Orthologs Set ID: EOG4006BS


Orthology Database
OrthoDB4
Gene Symbol(s)
PRAMEF16,PRAMEF17

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Gorilla gorilla 14282 287, 667, 899
Homo sapiens 1010 287, 899
Homo sapiens 996 287, 899
Pan troglodytes 349 287, 899
Pongo abelii 2669 287, 899
Rattus norvegicus 11195 287, 737, 755, 899
Rhesus macaque 499 287, 899

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Gorilla gorilla 14282 ENSGGOT00000027478 ENSGGOG00000002014 PRAMEF17 gorGor3
Homo sapiens 996 ENST00000376121 654348 ENSG00000204488 PRAMEF16 hg19,GRCh37
Homo sapiens 1010 ENST00000376098 654348 ENSG00000204479 PRAMEF17 hg19,GRCh37
Pan troglodytes 349 ENSPTRT00000059635 738833 ENSPTRG00000030820 PRAMEF17 panTro2
Pongo abelii 2669 ENSPPYT00000002219 100438068 ENSPPYG00000001859 LOC100438068 ponAbe2
Rattus norvegicus 11195 ENSRNOT00000044403 ENSRNOG00000030903 D4ABX5_RAT rn4
Rhesus macaque 499 ENSMMUT00000023576 715953 ENSMMUG00000016780 rheMac2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Gorilla gorilla 11617 ENSGGOP00000021098 ENSGGOG00000002014 PRAMEF17 gorGor3
Homo sapiens 80603 ENSP00000365289 654348 ENSG00000204488 PRAMEF16 hg19,GRCh37
Homo sapiens 80761 ENSP00000365266 654348 ENSG00000204479 PRAMEF17 hg19,GRCh37
Pan troglodytes 21697 ENSPTRP00000052838 738833 ENSPTRG00000030820 PRAMEF17 panTro2
Pongo abelii 10612 ENSPPYP00000002153 100438068 ENSPPYG00000001859 LOC100438068 ponAbe2
Rattus norvegicus 19366 ENSRNOP00000040450 ENSRNOG00000030903 D4ABX5_RAT rn4
Rhesus macaque 2741 ENSMMUP00000022059 715953 ENSMMUG00000016780 rheMac2

multiple sequence alignment in CLUSTALW format


Rattus_norvegicus|11195 ATGAGTATTCCGACCCCACTCACACTCCAGATGCTGGCAAGACAGTCATTGCTCAGAAAT
Rhesus_macaque|499      ATGAGCCTCCAGTCCCCATCCAGACTTCTGGAGCTGGCAGGGCAGAGCCTGCTGAGGAAC
Gorilla_gorilla|14282   ATGAGCCTCCAGTCCCCATCCAGACTCCTGGAGCTGGCAGGCCAGAGCCTGCTGAGGAAC
Pongo_abelii|2669       ATGAGCCTCCAGTCCCCATCCAGACTCCTGCAGCTGGCAGGGCAGAGCCTGCTGAGGAAC
Pan_troglodytes|349     ATGAGCCTCCAGTCCCCATCCAGACTCCTGGAGCTTGCAGGCCAGAGCCTGCTGAGGAAC
Homo_sapiens|1010       ATGAGCCTCCAGTCCCCATCCAGACTCCTGGAGCTGGCAGGCCAGAGCCTGCTGAGGAAC
Homo_sapiens|996        ATGAGCCTCCAGTCCCCATCCAGACTCCTGGAGCTGGCAGGCCAGAGCCTGCTGAGGAAC
                        ***** .* *.*:*****  ** *** *:* :*** ***.* ***: . **** **.** 

Rattus_norvegicus|11195 GAGGATGTGGCCATATTCTCTCTGGAGGAGATGCCAAATGTGCTCTTCCCAGCACTGTTC
Rhesus_macaque|499      CGGTCCCTGACCATCTTCACCCTGGATGAGCTGCCCCGGGAGGTCTTCCCTCTGATGTTC
Gorilla_gorilla|14282   CAGTTCTTGACCATCTTCAACCTGGACGAGCTGCCCAGGGAGGTCTTCCCTCTGATGTTC
Pongo_abelii|2669       CAGTTCTTGACCATTTTCACCCTGGAGGAGCTGCCCAGGGAAGTCTTCCCTCTGATGTTC
Pan_troglodytes|349     CAGTTCTTGACCATCTTCACCGTGGACGAGCTGCCCAGGGAGGTCTTCCCTCTGATGTTC
Homo_sapiens|1010       CAGTTCTTGACCATCTTCATCCTGGACGAGCTGCCCAGGGAGGTCTTCCCTCTGATGTTC
Homo_sapiens|996        CAGTTCTTGACCATCTTCATCCTGGACGAGCTGCCCAGGGAGGTCTTCCCTCTGATGTTC
                         .*    **.**** ***:   **** ***.****... *:. *******:  ..*****

Rattus_norvegicus|11195 AAGGAGGCCTTTGAGGGCAGACAAACCAAGCTTGTGAAAGAAATGGTGGCAACTTGGCCA
Rhesus_macaque|499      ATGGAGGCCTTCAGCATGAGACGCTGTGAGGACCTGAAGCTGATGGTGCAGGCTTGGCCC
Gorilla_gorilla|14282   ATGGAGGCCTCCAGCATGAGACATTTTGAGGCCCTGAAGCTGATGGTGCAGGCCTGGCCC
Pongo_abelii|2669       ATGGAGGCCTTCAGCATGAGACACTGTGAGGCCCTGAAGCTGATGGTGCAGGCCTGGCCC
Pan_troglodytes|349     ATGGAGGCCTCCAGCATGAGACATTTTGAGGCCCTGAAGCTGATGGTGCAGGCCTGGCCC
Homo_sapiens|1010       ATGGAGGCCTCCAGCATGAGACATTTTGAGGCCCTGAAGCTGATGGTGCAGGCCTGGCCC
Homo_sapiens|996        ATGGAGGCCTCCAGCATGAGACATTTTGAGGCCCTGAAGCTGATGGTGCAGGCCTGGCCC
                        *:********  .. .  ****. :  .**    ****. :.****** ...* *****.

Rattus_norvegicus|11195 TTGCCCTGTCTCCCTGTGGGTGCATTGATGAAGACACCAAGCCTAGAAACCTTTCAAGCT
Rhesus_macaque|499      TTCCTCCGCCTCCCTCTGGGATCCCTGATGAAGACACCTCATCTGGAGACCTTGCGAGCT
Gorilla_gorilla|14282   TTCCTCCGCCTCCCTCTGGGATCCCTGATGAAGACACCTCATCTGGAGACCTTGCAAGCT
Pongo_abelii|2669       TTCGTACGCCTCCCTCTGGGATCCCTGATGAAGACACCTCATCTGGAGACCTTGCAAGCT
Pan_troglodytes|349     TTCCTCCGCCTCCCTCTGGGATCCCTGATGAAGACACCTGATCTGGAGACCTTGCAAGCT
Homo_sapiens|1010       TTCCTCCGCCTCCCTCTGGGATCCCTGATGAAGACACCTCATCTGGAGACCTTGCAAGCT
Homo_sapiens|996        TTCCTCCGCCTCCCTCTGGGATCCCTGATGAAGACACCTCATCTGGAGACCTTGCAAGCT
                        **   . * ****** ****: *. *************: . **.**.***** *.****

Rattus_norvegicus|11195 GTGCTAGATGGAGTAGACATGCGACTGACAAGAAAGTTTCACCCCAGGAGAACAAAACTA
Rhesus_macaque|499      GCGCTGAAGGGACTTGATACGCTGCTGGCCCAGAAGGTCCGGCCCAGGAGGTGGAAACTT
Gorilla_gorilla|14282   GTGCTGAAGGGACTTGATACACTGCTGGCCCAGAAGCTTCGCCCCAGGAGGTGGAAACTT
Pongo_abelii|2669       GTGCTGAAGGGACTTGATACACTGCTGGCCCAGAAGCTTCGCCCCAGGAGGTGGAAACTT
Pan_troglodytes|349     GTGCTGAAGGGACTTGATACACTGCTGGCCCAGAAGCTTCGCCCCAGGAGGTGGAAACTT
Homo_sapiens|1010       GTGCTGAAGGGACTTGATACACTGCTGGCCCAGAAGCTTCGCCCCAGGAGGTGGAAACTT
Homo_sapiens|996        GTGCTGAAGGGACTTGATACACTGCTGGCCCAGAAGCTTCGCCCCAGGAGGTGGAAACTT
                        * ***..* *** *:** * .* .***.*....*** * *. ********.: .*****:

Rattus_norvegicus|11195 CAGGTTCTTGATTTGAGAAATGCACACCATGCCTTCTGGAACATATGGGCTGGTGCAGAG
Rhesus_macaque|499      CAAGTGCTGGATTTGCGGGATGTTGATGAGAATTTCTGGACCATATGGTCTGGAGCCCGG
Gorilla_gorilla|14282   CAAGTGCTGGATTTGCGAGATGTTGATGAGAATTTCTGGACCATATGGTCTGGAGCCAGG
Pongo_abelii|2669       CAAGTGCTGGATTTGCGGGATGTTGATGAGAATTTCTGGACCATATGGTCTGGAGCCAGG
Pan_troglodytes|349     CAAGTGCTGGATTTGCGGGATGTTGATGAGAATTTCTGGACCATATGGTCTGGAGCCAGG
Homo_sapiens|1010       CAAGTGCTGGATTTGCGGGATGTTGATGGGAATTTCTGGACTATATGGTCTGGAGCCAGG
Homo_sapiens|996        CAAGTGCTGGATTTGCGGGATGTTGATGGGAATTTCTGGACTATATGGTCTGGAGCCAGG
                        **.** ** ******.*..*** : *  . .. *******. ****** ****:**. .*

Rattus_norvegicus|11195 GAGAGCAGCTGTTCAGCAGAAAACTGGGAGGAAAAGCAAGTAGTGAAGGTCTTGCCCAGA
Rhesus_macaque|499      GCCCTGTCCTGCTCCCCAGAGGCCATGAGTAAGAGGCAGACAGTGGAGGACTGTCCGAGG
Gorilla_gorilla|14282   GCCCTGTCCTGCTCCCCAGAGGCCATGAGTAAGAGGCAGACAGTGGAGGACTATCCAAGG
Pongo_abelii|2669       GCCCTCTCCTGCTCCCCAGAGGCCATGAGTAAGAGGCAGACAGTGGAGGACTGTCCAAGG
Pan_troglodytes|349     GCCCTCTCCTGCTCCCCAGAGGCCATGAGTAAGAGGCAGACAGTGGAGGACTGTTCGAGG
Homo_sapiens|1010       GCCCTCTCCTGCTCCCCAGAGGCCATGAGTAAGAGGCAGACAGTGGAGGACTATCCAAGG
Homo_sapiens|996        GCCCTCTCCTGCTCCCCAGAGGCCATGAGAAAGAGGCAGACAGTGGAGGACTATCCAAGG
                        *. .  : *** **. ****...*: *.. .*.*.***.. ****.***:**   * **.

Rattus_norvegicus|11195 TATGCACTGAGGCGGCAGCGAGTGAAGGTCATAGTTGAATTGTGCATCTGG---TCCTGC
Rhesus_macaque|499      ACGGGA---GAGCGCCAGCCCTTGAAGGTGTTCATAGACCTCTGCCTAAAGGACAGTGCG
Gorilla_gorilla|14282   ACGGGA---CAGCACCAGCCCTTGAAGGTGTTCATAGACCTCTGCCTAAAGGAAAGTATG
Pongo_abelii|2669       ATGGGA---GAGCCCCAGCCCTTAAAGGTGTTCATAGACCTCTGCCTAAAGGAAAGTATG
Pan_troglodytes|349     ATGGGA---GAGTGCCAGCCCTTGAAGGTGTTCATAGACCTCTGCCTAAAGAAAAGTATG
Homo_sapiens|1010       ACGGGA---GAGCACCAGCCCTTGAAGGTGTTCATAGACCTCTGCCAAAAGGAAAGTACA
Homo_sapiens|996        ACGGGA---GAGCACCAGCCCTTGAAGGTGTTCATAGACCTCTGCCAAAAGGAAAGTACA
                        :  * *    .*   **** . *.***** :*..*:**. * ***.:.:.*   :     

Rattus_norvegicus|11195 CTTGATGAAACACAAGCATATTTCTTGAAGTGGGCCCAGCAGAGAAAGGGCTCCCTACAT
Rhesus_macaque|499      CTGGATGAATGCCTGAGCTACCTCTGTGGGTGGGTCCACTACAGAAGCGGTCTCGTGCAC
Gorilla_gorilla|14282   CTGGATGAATGCCTGAGCTACCTCTGCAGGTGGATCCACTACAGAAGAGGTCTAGTGCAC
Pongo_abelii|2669       CTGGATGAATGCCTGAGCTACCTCTGTGGGTGGATCCACTACAGAAGAGGTCTAGTGCAC
Pan_troglodytes|349     CTGGATGAATGCCTGAGCTACCTCTGTGGGTGGATCCACTACAGAAGAGGCCTAGTGCAC
Homo_sapiens|1010       CTGGATGAATGCCTGAGCTACCTCTGCAGGTGGATCCACTACAGAAGAGGTCTAGTGCAC
Homo_sapiens|996        CTGGATGAATGCCTGAGCTACCTCTGCAGGTGGATCCACTACAGAAGAGGTCTAGTGCAC
                        ** ******: .*:.. .**  ***  ..****. ***  * ****. **   . *.** 

Rattus_norvegicus|11195 TTCTGTTGTACACAGATGACAATCTGGGAGCTGCCACTCAGAGTTCTCAAAGAGATCTTG
Rhesus_macaque|499      CTGTGTTGTAGTAAGGTGCAGAATTACTCAATGCCCACTTCAAGTTTCAGAAATCTATTG
Gorilla_gorilla|14282   CTGTGTTGTAATAAGGTGCAGAATTACTCAATGCCAACTTCAAGTTTCAGAAATTTATTG
Pongo_abelii|2669       CTGTGTTGTAGTAAGTTGCAGAATTACTCAATGCCCACTTCAAGTTTCAGAAATTTATTG
Pan_troglodytes|349     CTGTGTTGTAATAAGGTGCAGAATTACTCAATGCCAACTTCAAGTTTCAGAAATTTATTG
Homo_sapiens|1010       CTGTGTTGTAATAAGGTGCAGAATTACTCAATGCCCACTTCAAGTTTCAGAAATTTATTG
Homo_sapiens|996        CTGTGTTGTAATAAGGTGCAGAATTACTCAATGCCCACTTCAAGTTTCAGAAATTTATTG
                         * ******* :.** **...*: *.  ...****..  : *. * ***.*.*  *.***

Rattus_norvegicus|11195 AATGTATTTAATCCACAACACATCACTGAATTAGAACTGAATACAGAGTGGAATCTGTCT
Rhesus_macaque|499      GAAAGGATATACCCAGACAGTATCCAGGAGTTGGAAGTCAGGAGAAAGTGCTCTCTGAAT
Gorilla_gorilla|14282   AAAAGGGTATACCCAGACAGTATCCAGGAGTTGGAAATTAAGAGAAAGTGCTCTCTGAAT
Pongo_abelii|2669       AAAAGGGTATACCCAGACAGTATCCAGGAGTTGGAAGTTAAGAGAAAGTGCTCTCTGAAT
Pan_troglodytes|349     AAAAGGGTATACCCAGACAGTATCCAGGAGTTGGAAATTAAGAGAAAGTGCTCTCTGAAT
Homo_sapiens|1010       AAAAGGGTATACCCAGACAGTATCCAGGAGTTGGAAATTAAGAGAAAGTGCTCTCTGAAT
Homo_sapiens|996        AAAAGGGTATACCCAGACAGTATCCAGGAGTTGGAAATTAAGAGAAAGTGCTCTCTGAAT
                        .*:. . *::* *** *... ***.. **.**.*** * *. * *.**** :.****:.*

Rattus_norvegicus|11195 GACCTGGCACATTTTGCTGCCTACTTTGGAAAGATGATAAATCTTCAGAAAGTCTTCCTG
Rhesus_macaque|499      CAAACAGGAAAGTTTGCCCCTTACCTGAGCCGGATGAGCAATCTTCGCAAACTCTTTTTA
Gorilla_gorilla|14282   AAAACAGGAAAGTTTGCCCCTTACCTGAGCCAGATGAGCAATCTTCGCAAACTCTTTTTA
Pongo_abelii|2669       AAAACAGGAAAGTTTGCCCCTTACTTGAGCAAGATGAGCAATCTTCGCAAACTCTTTTTA
Pan_troglodytes|349     AAAACAGGAAAGTTTGCCCCTTACTTGAGCCAGATGAGCAATCTTCGCAAACTCTTTTTA
Homo_sapiens|1010       AAAACAGGAAAGTTTGCCCCTTACTTGAGCCAGATGAGCAATCTTCGCAAACTCTTTTTA
Homo_sapiens|996        AAAACAGGAAAGTTTGCCCCTTACTTGAGCCAGATGAGCAATCTTCGCAAACTCTTTTTA
                         *.. .* *.* *****  * *** * .*...***** .*******. *** ****  *.

Rattus_norvegicus|11195 GCACCCCTCCACAAGATTTATTTATTTTTAATAAGCACTGAAACAAGAGACAGAGAAACC
Rhesus_macaque|499      GCCTTCGGTTATGATGGTGAGTTATACGTGAGCGGCCTCCAG------------------
Gorilla_gorilla|14282   GCCTTCGGTTATGACGATGAGTTACATATAAGCGGCCAACAG------------------
Pongo_abelii|2669       GCCTTCGGTTATGACGATGAGTTATATGTAAGCGGCCAACAG------------------
Pan_troglodytes|349     GCCTTCGGTTATGACGATGAGTTATATGTAAGCGGCCAACAG------------------
Homo_sapiens|1010       GCCTTCGGTTATGACGATGAGTTATATGTAAGCGGCCAACAG------------------
Homo_sapiens|996        GCCTTCGGTTATGACGATGAGTTATATGTAAGCGGCCAACAG------------------
                        **.  *    * .* . * * *** :  *.* ..**.   *.                  

Rattus_norvegicus|11195 AAGTGTATCAAGAAGTTTATATCTCAGTTC---TCCAAATTCAATTGCCTCCAGCATCTC
Rhesus_macaque|499      ------------CAGTTCATTCCTGACTTGGACTCTCCATTCCTCTGCCTGTCCTACCCC
Gorilla_gorilla|14282   ------------CAGTTCGTTCCTGACTTGGGCTGTCCATTCCTCTGCCTGTCCTACCCT
Pongo_abelii|2669       ------------CAGTTCGTTCCTGACTTGGACTCTCCATTCCTCTGCCTGTACTACCCT
Pan_troglodytes|349     ------------CAGTTCGTTCCTGACTTGGACTGTCCATTCCTCTGCCTGTACTACCCT
Homo_sapiens|1010       ------------CAGTTCGTTCCTGACTTGGACTGTCCATTCCTCTGCCTGTACTACCCT
Homo_sapiens|996        ------------CAGTTCGTTCCTGACTTGGACTGTCCATTCCTCTGCCTGTACTACCCT
                                    .**** .*: ** * **    *  ..****.: *****  .  * *  

Rattus_norvegicus|11195 TGCATGTTCTGCGTCCAT---------TTTCTTAGAGATCACATGAATCAAGTCCTAGGG
Rhesus_macaque|499      CAGATGCTTTATATAAGAAAGGTCAGCAATATCAAAGAGCACCTGGAGCACCTGCTCAGG
Gorilla_gorilla|14282   CAGATGCTTTATATAAGAAAGGTCAATAATATCAAAGAGCACCTGGAGCACCTGCTCAGG
Pongo_abelii|2669       CAGATGCTTTATATAAGAAAGATCAGTAATATCAAAGAGCACCTGGAGCACCTGCTCAGG
Pan_troglodytes|349     CAGATGCTTTATATAAGAAAGATCAGTAATATCGAAGAGCACCTGGAGCACCTGCTCAGG
Homo_sapiens|1010       CAGATGCTTTATATAAGAAAGATCAGTAATATCAAAGAGCACCTGGAGCACCTGCTCAGG
Homo_sapiens|996        CAGATGCTTTATATAAGAAAGATCAGTAATATCAAAGAGCACCTGGAGCACCTGCTCAGG
                         . *** * *. .*...:         ::*.* ..*** ***.**.* **. * **..**

Rattus_norvegicus|11195 TCCCTGATGACTCCCTTGGAGACCCTTTCAATCACATACTACCTAATTTCACAGAAAGAC
Rhesus_macaque|499      TGCCTCAAGAACCCCTTGCGGGCCTTTGTATTCTGTCATGCTTACCTAGCTGATCAGGAC
Gorilla_gorilla|14282   TGCCTCAAGAACCTCTTGGTGGCCTTTATATTCTGTCATGCTTACCTAGCTGATCGGGAA
Pongo_abelii|2669       TGCCTCAAGAACCCCTTGGGGGCCTTTATATTCTGTCATGCCTACCTAGCTGATCGGGAC
Pan_troglodytes|349     TGCCTCAAGAACCCCTTGGGAACCTTTATATTCTGTCATGCTTACCTAGCTGATCGGGAC
Homo_sapiens|1010       TGCCTCAAGAACCCCTTGGGAACCTTTATATTCTGTCATGCTTACCTAGCTGATCAGGAC
Homo_sapiens|996        TGCCTCAAGAACCCCTTGGGAACCTTTATATTCTGTCATGCTTACCTAGCTGATCAGGAC
                        * *** *:**. * ****  ..** **  *:**: : *  .  :..*: *: * ...**.

Rattus_norvegicus|11195 TTGGATTCCCTATCCCGCAGTCAAAGCCTATTTCAGCTAAAACATCTGGATTTGAGTGGA
Rhesus_macaque|499      GTGGAGTGTCTGTCTCAGTACCCAAGCCTCAGTCAGCTAAAGGAGCTGCACCTGATTCAT
Gorilla_gorilla|14282   TTGGAGTGTCTGTCTCAGTACCCAAGCCTCAGTCAGCTAAAGGAGCTGCGTCTGATTCGT
Pongo_abelii|2669       GTGGAGTGTCTGTCTCAGTACCCAAGCCTCAGTCAGCTAAAGGAGCTGCATCTGATTCAT
Pan_troglodytes|349     ATGGAGTGTCTGTCTCAGTACCCAAGCCTCAGTCAGCTAAAGGAGCTGCATCTGATTCAT
Homo_sapiens|1010       ATGGAGTGTCTGTCTCAGTACCCAAGCCTCAGTCAGCTAAAGGAGCTGCATCTGATTCAT
Homo_sapiens|996        ATGGAGTGTCTGTCTCAGTACCCAAGCCTCAGTCAGCTAAAGGAGCTGCATCTGATTCAT
                         **** *  **.** *. :. *.******.: *********. * *** .  *** * .:

Rattus_norvegicus|11195 GTGGTCTTATGTGATCTGGATATTATGCCTCTGAGAGGTCTCCTAGAGAAAGTGGCAGAC
Rhesus_macaque|499      ATCCTAATGTGGACCACCAATCTTGAGCCCCTTGGAGCTCTGCTAGAGAAAGCTGCTGCT
Gorilla_gorilla|14282   ATCTTAATGTGGACCACCCATCTTGAGCCCCTTGGAGTTCTGCTGGAGAAAGTTGCTGCT
Pongo_abelii|2669       ATCCTAATGTGGACCACCAATCCTGAGCCCCTTAGAGCTCTGCTAGAGAAAGTTGCTGCT
Pan_troglodytes|349     ATCCTAATGGGGACCACCAATCTTGAGCCCCTTGGAGCTCTGCTAGAGAAAGTTGCTGCT
Homo_sapiens|1010       ATCCTAATGTGGACCACCAATCTTGAGCCCCTTGGAGCTCTGCTAGAGAAAGTTGCTGCT
Homo_sapiens|996        ATCCTAATGTGGACTACCAATCTTGAGCCCCTTGGAGCTCTGCTAGAGAAAGTTGCTGCT
                        .*  *.:*. * .. .   **. *.:*** ** .*** *** **.*******  **:*. 

Rattus_norvegicus|11195 ACTCTTGAGACTCTGGATTTGAAGTGGTGTAGAATGAATGACTCCCAACTCTATGCCCTC
Rhesus_macaque|499      ACTCTCAAGAGCCTCACCTTAAAGGACTGTCGGATCCAGGACTCCCAACTCAGGGTCCTC
Gorilla_gorilla|14282   ACTCTCGAGATCCTCGTCTTAGAGAACTGTCGGATCCAGGACCCCCAACTCAGGGTCCTC
Pongo_abelii|2669       ACTCTCGAGATCCTCACGTTAAAGAACTGTCAGATCCAGGACTCCCAACTCAGGGTCCTC
Pan_troglodytes|349     ACTCTCCAGATCCTCACGTTAAAGGACTGTCAGATCCAGGACTCCCAACTCGGGCTCCTC
Homo_sapiens|1010       ACTCTCGAGATCCTCACGTTAAAGGACTGTCAGATCCAGGACTCCCAGCTCAGGGTCCTC
Homo_sapiens|996        ACTCTCGAGATCCTCACGTTAAAGGACTGTCAGATCCAGGACTCCCAGCTCAGGGTCCTC
                        *****  ***  ** .  **..** . ***...** .* *** ****.*** .   ****

Rattus_norvegicus|11195 CTACCTGCCCTCAGACATTGCTGTCAGCTCACCATGGTCAACTTCTACAGCAATAACTTC
Rhesus_macaque|499      CTGCCTGCCCTGAGCCGCTGCTCCCAGCTCACCACCTTCTACTTTGGTGGAAATGAGACC
Gorilla_gorilla|14282   CTGCCTGCCCTGAGCCACTGTTCCCAGCTCACCACCTTCAACTTTCATGGAAATGAGACC
Pongo_abelii|2669       CTACCTGCCCTGAGCCACTGCTCCCAGCTCACCACCTTCTACTTTCATGGAAATGAGACC
Pan_troglodytes|349     CTGCCTGCCCTGAGCCGCTGCTCCCAGCTCACCACCTTCTACTTTCGCGGAAATGAGACC
Homo_sapiens|1010       CTGCCTGCCCTGAGCCGCTGCTCCCAGCTCACCACCTTCTACTTTCGCGGAAATGAGACC
Homo_sapiens|996        CTGCCTGCCCTGAGCCGCTGCTCCCAGCTCACCACCTTCTACTTTCGCGGAAATGAGACC
                        **.******** **.*. ** *  **********   **:****  . .*.***.* : *

Rattus_norvegicus|11195 TCCATGCATATTCTGAAGGACCTTTTGCAGCACACAATCAACTGGAGCAGGATCAATGTG
Rhesus_macaque|499      TCCACGAATGCTCTGAAAGACCTGCTGCGTCACACAGGCGGGCTGAGCAAGTTAGGCCTG
Gorilla_gorilla|14282   TCCACAAATGCTCTGAAAGACCTGCTGCGTCACACAGGCGGGCTGAGCAAGTTAGGCCTG
Pongo_abelii|2669       TCCACGAATGCTCTGAAAGACCTACTGCGTCACACAGGCGGGCTGAGCAAGTTAGGCCTG
Pan_troglodytes|349     TCCACGAATGCTCTGAAAGACCTGCTGCGTCACACAGGTGGGCTGAGCAAGTTAGGCCTG
Homo_sapiens|1010       TCCACGAATGCTCTGAAAGACCTGCTGTGTCACACAGGTGGGCTGAGCAAGTTAGGTCTG
Homo_sapiens|996        TCCACGAATGCTCTGAAAGACCTGCTGTGTCACACAGGTGGGCTGAGCAAGTTAGGTCTG
                        **** ..**. ******.*****  ** . ******.  ..   *****.*:*...  **

Rattus_norvegicus|11195 GAACTATACCCTGCCCCTCTGGAGTGCTATGATGACTCGGCTCAAGTATCTGTAGAAAGA
Rhesus_macaque|499      GAGTTGTATCCTGCCCCTCTGGAGAGTCTTGACAACAGGGGTCACGTCAATTGGGAGATC
Gorilla_gorilla|14282   GAGTTGTATCCTGCCCCTCTGGAGAGTCTTGACTACAAGGGTCATGTCAACTGGGAGATC
Pongo_abelii|2669       GAGTTGTACCCTGCCCCTCTGGAGTGTCTTGACAACAGGGGTAATGTCAATTGGGAGATC
Pan_troglodytes|349     GAGTTGTATCCTGCCCCTCTGGAGTGTCTTGACAACAGGGGTCATGTCAATTGGGAGATC
Homo_sapiens|1010       GAGTTGTATCCTGCCCCTCTGGAGTGTCTTGACAACAGGGGTCATGTCAATTGGGAGATC
Homo_sapiens|996        GAGTTGTATCCTGCCCCTCTGGAGTGTCTTGACAACAGGGGTCATGTCAATTGGGAGATC
                        **. *.** ***************:*  :***  **: ** *.* **.:.   .**.* .

Rattus_norvegicus|11195 TTTGCCCTACTTTGTCCTGAGATCGTGGATACACTCAGGGCAATAAGGCAGCCCAAGAGC
Rhesus_macaque|499      CTTGCCCCAATTCGGGCTGAGCTGATGCGGACGCTCAGGGAAGTCAGGCAGCCCAAGAGG
Gorilla_gorilla|14282   CTCATCCCAATTCGGGCTGAGCTGATGCGTACACTCAGGGAAGTCAGGCAGCCCAAGAGG
Pongo_abelii|2669       CTTTCCCCAATTCGGGCTGAGCTGATGCGTACACTCAGGGAAGTCAGGCAGCCCAAGAGG
Pan_troglodytes|349     CTCACCCCAATTCGGGCTGAGCTGATGCGTACACTCAGGGAATTCAGGCAGCCCAAGAGG
Homo_sapiens|1010       CTCGCCCCAATTCGGGCTGAGCTGATGTGTACACTCAGGGAAGTCAGGCAGCCCAAGAGG
Homo_sapiens|996        CTCGCCCCAATTCGGGCTGAGCTGATGTGTACACTCAGGGAAGTCAGGCAGCCCAAGAGG
                         *   ** *.** *  *****.* .** . **.*******.* *.************** 

Rattus_norvegicus|11195 ATCTCCTTTGCTACAGATGCCTGCCAAAGATGTGGTGAGCGCTATGTCTATCACAATGGG
Rhesus_macaque|499      ATCTTTTTTGGTCCCGTTCCCTGCCCTTCCTGTGGCTCATGGCCATCTGAGACAGTGGAC
Gorilla_gorilla|14282   ATCTTCTTTGGTCCCGTCCCTTGCCCTACCTGTGGCTCATGGCCATCTGAGAAAGTGGAC
Pongo_abelii|2669       ATCTTTTTTGGTCCCGTCCCCTGCCCTTCCTGTGGCTCATGGCCATCTGAGAAAGTGGAC
Pan_troglodytes|349     ATCTTTTTTGGTCCCATCCCCTGCCCTTCCTGTGGCTCATGGCCATCTGAGAAAGTGGAC
Homo_sapiens|1010       ATCTTTTTTGGTCCCATCCCCTGCCCTTCCTGTGGCTCATGGCCATCTGAGAAAGTGGAC
Homo_sapiens|996        ATCTTTTTTGGTCCCATCCCCTGCCCTTCCTGTGGCTCATGGCCATCTGAGAAAGTGGAC
                        ****  **** *.*..:  * ****.:: .*****  .. *  .:    * ....: *. 

Rattus_norvegicus|11195 TCCAGACTTTGTTGTTGCTGGCAGTAA
Rhesus_macaque|499      TTCCATCTTTGCTCC---------TAG
Gorilla_gorilla|14282   TTCCATCTTTGC---------------
Pongo_abelii|2669       TTCCATCTTTGCTCT------------
Pan_troglodytes|349     TTCCATCTTTGCTCT---------TAG
Homo_sapiens|1010       TTCCATCTTTGCTCT---------TAG
Homo_sapiens|996        TTCCATCTTTGCTCT---------TAG
                        * *..:*****                

multiple sequence alignment in CLUSTALW format


Rattus_norvegicus|19366 MSIPTPLTLQMLARQSLLRNEDVAIFSLEEMPNVLFPALFKEAFEGRQTKLVKEMVATWP
Rhesus_macaque|2741     MSLQSPSRLLELAGQSLLRNRSLTIFTLDELPREVFPLMFMEAFSMRRCEDLKLMVQAWP
Gorilla_gorilla|11617   MSLQSPSRLLELAGQSLLRNQFLTIFNLDELPREVFPLMFMEASSMRHFEALKLMVQAWP
Pongo_abelii|10612      MSLQSPSRLLQLAGQSLLRNQFLTIFTLEELPREVFPLMFMEAFSMRHCEALKLMVQAWP
Pan_troglodytes|21697   MSLQSPSRLLELAGQSLLRNQFLTIFTVDELPREVFPLMFMEASSMRHFEALKLMVQAWP
Homo_sapiens|80761      MSLQSPSRLLELAGQSLLRNQFLTIFILDELPREVFPLMFMEASSMRHFEALKLMVQAWP
Homo_sapiens|80603      MSLQSPSRLLELAGQSLLRNQFLTIFILDELPREVFPLMFMEASSMRHFEALKLMVQAWP
                        **: :*  *  ** ******. ::** ::*:*. :** :* ** . *: : :* ** :**

Rattus_norvegicus|19366 LPCLPVGALMKTPSLETFQAVLDGVDMRLTRKFHPRRTKLQVLDLRNAHHAFWNIWAGAE
Rhesus_macaque|2741     FLRLPLGSLMKTPHLETLRAALKGLDTLLAQKVRPRRWKLQVLDLRDVDENFWTIWSGAR
Gorilla_gorilla|11617   FLRLPLGSLMKTPHLETLQAVLKGLDTLLAQKLRPRRWKLQVLDLRDVDENFWTIWSGAR
Pongo_abelii|10612      FVRLPLGSLMKTPHLETLQAVLKGLDTLLAQKLRPRRWKLQVLDLRDVDENFWTIWSGAR
Pan_troglodytes|21697   FLRLPLGSLMKTPDLETLQAVLKGLDTLLAQKLRPRRWKLQVLDLRDVDENFWTIWSGAR
Homo_sapiens|80761      FLRLPLGSLMKTPHLETLQAVLKGLDTLLAQKLRPRRWKLQVLDLRDVDGNFWTIWSGAR
Homo_sapiens|80603      FLRLPLGSLMKTPHLETLQAVLKGLDTLLAQKLRPRRWKLQVLDLRDVDGNFWTIWSGAR
                        :  **:*:***** ***::*.*.*:*  *::*.:*** ********:..  **.**:**.

Rattus_norvegicus|19366 ESSCSAENWEEKQVVKVLPRYALRRQRVKVIVELCIW-SCLDETQAYFLKWAQQRKGSLH
Rhesus_macaque|2741     ALSCSPEAMSKRQTVEDCPRTG-ERQPLKVFIDLCLKDSALDECLSYLCGWVHYRSGLVH
Gorilla_gorilla|11617   ALSCSPEAMSKRQTVEDYPRTG-QHQPLKVFIDLCLKESMLDECLSYLCRWIHYRRGLVH
Pongo_abelii|10612      ALSCSPEAMSKRQTVEDCPRMG-EPQPLKVFIDLCLKESMLDECLSYLCGWIHYRRGLVH
Pan_troglodytes|21697   ALSCSPEAMSKRQTVEDCSRMG-ECQPLKVFIDLCLKKSMLDECLSYLCGWIHYRRGLVH
Homo_sapiens|80761      ALSCSPEAMSKRQTVEDYPRTG-EHQPLKVFIDLCQKESTLDECLSYLCRWIHYRRGLVH
Homo_sapiens|80603      ALSCSPEAMRKRQTVEDYPRTG-EHQPLKVFIDLCQKESTLDECLSYLCRWIHYRRGLVH
                          ***.*   ::*.*:  .* . . * :**:::**   * ***  :*:  * : * * :*

Rattus_norvegicus|19366 FCCTQMTIWELPLRVLKEILNVFNPQHITELELNTEWNLSDLAHFAAYFGKMINLQKVFL
Rhesus_macaque|2741     LCCSKVQNYSMPTSSFRNLLERIYPDSIQELEVRRKCSLNQTGKFAPYLSRMSNLRKLFL
Gorilla_gorilla|11617   LCCNKVQNYSMPTSSFRNLLKRVYPDSIQELEIKRKCSLNKTGKFAPYLSQMSNLRKLFL
Pongo_abelii|10612      LCCSKLQNYSMPTSSFRNLLKRVYPDSIQELEVKRKCSLNKTGKFAPYLSKMSNLRKLFL
Pan_troglodytes|21697   LCCNKVQNYSMPTSSFRNLLKRVYPDSIQELEIKRKCSLNKTGKFAPYLSQMSNLRKLFL
Homo_sapiens|80761      LCCNKVQNYSMPTSSFRNLLKRVYPDSIQELEIKRKCSLNKTGKFAPYLSQMSNLRKLFL
Homo_sapiens|80603      LCCNKVQNYSMPTSSFRNLLKRVYPDSIQELEIKRKCSLNKTGKFAPYLSQMSNLRKLFL
                        :**.::  :.:*   ::::*: . *: * ***:. : .*.. .:**.*:.:* **:*:**

Rattus_norvegicus|19366 APLHKIYLFLISTETRDRETKCIKKFISQF-SKFNCLQHLCMFCVH---FLRDHMNQVLG
Rhesus_macaque|2741     AFGYDGELYVSGLQ----------QFIPDLDSPFLCLSYPQMLYIRKVSNIKEHLEHLLR
Gorilla_gorilla|11617   AFGYDDELHISGQQ----------QFVPDLGCPFLCLSYPQMLYIRKVNNIKEHLEHLLR
Pongo_abelii|10612      AFGYDDELYVSGQQ----------QFVPDLDSPFLCLYYPQMLYIRKISNIKEHLEHLLR
Pan_troglodytes|21697   AFGYDDELYVSGQQ----------QFVPDLDCPFLCLYYPQMLYIRKISNIEEHLEHLLR
Homo_sapiens|80761      AFGYDDELYVSGQQ----------QFVPDLDCPFLCLYYPQMLYIRKISNIKEHLEHLLR
Homo_sapiens|80603      AFGYDDELYVSGQQ----------QFVPDLDCPFLCLYYPQMLYIRKISNIKEHLEHLLR
                        *  :.  *.: . :          :*:.:: . * ** :  *: ::    :.:*::::* 

Rattus_norvegicus|19366 SLMTPLETLSITYYLISQKDLDSLSRSQSLFQLKHLDLSGVVLCDLDIMPLRGLLEKVAD
Rhesus_macaque|2741     CLKNPLRAFVFCHAYLADQDVECLSQYPSLSQLKELHLIHILMWTTNLEPLGALLEKAAA
Gorilla_gorilla|11617   CLKNLLVAFIFCHAYLADRELECLSQYPSLSQLKELRLIRILMWTTHLEPLGVLLEKVAA
Pongo_abelii|10612      CLKNPLGAFIFCHAYLADRDVECLSQYPSLSQLKELHLIHILMWTTNPEPLRALLEKVAA
Pan_troglodytes|21697   CLKNPLGTFIFCHAYLADRDMECLSQYPSLSQLKELHLIHILMGTTNLEPLGALLEKVAA
Homo_sapiens|80761      CLKNPLGTFIFCHAYLADQDMECLSQYPSLSQLKELHLIHILMWTTNLEPLGALLEKVAA
Homo_sapiens|80603      CLKNPLGTFIFCHAYLADQDMECLSQYPSLSQLKELHLIHILMWTTNLEPLGALLEKVAA
                        .* . * :: : :  :::::::.**:  ** ***.* *  :::   .  **  ****.* 

Rattus_norvegicus|19366 TLETLDLKWCRMNDSQLYALLPALRHCCQLTMVNFYSNNFSMHILKDLLQHTINWSRINV
Rhesus_macaque|2741     TLKSLTLKDCRIQDSQLRVLLPALSRCSQLTTFYFGGNETSTNALKDLLRHTGGLSKLGL
Gorilla_gorilla|11617   TLEILVLENCRIQDPQLRVLLPALSHCSQLTTFNFHGNETSTNALKDLLRHTGGLSKLGL
Pongo_abelii|10612      TLEILTLKNCQIQDSQLRVLLPALSHCSQLTTFYFHGNETSTNALKDLLRHTGGLSKLGL
Pan_troglodytes|21697   TLQILTLKDCQIQDSQLGLLLPALSRCSQLTTFYFRGNETSTNALKDLLRHTGGLSKLGL
Homo_sapiens|80761      TLEILTLKDCQIQDSQLRVLLPALSRCSQLTTFYFRGNETSTNALKDLLCHTGGLSKLGL
Homo_sapiens|80603      TLEILTLKDCQIQDSQLRVLLPALSRCSQLTTFYFRGNETSTNALKDLLCHTGGLSKLGL
                        **: * *: *:::*.**  ***** :*.*** . * .*: * : ***** ** . *::.:

Rattus_norvegicus|19366 ELYPAPLECYDDSAQVSVERFALLCPEIVDTLRAIRQPKSISFATDACQRCGERYVYHNG
Rhesus_macaque|2741     ELYPAPLESLDNRGHVNWEILAPIRAELMRTLREVRQPKRIFFGPVPCPSCGSWPSETVD
Gorilla_gorilla|11617   ELYPAPLESLDYKGHVNWEILIPIRAELMRTLREVRQPKRIFFGPVPCPTCGSWPSEKVD
Pongo_abelii|10612      ELYPAPLECLDNRGNVNWEILSPIRAELMRTLREVRQPKRIFFGPVPCPSCGSWPSEKVD
Pan_troglodytes|21697   ELYPAPLECLDNRGHVNWEILTPIRAELMRTLREFRQPKRIFFGPIPCPSCGSWPSEKVD
Homo_sapiens|80761      ELYPAPLECLDNRGHVNWEILAPIRAELMCTLREVRQPKRIFFGPIPCPSCGSWPSEKVD
Homo_sapiens|80603      ELYPAPLECLDNRGHVNWEILAPIRAELMCTLREVRQPKRIFFGPIPCPSCGSWPSEKVD
                        ********. *  .:*. * :  : .*:: *** .**** * *.. .*  **.      .

Rattus_norvegicus|19366 SRLCCCWQ
Rhesus_macaque|2741     FHLCS---
Gorilla_gorilla|11617   FHLC----
Pongo_abelii|10612      FHLCS---
Pan_troglodytes|21697   FHLCS---
Homo_sapiens|80761      FHLCS---
Homo_sapiens|80603      FHLCS---
                         :**