ornithorhynchus_anatinus|4059 ------------------------------------------------------------
Ochotona_princeps|14498       ---QAKERGRSELFSDSECREL-------AELTG-----DPVHETLRGLLSSSEWAKSEK
Pteropus_vampyrus|10249       ---QAKEHGRNELFTDSESKEI-------SEITG-----GPVNETLEVILSSNEWIKSET
Myotis_lucifugus|2708         ---QAKDHGRSELFTDSEYKEI-------SAVTG-----GPLNETLKALLSSNEWVKSEK
Cavia_porcellus|4929          ---QTKEHGRNGLFTDSESKEL-------GEAVG-----GPVPETLKVLLSGSEWAQSEK
Canis_familiaris|9383         ---QGKEHGRSELFTDAECKEI-------SEITG-----GPINETLKVLLSSSEWIKSEK
Mus_musculus|40015            ---QGKEHGRNELFTDSECQEI-------SAVTG-----NPVHESLKGFLSSGEWVKSEK
Rattus_norvegicus|13840       ---QGKEYGRNELFTDSECKEI-------AEVTG-----DPVHESLKGLLSSGEWAKSEK
Felis_catus|11977             ---QAKEHGRIELLTDSECKEI-------SEILG------PVNETLKVSLSSSEWVKSEK
Equus_caballus|20286          ---QAKDHGRSELFAESESKEI-------SEILG-----GPVNETLKALLSSNEWVQSER
Callithrix_jacchus|2263       ------------------------------------------------------------
Pongo_abelii|19290            ---QTKEHGRNELFTDLECKEI-------SEITG-----GPINETLKLLLSSSEWVQSEK
Rhesus_macaque|32845          ---QVKDHGRNELFTDSECKEI-------SEITG-----GPTNETLKLLLGSSEWVQSET
Homo_sapiens|39762            ---QTKEHGRNELFTDSECKEI-------SEITG-----GPINETLKLLLSSSEWVQSEK
Pan_troglodytes|19752         ---QMKEHGRNELFTDSECKEI-------SEITG-----GPINETLKLLLSSSEWVQSEK
Gorilla_gorilla|23175         ---QTKEHGRNELFTDSECKEI-------SEITG-----GPINETLKLLLSSSEWVQSEK
Apis_mellifera|2047           --------DIYNIFTNEECNSI-------QEILK----EKDIAFGLKKILNNSLWTHNIK
Linepithema_humile|14603      --------DVAFIFTAQEHAIM-------KDILK----TEEIVSVLKKVLSTSLWTGDKQ
Pogonomyrmex_barbatus|13812   --------DIAFIFTAQEHRIA-------KDILQ----TENVVPTLRKTLHTSLWTEDKQ
                                                                                          

Nematostella_vectensis|9693   IIDCIKAPLMRLGTR-YLYEEKRRGFAFDQV-------GATMWRLNWMADTSARGLHNSL
Caenorhabditis_elegans|11183  QLNAIQHILMYACAH-YLCNAKRNGMALNSVANFHIRNGAELYRLNWNGDTSHRGINNSF
Daphnia_pulex|953             KAKLMENPLMRLCAH-YLFVEKRRGFALDSVANFHLRNGAMMWRLNWASDLSPRGLKNSF
Branchiostoma_floridae|1218   MVEVLKDPLMRLCA----------------------------------------------
Ixodes_scapularis|8650        LVQRLEAPLMRLCAF-YLYHEKRRGYALNGVANFHLKNGAVIWRLNWLGDISPRGLSASC
Pediculus_humanus|7874        LVSLLEKPLMRLCAR-YLFIEKRRGYAFDSVANFHLKNGAVLWRLNWSADLSPRGLGNSC
Nasonia_vitripennis|6623      LSSTLREPMLRACAF-YLYKEKRRNYALNNVANFHLRNGAVMWRINWMADPSPRGMANSC
Danio_rerio|3315              LVRALEPALMRLCAW-YLFGEKRRGYALNPVANFHLQNGATMWRLNWQADTSPRGIANSC
Gasterosteus_aculeatus|17633  ---------MRLCAW-YLYGEKRRGYALNPVANFHLQNGATMWRLNWSADTSPRGVANSC
Oryzias_latipes|18869         LSGVLEPVLMRLCAW-YLYGEKRRGYALNPVANFHLQNGATMWRLNWRADTSPRGVANSC
Fugu_rubripes|2781            LSRVLEPVLMRLCAW-YLYGEKRRGSALNPVANFHLQNGATMWRINWLADTSPRGVANSC
Tetraodon_nigroviridis|4239   LSRVLEPALMRLCAW-YLYGEKRRGYALNPVANFHLQNGATMWRINWLADTSPRGVANSC
Xenopus_tropicalis|15934      LVNALETPLMRLCAW-YLYGEKHRGFALNPVANFHLQNGAVLWRLNWMADTSPRGGTASC
Erinaceus_europaeus|166       LSRALQAPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVMWRINWMADASFKGITSSC
Dasypus_novemcinctus|3617     LVRALQAPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVMWRINWMADASLKGVTGSC
Otolemur_garnettii|8326       LVRALQTPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVLWRINWMADTSLKGLSGSC
Monodelphis_domestica|17343   LVKVLQSPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVMWRINWLADLSLKGTTSSC
Macropus_eugenii|760          LVKMFEFPLVRF--WGYLCGEMHHGYALNPVTNFHLQNEAIMWHINWLADLSLKN-----
Ornithorhynchus_anatinus|4060 ------------------------------------------------------------
Anolis_carolinensis|17136     LVRALQAPLLRLCAW-YLYGEKHRGHALNPVANFHLQNGAVLWRLNWMADTSPRGISASC
Gallus_gallus|8520            LVNALHSPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGSVLWRINWMADTSPRGIAAAC
Taeniopygia_guttata|5765      ---------MRLCAW-YLYGEKHRGYALNPVANFHLQNGSVLWRINWMGDTSPRGIGASC
Taeniopygia_guttata|7859      LSEVLHSPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGSVLWRINWMGDTSPRGIGASC
Tupaia_belangeri|12320        LVRALQAPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVLWRINWMADTSSRGLAGSC
Microcebus_murinus|6389       LVRALQAPLMRLRPW-YLY-EKHRGYALNPVANFPLQNGAVMWRINWMADTSPKGLSGSC
Procavia_capensis|11690       LVRTLQAPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVIWRINWMGDMSLRGITGSC
Echinops_telfairi|11860       ------------------------------------------------------------
Bos_taurus|10371              LARALQAPLMRLCAW-YLYGEKHRGYALNPVAHFHLQNGAVLWRINWLADVSLKGVTGAC
Tursiops_truncatus|8933       LVRALQAPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVMWRINWMADVSLKGITGSC
Dipodomys_ordii|9682          LVCALQAPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVLWRINWMADSSPRGLTSSC
Loxodonta_africana|9480       LVRTLQAPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVMWRINWMADVSLRGITGSC
Ornithorhynchus_anatinus|4059 ---------MRLCAW-YLFGEKHRGFALNPVANFHLQNGAVMWRINWMADTSFRGITASC
Ochotona_princeps|14498       LVRALQAPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVLWRINWMADSSLRGLTGSC
Pteropus_vampyrus|10249       LVRVLQAPLMRLCAW-YLYGEKHRGYALNPVTHFHLQNGAVMWRINWMADVSLKGITGSC
Myotis_lucifugus|2708         LAKALQAPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVMWRINWMADLSF-GITGSC
Cavia_porcellus|4929          LVQALQAPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVMWRINWMGDSSPRGLTSSC
Canis_familiaris|9383         LVRALQAPLMRLCAW-YLFGEKHRGFALNPVANFHLQNGAVIWRINWMADVSLKGITGSC
Mus_musculus|40015            LTQALQGPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVMWRINWMADSSLKGLTSSC
Rattus_norvegicus|13840       LAQALQGPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVMWRINWMADSSLKGLTSSC
Felis_catus|11977             LVRVLQAPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVLWRLNWLADTSLKGVAGSC
Equus_caballus|20286          LVRALQAPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVMWRLNWMADASLRGISSSC
Callithrix_jacchus|2263       ------------------------------------------------------------
Pongo_abelii|19290            LVRALQTPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVLWRINWMADVSLKGITGSC
Rhesus_macaque|32845          LVRALQTPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVLWRINWMADVSLKGITGSC
Homo_sapiens|39762            LVRALQTPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVLWRINWMADVSLRGITGSC
Pan_troglodytes|19752         LARALQTPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVLWRINWMADVSLRGITGSC
Gorilla_gorilla|23175         LVRALQTPLMRLCAW-YLYGEKHRGYALNPVANFHLQNGAVLWRINWMADVSLRGITGSC
Apis_mellifera|2047           ISEVLKKPLLRACAW-YLYKEKRRNYALDSVANFHLRNGAVMWRINWLADPSPRGVGNSC
Linepithema_humile|14603      LSEFLKDPLLRACAW-YLYKEKRRGYALNNVANFHLRNGAMMWRINWMADPSPRGVANSC
Pogonomyrmex_barbatus|13812   LSTFLKEPLLRACAW-YLYKEKRRGYALNSVANFHLRNGAVMWRINWMADPSPRGVANSC
                                                                                          

Nematostella_vectensis|9693   GLMVNYKYVLEDVDNNNQQYLLNGTIAASKPFLEILDSE------TPGNTARVE------
Caenorhabditis_elegans|11183  GIMVNYRYDLEKVHENSAAYTEHKKMAINQKVLDIF------------------------
Daphnia_pulex|953             GLMMNYRYYVDACEKYSQLYAEKQHIESSEQI-RLLSGVSNSSAASQIS--HL-------
Branchiostoma_floridae|1218   ------RYFLGDTMRNSQRYMEEQHIEASQQVIDLAQAAGGADSPAGKS--NL-------
Ixodes_scapularis|8650        SIMVNYRYYLDEMETNRQKYLEHFTVPASDIFLEHLKPL------QSSL-----------
Pediculus_humanus|7874        SMMVNYRYFLEDTESNSRAYLENFSIPASEQILNLAEQAKQKIVCNSDSWKYL-------
Nasonia_vitripennis|6623      GIMVNYRYFLDETELNSRNYIEKYHIKASNTVIHLANEA------EKFF--STKVATAKE
Danio_rerio|3315              GIMVNYRYFLQETGTNSIAYLHNKVIKASEQVLGLVSQF------QRNS--KL-------
Gasterosteus_aculeatus|17633  GIMVNYRYFLNETSKNSALYLQNKVISASEQLVGLVSQF------QKSS--KL-------
Oryzias_latipes|18869         GIMVNYRYFLNETSKNSALYLQNKVVTASEQVLGLVSQF------QKNS--KL-------
Fugu_rubripes|2781            GIMVNYRYFLNDTSKNSALYLQNKVVTASEQVLGLVSQF------QKNS--KL-------
Tetraodon_nigroviridis|4239   GIMVNYRYFLNDTSKNSVLYLQNKVVTASEQVLGLVSQF------QKNS--KL-------
Xenopus_tropicalis|15934      GMMVNYRYFLENTSANSAKYLRMKHIEASDQVLNLVSKM--------NS--KL-------
Erinaceus_europaeus|166       SLMVNYRYFLEETASNSTSYLSSKNIKASEQVLSLVAQF------QKQS--KL-------
Dasypus_novemcinctus|3617     GLMVNYRYYLEETAANSTAYLGSKNIKASEQVLSLVAQF------QRNS--KL-------
Otolemur_garnettii|8326       GLMVNYRYYLHETGSNSTAYLGSRNIKASEQVLSLVAQF------QKNS--KL-------
Monodelphis_domestica|17343   GMMVNYRYFLEETGVNSAAYLGAKNIKASEQVLNLVSQF------QKLS--KL-------
Macropus_eugenii|760          ------HYLLEETAVNSAA-LEVKNFNASEQVPNLVSRF------QKLS--KL-------
Ornithorhynchus_anatinus|4060 ------------------------------------------------------------
Anolis_carolinensis|17136     GMMVNYRYVLEDTASNSAAYLGSKHIEASEQVLSLVAQF------QQNS--KL-------
Gallus_gallus|8520            GMMVNYRYFLEDTASNSAAYLGTKAIKASEQVLSLVSQF------QQNS--KL-------
Taeniopygia_guttata|5765      GMMVNYRYFLEETASNSALYLGSKQVRASEQVLALVAQF------QQNS--KL-------
Taeniopygia_guttata|7859      GMMVNYRYFLEETASNSALYLGSKQVRASEQVLALVAQF------QQNS--KL-------
Tupaia_belangeri|12320        GLMVNYRYYLEETGPNSTAYLGSKHIKASEQVLSLVAQF------QKNS--KL-------
Microcebus_murinus|6389       GLMVNYRYYLDETGPNSTAYLGSKSIKASEQVLSLVAQF------QKNS--KL-------
Procavia_capensis|11690       GLMVNYRYYLEETATHSTAYLGSKHIMASEQVLSLVSQF------QKNS--KL-------
Echinops_telfairi|11860       ------------------------------------------------------------
Bos_taurus|10371              GLMVNYRYFLEDTAANSTAYLGSKSIKASEQVLSLVAQF------QKNS--KL-------
Tursiops_truncatus|8933       GLMVNYRYFLENTATNRTTYLSSKSIKASEQVLSLVAQF------QKNS--KL-------
Dipodomys_ordii|9682          GLMVNYRYFLEETSTNSVAYLGSKTIKASEQVLGLVAQF------QKHS--KL-------
Loxodonta_africana|9480       GLMVNYRYYLEETATNSTAYLGSKHIKASEQVLSLVSQF------QKNS--KL-------
Ornithorhynchus_anatinus|4059 GLMVNYRYFLEETATNSAAYLGTQHIKASEQVLNLVSQF------QKNS--KL-------
Ochotona_princeps|14498       GLMVNYRYFLEETAPNSTAYLSCKTIKASEQVLSLVAQF------QKNS--KL-------
Pteropus_vampyrus|10249       GLMVNYRYFLEELATNSTSYLSSKNIKASEQVLSLVAQF------QKNS--KL-------
Myotis_lucifugus|2708         GMMVNYRYFLEETATNSTSYLGSKNIKASEQVLNLVAQF------QKNS--KL-------
Cavia_porcellus|4929          GLMANYRYFPEETGPNSTAYLGSKSIKASEQVLSLVAQF------QKNS--KL-------
Canis_familiaris|9383         GLMVNYRYYPAETATNSTSYLCSKNIKASEQVLSLVAQF------QKNS--KL-------
Mus_musculus|40015            GLMVNYRYYLEETGPNSISYLGSKNIKASEQILSLVAQF------QNNS--KL-------
Rattus_norvegicus|13840       GLMVNYRYYLEETGPNSISYLGSKNIKASEQILSLVAQF------QSNS--KL-------
Felis_catus|11977             GLMVNYRYYPEETAANSTSYLCAKNIKASEQVLSLVAQF------HKNS--KL-------
Equus_caballus|20286          GLMVNYRYYLEDTAINSTAYLGSKTIKASEQVLSLVAQF------QKNS--KL-------
Callithrix_jacchus|2263       ------------------------------------------------------------
Pongo_abelii|19290            GLMANYRYFLEETGPNSTSYLGSKNIKASEQVLSLVAQF------QRNS--KL-------
Rhesus_macaque|32845          GLMANYRYFLEETGPNSTSYLSSKNIKASEQVLSLVAQF------QKNS--KL-------
Homo_sapiens|39762            GLMANYRYFLEETGPNSTSYLGSKIIKASEQVLSLVAQF------QKNS--KL-------
Pan_troglodytes|19752         GLMANYRYFLEETGPNSTSYLGSKIIKASEQVLSLVAQF------QKNS--KL-------
Gorilla_gorilla|23175         GLMANYRYFLEETGPNSTSYLGSKNIKASEQVLSLVAQF------QKNS--KL-------
Apis_mellifera|2047           GIMVNYRYYLHECEKHSQNYIENYFINASEDIINLSTQY------K-----KL-------
Linepithema_humile|14603      GIMVNY------SNHRRRVWRNNWKVQSC-------------------------------
Pogonomyrmex_barbatus|13812   GIMVNYRYFLQDSERNSRNYIEHFVINASEN-----------------------------
                                                                                          

Nematostella_vectensis|9693   ----
Caenorhabditis_elegans|11183  ----
Daphnia_pulex|953             ----
Branchiostoma_floridae|1218   ----
Ixodes_scapularis|8650        ----
Pediculus_humanus|7874        ----
Nasonia_vitripennis|6623      AVEE
Danio_rerio|3315              ----
Gasterosteus_aculeatus|17633  ----
Oryzias_latipes|18869         ----
Fugu_rubripes|2781            ----
Tetraodon_nigroviridis|4239   ----
Xenopus_tropicalis|15934      ----
Erinaceus_europaeus|166       ----
Dasypus_novemcinctus|3617     ----
Otolemur_garnettii|8326       ----
Monodelphis_domestica|17343   ----
Macropus_eugenii|760          ----
Ornithorhynchus_anatinus|4060 ----
Anolis_carolinensis|17136     ----
Gallus_gallus|8520            ----
Taeniopygia_guttata|5765      ----
Taeniopygia_guttata|7859      ----
Tupaia_belangeri|12320        ----
Microcebus_murinus|6389       ----
Procavia_capensis|11690       ----
Echinops_telfairi|11860       ----
Bos_taurus|10371              ----
Tursiops_truncatus|8933       ----
Dipodomys_ordii|9682          ----
Loxodonta_africana|9480       ----
Ornithorhynchus_anatinus|4059 ----
Ochotona_princeps|14498       ----
Pteropus_vampyrus|10249       ----
Myotis_lucifugus|2708         ----
Cavia_porcellus|4929          ----
Canis_familiaris|9383         ----
Mus_musculus|40015            ----
Rattus_norvegicus|13840       ----
Felis_catus|11977             ----
Equus_caballus|20286          ----
Callithrix_jacchus|2263       ----
Pongo_abelii|19290            ----
Rhesus_macaque|32845          ----
Homo_sapiens|39762            ----
Pan_troglodytes|19752         ----
Gorilla_gorilla|23175         ----
Apis_mellifera|2047           ----
Linepithema_humile|14603      ----
Pogonomyrmex_barbatus|13812   ----