Orthologs Set ID: EOG4006BV


Orthology Database
OrthoDB4
Gene Symbol(s)
TOM1L1

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Anolis carolinensis 12939 109, 194, 273, 423
Bos taurus 9760 109, 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1441, 1526
Callithrix jacchus 51275 109, 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1441, 1526
Canis familiaris 27683 109, 194, 273, 423, 549, 696, 813, 947, 1017, 1151, 1270, 1326, 1441, 1526, 1576
Cavia porcellus 18337 109, 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1435, 1526
Choloepus hoffmanni 5376 194, 273, 387, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1441, 1526
Danio rerio 21516 273, 423, 564, 696, 813, 947, 1035, 1147, 1217, 1269, 1344, 1425, 1489
Dasypus novemcinctus 7205 109, 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1441, 1526
Dipodomys ordii 12963 109, 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1241, 1268, 1326, 1416, 1425, 1441, 1526
Echinops telfairi 18178 194, 273, 423, 549, 566, 592, 611, 630, 652, 675, 690, 696, 813, 947, 1008, 1017, 1147, 1268, 1326, 1441, 1526
Equus caballus 4395 947, 1017, 1147, 1268, 1333, 1441, 1526
Erinaceus europaeus 13757 109, 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1441, 1526
Felis catus 46567 77, 109, 194, 273, 341, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1441, 1526
Fugu rubripes 18278 109, 194, 273, 423, 567, 696, 813, 956, 1008, 1147, 1168, 1264, 1362, 1428, 1489
Gallus gallus 7181 109, 194, 273, 423, 543, 696, 813, 947, 1008, 1147, 1265, 1326, 1417, 1526
Gorilla gorilla 19974 109, 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1441, 1526
Homo sapiens 35585 109, 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1441, 1526
Loxodonta africana 14919 109, 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1367, 1377, 1441, 1526
Macropus eugenii 10709 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1441, 1526, 1595
Microcebus murinus 5590 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1441, 1526
Monodelphis domestica 9113 109, 194, 273, 314, 423, 546, 552, 696, 813, 947, 1017, 1147, 1268, 1326, 1435, 1526
Mus musculus 7147 109, 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1271, 1326, 1441, 1526
Myotis lucifugus 7417 273, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1441, 1526
Ochotona princeps 12652
Ochotona princeps 5227 109, 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1441
Ornithorhynchus anatinus 12277 194, 273, 423, 555, 696, 813, 947, 1017
Oryctolagus cuniculus 11447 109, 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1271, 1326, 1435, 1526
Pan troglodytes 16522 109, 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1441, 1526
Pongo abelii 11826 109, 194, 273, 423, 549, 696, 813
Procavia capensis 8466 194, 232, 273, 423, 549, 696, 705, 813, 912, 947, 1017, 1147, 1268, 1326, 1441, 1526
Pteropus vampyrus 12184 109, 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1441, 1526
Rattus norvegicus 6711 109, 194, 273, 423, 549, 696, 813, 947, 1014, 1147, 1271, 1326, 1441, 1526
Rhesus macaque 16910 109, 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1441, 1526
Sorex araneus 3827 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1184, 1268, 1326, 1441, 1526
Spermophilus tridecemlineatus 12163 77, 109, 194, 273, 423, 435, 474, 480, 483, 501, 513, 525, 549, 696, 813, 898, 935, 947, 1017, 1147, 1268, 1326, 1441, 1526
Sus scrofa 3743 109, 194, 273, 423, 549, 696
Taeniopygia guttata 4202 273, 423, 529, 555, 579, 696, 813
Tarsius syrichta 13906 109, 194, 273, 399, 423, 481, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1405, 1441, 1526
Tetraodon nigroviridis 22877 52, 109, 194, 273, 423, 558, 696, 813, 959, 1014, 1130, 1275, 1344, 1428, 1516, 1526
Tupaia belangeri 4456 109, 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1339, 1441, 1526, 1578
Tursiops truncatus 5172 109, 194, 273, 423, 440, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1441, 1526, 1534
Vicugna pacos 1270 194, 273, 423, 549, 696, 813, 947, 1017, 1147, 1268, 1326, 1441, 1526
Xenopus tropicalis 13716 109, 194, 273, 423, 573, 696, 813, 947, 1017, 1183, 1268, 1326, 1441, 1526

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 12939 ENSACAT00000017466 ENSACAG00000017394 TOM1L1 anoCar1
Bos taurus 9760 ENSBTAT00000009229 513303 ENSBTAG00000007013 TOM1L1 bosTau4
Callithrix jacchus 51275 ENSCJAT00000057653 100399921 ENSCJAG00000011347 TOM1L1 calJac3
Canis familiaris 27683 ENSCAFT00000027479 491093 ENSCAFG00000017340 TOM1L1 canFam2
Cavia porcellus 18337 ENSCPOT00000020851 100735540 ENSCPOG00000023145 TOM1L1 cavPor3
Choloepus hoffmanni 5376 ENSCHOT00000005383 ENSCHOG00000005361 TOM1L1 choHof1
Danio rerio 21516 ENSDART00000064078 553244 ENSDARG00000043638 tom1 danRer6
Dasypus novemcinctus 7205 ENSDNOT00000014851 101429753 ENSDNOG00000014848 TOM1L1 dasNov2
Dipodomys ordii 12963 ENSDORT00000001206 ENSDORG00000001206 Tom1l1 dipOrd1
Echinops telfairi 18178 ENSETET00000017659 101639106 ENSETEG00000017657 TOM1L1 TENREC
Equus caballus 4395 ENSECAT00000014842 100070513 ENSECAG00000014174 TOM1L1 equCab2
Erinaceus europaeus 13757 ENSEEUT00000012422 ENSEEUG00000012409 TOM1L1 eriEur1
Felis catus 46567 ENSFCAT00000002880 101086356 ENSFCAG00000002879 TOM1L1 felCat3
Fugu rubripes 18278 ENSTRUT00000016398 ENSTRUG00000006642 tom1 fr2
Gallus gallus 7181 ENSGALT00000034713 417391 ENSGALG00000003011 TOM1L1 galGal3
Gorilla gorilla 19974 ENSGGOT00000017187 101124198 ENSGGOG00000017131 TOM1L1 gorGor3
Homo sapiens 35585 ENST00000445275, NM_005486 10040 ENSG00000141198 TOM1L1 hg19,GRCh37
Loxodonta africana 14919 ENSLAFT00000011886 100666842 ENSLAFG00000011887 TOM1L1 loxAfr3
Macropus eugenii 10709 ENSMEUT00000010714 ENSMEUG00000010679 TOM1L1 Meug_1.0
Microcebus murinus 5590 ENSMICT00000005218 ENSMICG00000005217 TOM1L1 micMur1
Monodelphis domestica 9113 ENSMODT00000018933 100014933 ENSMODG00000014869 TOM1L1 monDom5
Mus musculus 7147 ENSMUST00000020849 71943 ENSMUSG00000020541 mm9
Myotis lucifugus 7417 ENSMLUT00000007321 102422099 ENSMLUG00000007320 TOM1L1 myoLuc1
Ochotona princeps 5227 ENSOPRT00000004114 ENSOPRG00000004109 OchPri2.0
Ochotona princeps 12652 ENSOPRT00000008146 101518485 ENSOPRG00000008157 OchPri2.0
Ornithorhynchus anatinus 12277 ENSOANT00000011582 ENSOANG00000007277 TOM1L1 ornAna1
Oryctolagus cuniculus 11447 ENSOCUT00000008461 100344255 ENSOCUG00000008462 TOM1L1 oryCun2.0
Pan troglodytes 16522 ENSPTRT00000017291 455138 ENSPTRG00000009421 TOM1L1 panTro2
Pongo abelii 11826 ENSPPYT00000029421 100446539 ENSPPYG00000025942 TOM1L1 ponAbe2
Procavia capensis 8466 ENSPCAT00000015977 ENSPCAG00000015955 TOM1L1 proCap1
Pteropus vampyrus 12184 ENSPVAT00000012978 ENSPVAG00000012979 TOM1L1 pteVam1
Rattus norvegicus 6711 ENSRNOT00000003369 287622 ENSRNOG00000002474 Tom1l1 rn4
Rhesus macaque 16910 ENSMMUT00000014761 710262 ENSMMUG00000010550 rheMac2
Sorex araneus 3827 ENSSART00000003763 ENSSARG00000003755 TOM1L1 sorAra1
Spermophilus tridecemlineatus 12163 ENSSTOT00000012164 101970810 ENSSTOG00000012160 Tom1l1 speTri1
Sus scrofa 3743 ENSSSCT00000019162 100522701 ENSSSCG00000017601 TOM1L1 susScr2
Taeniopygia guttata 4202 ENSTGUT00000009849 ENSTGUG00000009453 TOM1L1 taeGut1
Tarsius syrichta 13906 ENSTSYT00000004761 ENSTSYG00000004766 TOM1L1 tarSyr1
Tetraodon nigroviridis 22877 ENSTNIT00000002080 ENSTNIG00000006261 tom1 tetNig2
Tupaia belangeri 4456 ENSTBET00000004457 ENSTBEG00000004445 TOM1L1 tupBel1
Tursiops truncatus 5172 ENSTTRT00000011939 ENSTTRG00000011939 TOM1L1 turTru1
Vicugna pacos 1270 ENSVPAT00000009533 ENSVPAG00000009533 TOM1L1 vicPac1
Xenopus tropicalis 13716 ENSXETT00000009389 100170155 ENSXETG00000004317 tom1l1 xenTro2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 16837 ENSACAP00000017129 ENSACAG00000017394 TOM1L1 anoCar1
Bos taurus 9611 ENSBTAP00000009229 513303 ENSBTAG00000007013 TOM1L1 bosTau4
Callithrix jacchus 42275 ENSCJAP00000049832 100399921 ENSCJAG00000011347 TOM1L1 calJac3
Canis familiaris 6517 ENSCAFP00000025555 491093 ENSCAFG00000017340 TOM1L1 canFam2
Cavia porcellus 14404 ENSCPOP00000017230 100735540 ENSCPOG00000023145 TOM1L1 cavPor3
Choloepus hoffmanni 4753 ENSCHOP00000004758 ENSCHOG00000005361 TOM1L1 choHof1
Danio rerio 8425 ENSDARP00000064077 553244 ENSDARG00000043638 tom1 danRer6
Dasypus novemcinctus 6353 ENSDNOP00000011507 101429753 ENSDNOG00000014848 TOM1L1 dasNov2
Dipodomys ordii 12188 ENSDORP00000001129 ENSDORG00000001206 Tom1l1 dipOrd1
Echinops telfairi 14324 ENSETEP00000014343 101639106 ENSETEG00000017657 TOM1L1 TENREC
Equus caballus 11918 ENSECAP00000011880 100070513 ENSECAG00000014174 TOM1L1 equCab2
Erinaceus europaeus 11317 ENSEEUP00000011326 ENSEEUG00000012409 TOM1L1 eriEur1
Felis catus 12683 ENSFCAP00000002651 101086356 ENSFCAG00000002879 TOM1L1 felCat3
Fugu rubripes 16326 ENSTRUP00000016326 ENSTRUG00000006642 tom1 fr2
Gallus gallus 9605 ENSGALP00000034070 417391 ENSGALG00000003011 TOM1L1 galGal3
Gorilla gorilla 15823 ENSGGOP00000016716 101124198 ENSGGOG00000017131 TOM1L1 gorGor3
Homo sapiens 77708 ENSP00000408958 hg19,GRCh37
Loxodonta africana 11292 ENSLAFP00000009932 100666842 ENSLAFG00000011887 TOM1L1 loxAfr3
Macropus eugenii 9745 ENSMEUP00000009747 ENSMEUG00000010679 TOM1L1 Meug_1.0
Microcebus murinus 4758 ENSMICP00000004760 ENSMICG00000005217 TOM1L1 micMur1
Monodelphis domestica 13454 ENSMODP00000018598 100014933 ENSMODG00000014869 TOM1L1 monDom5
Mus musculus 4743 ENSMUSP00000020849 71943 ENSMUSG00000020541 mm9
Myotis lucifugus 6680 ENSMLUP00000006681 102422099 ENSMLUG00000007320 TOM1L1 myoLuc1
Ochotona princeps 11042 ENSOPRP00000007451 101518485 ENSOPRG00000008157 OchPri2.0
Ochotona princeps 4535 ENSOPRP00000003790 ENSOPRG00000004109 OchPri2.0
Ornithorhynchus anatinus 11217 ENSOANP00000011580 ENSOANG00000007277 TOM1L1 ornAna1
Oryctolagus cuniculus 507 ENSOCUP00000007311 100344255 ENSOCUG00000008462 TOM1L1 oryCun2.0
Pan troglodytes 24764 ENSPTRP00000016008 455138 ENSPTRG00000009421 TOM1L1 panTro2
Pongo abelii 23522 ENSPPYP00000023564 100446539 ENSPPYG00000025942 TOM1L1 ponAbe2
Procavia capensis 7938 ENSPCAP00000014950 ENSPCAG00000015955 TOM1L1 proCap1
Pteropus vampyrus 11482 ENSPVAP00000012238 ENSPVAG00000012979 TOM1L1 pteVam1
Rattus norvegicus 18627 ENSRNOP00000003369 287622 ENSRNOG00000002474 Tom1l1 rn4
Rhesus macaque 23916 ENSMMUP00000013829 710262 ENSMMUG00000010550 rheMac2
Sorex araneus 3395 ENSSARP00000003407 ENSSARG00000003755 TOM1L1 sorAra1
Spermophilus tridecemlineatus 10902 ENSSTOP00000010905 101970810 ENSSTOG00000012160 Tom1l1 speTri1
Sus scrofa 18591 ENSSSCP00000018655 100522701 ENSSSCG00000017601 TOM1L1 susScr2
Taeniopygia guttata 13228 ENSTGUP00000009743 ENSTGUG00000009453 TOM1L1 taeGut1
Tarsius syrichta 12749 ENSTSYP00000004353 ENSTSYG00000004766 TOM1L1 tarSyr1
Tetraodon nigroviridis 21341 ENSTNIP00000002105 ENSTNIG00000006261 tom1 tetNig2
Tupaia belangeri 3837 ENSTBEP00000003846 ENSTBEG00000004445 TOM1L1 tupBel1
Tursiops truncatus 4873 ENSTTRP00000011324 ENSTTRG00000011939 TOM1L1 turTru1
Vicugna pacos 1183 ENSVPAP00000008868 ENSVPAG00000009533 TOM1L1 vicPac1
Xenopus tropicalis 1331 ENSXETP00000009389 100170155 ENSXETG00000004317 tom1l1 xenTro2

multiple sequence alignment in CLUSTALW format


Xenopus_tropicalis|13716            ---------------------------------------------------ATGGCTTTT
Tupaia_belangeri|4456               ---------------------------------------------------ATGGCGTTT
Ornithorhynchus_anatinus|12277      ------------------------------------------------------------
Felis_catus|46567                   ---------------------------------------------------ATGGCGCAT
Erinaceus_europaeus|13757           ---------------------------------------------------ATGGCGTTT
Monodelphis_domestica|9113          ---------------------------------------------------ATGGCGTTT
Macropus_eugenii|10709              ------------------------------------------------------------
Anolis_carolinensis|12939           ---------------------------------------------------ATGGCTTTC
Gallus_gallus|7181                  ------------------------------------------------------------
Taeniopygia_guttata|4202            ------------------------------------------------------------
Dasypus_novemcinctus|7205           ---------------------------------------------------ATGGCGTTT
Myotis_lucifugus|7417               ------------------------------------------------------------
Procavia_capensis|8466              ------------------------------------------------------------
Choloepus_hoffmanni|5376            ------------------------------------------------------------
Vicugna_pacos|1270                  ------------------------------------------------------------
Sorex_araneus|3827                  ------------------------------------------------------------
Ochotona_princeps|5227              ---------------------------------------------------ATGGCGTTT
Dipodomys_ordii|12963               ---------------------------------------------------ATGGCGTTT
Spermophilus_tridecemlineatus|12163 ---------------------------------------------------ATGGCGTTT
Ochotona_princeps|12652             ---------------------------------------------------ATGGCGTTT
Oryctolagus_cuniculus|11447         ---------------------------------------------------ATGGCGTTT
Sus_scrofa|3743                     ---------------------------------------------------ATGGCGTTC
Echinops_telfairi|18178             ------------------------------------------------------------
Cavia_porcellus|18337               ---------------------------------------------------ATGGCGTTT
Rattus_norvegicus|6711              ---------------------------------------------------ATGGCGTTT
Bos_taurus|9760                     ---------------------------------------------------ATGGCGTTC
Loxodonta_africana|14919            ---------------------------------------------------ATGGCGTTT
Mus_musculus|7147                   ---------------------------------------------------ATGGCGTTT
Tursiops_truncatus|5172             ---------------------------------------------------ATGGCGTTC
Canis_familiaris|27683              ---------------------------------------------------ATGGCGTTT
Pteropus_vampyrus|12184             ---------------------------------------------------ATGGCGTTT
Tarsius_syrichta|13906              ---------------------------------------------------ATGGCGTTT
Microcebus_murinus|5590             ------------------------------------------------------------
Equus_caballus|4395                 ------------------------------------------------------------
Callithrix_jacchus|51275            ---------------------------------------------------ATGGCGTTT
Rhesus_macaque|16910                ---------------------------------------------------ATGGCGTTT
Homo_sapiens|35585                  ---------------------------------------------------ATGGCGTTT
Pan_troglodytes|16522               ---------------------------------------------------ATGGCGTTT
Gorilla_gorilla|19974               ---------------------------------------------------ATGGCGTTT
Pongo_abelii|11826                  ---------------------------------------------------ATGGCGTTT
Danio_rerio|21516                   ------------------------------------------------------------
Tetraodon_nigroviridis|22877        TCTCCCATGGACTTACCAGTCTGTTTTTCTTCCGAGGTCGCCTTGTCCCGCTTCAACATG
Fugu_rubripes|18278                 ---------------------------------------------------ATGGAATTT
                                                                                                

Xenopus_tropicalis|13716            GGGAAGAGTTCCAAGGATCCGTTCAGCACTCCCGTGGGACACTTAATTGATATTCACACA
Tupaia_belangeri|4456               GCCAAGGGTCACCGGGATCCCTACGCGACCTCCGTGGGCCACCTGATAGNNNNNNNNNNN
Ornithorhynchus_anatinus|12277      ------------------------------------------------GAAAAGAGTACG
Felis_catus|46567                   GGGAAGAGTCACCGGGATATTTATGCTACCTTCGTGGGCCACTTCATAANNNNNNNNNNN
Erinaceus_europaeus|13757           GGGAAAAATCATCGGGATCCCTATGCGACCTCTGTGGGCCACCTAATAGAAAAGGCTACA
Monodelphis_domestica|9113          GGGAAGAGCCACAAAGATCCCTTCGGGACTTCAATGGGCCACCTCATAGAAAAGGCTACA
Macropus_eugenii|10709              ---------------------------------------------------AAGGCTACA
Anolis_carolinensis|12939           GGGAAGAGCCAGAAGGACCCCTTCGGCACCGCCGTGGGACACCTGATCGAAAAGGCTACA
Gallus_gallus|7181                  GGGAAGGTGCCCAAAGACCCGTTCGGCACCGCCGTGGGGAGCCTGGTGGAGCGGGCGACG
Taeniopygia_guttata|4202            ------------------------------------------------------------
Dasypus_novemcinctus|7205           GGGAAGAGCCACCGGGACCCCTACGCGACCTCCGTGGGCCACCTCATAGAAAAGGCAACA
Myotis_lucifugus|7417               ------------------------------------------------------------
Procavia_capensis|8466              ---------------------------------------------------AAGGCTACA
Choloepus_hoffmanni|5376            ---------------------------------------------------AAGGCTACA
Vicugna_pacos|1270                  ---------------------------------------------------AAGGCTACA
Sorex_araneus|3827                  ---------------------------------------------------AAGGCTACA
Ochotona_princeps|5227              GGGAAGAGTCACCGGGATCCCTATGCCACCTCCGTGGGCCACCTCATAGAAAAGGCTACA
Dipodomys_ordii|12963               GGGAAGAGTCACCGGGATCCCTACGCGACCTCCGTGGGCCACCTGATAGAAAAGGCTACA
Spermophilus_tridecemlineatus|12163 GGGAAGAGCCACCGGGGCCCTTACGGCACCTTCGTGGGGCAACTCATAGAAAAGGCTACA
Ochotona_princeps|12652             GGGAAGAGTCACCGGGATCCCTATACCACCTCCGTGGGCCACCTCATAGAAAAGGCTACA
Oryctolagus_cuniculus|11447         GGGAAGAGTCACCGGGATCCTTATGCTACCTCCGTGGGCCACCTCATAGAAAAGGCTACA
Sus_scrofa|3743                     GGGAAGAGTCATCGGGACCCGTACGCGACCTCCGTGGGCCAGCTCATAGAAAAGGCTACA
Echinops_telfairi|18178             ---------------------------------------------------AAAGCTACA
Cavia_porcellus|18337               GGGAAGGGCCACCGCGACCCCTACGCGACCTCCGTGGGCCACCTCGTGGAAAAAGCTACA
Rattus_norvegicus|6711              GGGAAGAGTCACCGCGATCCCTACGCTACCTCTCTGGGTCACCTCATAGAAAAGGCCACC
Bos_taurus|9760                     GGCAGGAGTCACCGGGACCCGTACGCGAACTCCCTGGGCCAGCTGATAGAAAAGGCTACA
Loxodonta_africana|14919            GGGAAGAGTCACCGGGATCCCTACGGGACCCCGTTGGGCCACCTCATAGAAAAGGCTACG
Mus_musculus|7147                   GGGAAGAGTCACCGCGATCCTTACGCTACCTCTGTGGGTCACCTCATAGAAAAGGCCACT
Tursiops_truncatus|5172             GGGAAGAGTCACCGGGACCCATACGCGACCTCCGTGGGCCAGCTCATAGAAAAGGCTACA
Canis_familiaris|27683              GGCAGGAGTCACCGGGATCCCTATGCGACCTCCGTGGGCCACCTCATAGAAAAGGCTACA
Pteropus_vampyrus|12184             GGGAAGAGTCACCGGGATCCCTATGCGACTTCCGTGGGCCACCTCATAGAAAAGGCTACA
Tarsius_syrichta|13906              GGCAAGAGTCATCGGGATCCCTACGCGACCTCGGTGGGCCACCTCATAGAAAAGGCTACA
Microcebus_murinus|5590             ---------------------------------------------------AAGGCTACG
Equus_caballus|4395                 ------------------------------------------------------------
Callithrix_jacchus|51275            GGCAAGAGTCACCGGGATCCCTACGCGACCTCAGTGGGCCACCTCATAGAAAAGGCTACA
Rhesus_macaque|16910                GGCAAGAGTCACCGGGATCCCTACGCGACCTCCGTGGGCCACCTCATAGAAAAGGCTACA
Homo_sapiens|35585                  GGCAAGAGTCACCGGGATCCCTACGCGACCTCCGTGGGCCACCTCATAGAAAAGGCTACA
Pan_troglodytes|16522               GGCAAGAGTCACCGGGATGCCTACGCGACCTCCGTGGGCCACCTCATAGAAAAGGCTACA
Gorilla_gorilla|19974               GGCAAGAGTCACCGGGATCCCTATGCGACCTCCGTGGGCCACCTCATAGAAAAGGCTACC
Pongo_abelii|11826                  GGCAAGAGTCACCGGGATCCCTACGCGACCTCCGTGGGCCACCTCATAGAAAAGGCTACA
Danio_rerio|21516                   ------------------------------------------------------------
Tetraodon_nigroviridis|22877        GAATTTCTTTTAGGGAACCCGTTTGGAACCGCAGTCGGACAGCGAATCGAGAGTGCGACA
Fugu_rubripes|18278                 ------CTTTTAGGGAACCCATTTGGAACCCCGGTGGGACAGCGAATCGAGAGTGCAACC
                                                                                                

Xenopus_tropicalis|13716            GCCAGTACTCTACAAAATGAAGACTGGGGTCAGTTTATGAATATATGTGATGTCATCAAT
Tupaia_belangeri|4456               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|12277      GTCGGAACGACACGGTCCGAAAACTGGGATCGGTTTCTGCGCATCTGCGACCTCATTAAT
Felis_catus|46567                   NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Erinaceus_europaeus|13757           TTTGCTGGAGTTCAGACTGAAGATTGGGGACAGTTCATGCATATTTGTGACATAATTAAT
Monodelphis_domestica|9113          TTTGCAGGCGTTCAAACTGAAGATTGGGGTCAATTCATGCACATCTGTGATATGATTATC
Macropus_eugenii|10709              TTTGCAGGCGTTCAGACTGAGGATTGGGGCCAGTTCATGCACATCTGTGACATGATTATC
Anolis_carolinensis|12939           TTTGGAGGACTACAGACAGAAGAGTGGGGTCAGTTCATGCATATCTGTGACATCATCAAC
Gallus_gallus|7181                  TTCGGATCGCTGCAGACGGAGGAGTGGGGGCAATTCATGCACATCTGCGACGTGATCAAC
Taeniopygia_guttata|4202            ------------------------------------------------------------
Dasypus_novemcinctus|7205           TTTGCTGGAGTTCAGACTGAAGACTGGGGCCAGTTCATGCACATCTGTGACATGATTAAC
Myotis_lucifugus|7417               ------------------------------------------------------------
Procavia_capensis|8466              TTTGCTGGAGTTCAGACTGAAGACTGGGGCCAGTTCATGCACATCTGTGATATAATCAAC
Choloepus_hoffmanni|5376            TTTGCTGGAGCTCAGACTGAAGATTGGGGCCGGTTCATGCACATCTGTGACATAATTAAC
Vicugna_pacos|1270                  TTTGCTGGAGCTCAGACTGAAGACTGGGGCCAGTTCATGCACATCTGTGACATAATTAAC
Sorex_araneus|3827                  TTTGCTGGAGTTCAGACTGAAGACTGGGGCCAGTTCATGCACATCTGTGACATAATTAAT
Ochotona_princeps|5227              TTTGCTGGAGTCCAGACGGAAGATTGGGGTCAGTTCATGCATATCTGTGACATAATTAAC
Dipodomys_ordii|12963               TTTGCTGGAGTTCAGACTGAAGACTGGGGCCAGTTCATGCACATCTGTGACATAATTAAT
Spermophilus_tridecemlineatus|12163 TTTGCTGGAGTTCAGACTGAAGACTGGGGCCAGTTCATGCACATCTGTGACATAATTAAC
Ochotona_princeps|12652             TTTGCTGGAGTCCAGACAGAAGATTGGGGTCAGTTCATGCATATCTATGACATAATTAAC
Oryctolagus_cuniculus|11447         TTCGCTGGTCTCCAGACTGAAGATTGGGGTCAGTTCATGCACATCTGTGACATCATTAAC
Sus_scrofa|3743                     TTTGCTGGGGTTCAGACTGAAGATTGGGGCCAGTTCATGCACATCTGTGACATAATTAAC
Echinops_telfairi|18178             TTTGCTGGAGTTCAGACTGAAGACTGGGGCCAGTTCATGCATATCTGTGATGTCATCAAC
Cavia_porcellus|18337               TTTGCTGGTGCTCAGACTGAAGACTGGGGTCAATTCATGCATATCTGCGATATAATTAAC
Rattus_norvegicus|6711              TTTGCTGGAGTTCAGACAGAAGACTGGGGCCAGTTCATGCATATCTGTGACATAATTAAC
Bos_taurus|9760                     TTTGCTGGAGTGCAGACGGAAGACTGGGGTCAGTTCATGCACATCTGTGACATAATTAAC
Loxodonta_africana|14919            TTTGCTGGAGTTCAAACTGAAGACTGGGGCCAGTTCATGCACATCTGTGATATAATAAAC
Mus_musculus|7147                   TTTGCTGGAGTTCTGACTGAAGACTGGGGCCAGTTCCTGCACATCTGTGACATAATTAAC
Tursiops_truncatus|5172             TTTGCTGGAGTTCAGACTGAAGATTGGGGCCAGTTCATGCACATCTGTTACATAATTAAC
Canis_familiaris|27683              TTTGCTGGAGTCCAAACTGAAGATTGGGGCCAGTTTATGCACATCTGTGACATAATTAAC
Pteropus_vampyrus|12184             TTTGCTGGCGTTCAGACTGAAGATTGGGGCCAGTTCATGCACATTTGTGATATTATTAAC
Tarsius_syrichta|13906              TTTGCTGGAGTTCAGACTGAAGATTGGGGCCAGTTCATGCATATCTGTGACATGATTAAC
Microcebus_murinus|5590             TTTGCTGGAGTTCAGACTGAAGACTGGGGCCAGTTCATGCACATCTGTGACATAATTAAC
Equus_caballus|4395                 ------------------------------------------------------------
Callithrix_jacchus|51275            TTTGCTGGAGTTCAGACTGAAGATTGGGGCCAGTTCATGAACATCTGTGACATAATTAAC
Rhesus_macaque|16910                TTTGCTGGAGTTCAGACTGAAGATTGGGGCCAGTTCATGCACATCTGTGACATAATTAAC
Homo_sapiens|35585                  TTTGCTGGAGTTCAGACTGAAGATTGGGGCCAGTTCATGCACATCTGTGACATAATTAAC
Pan_troglodytes|16522               TTTGCTGGAGTTCAGACTGAAGATTGGGGCCAGTTCATGCACATCTGTGACATAATTAAC
Gorilla_gorilla|19974               TTTGCTGGAGTTCAGACTGAAGATTGGGGCCAGTTCATGCACATCTGTGACATAATTAAC
Pongo_abelii|11826                  TTTGCTGGAGTTCAGACTGAAGATTGGGGCCAGTTCATGCACATCTGTGACATAATTAAC
Danio_rerio|21516                   ------------------------------------------------------------
Tetraodon_nigroviridis|22877        GGTTCCAGCCTTGTATCAGAAGACTGGGCCCTTATTATGGAGATCTGTAACATGATCAAC
Fugu_rubripes|18278                 AGTTCCAGCCTCGTATCAGAAGACTGGACCCTTAATATGGAGATCTGCGACTTGATCAAT
                                                                                                

Xenopus_tropicalis|13716            ACAACAGCAGATGGGCCAAAAGATGCAGTCAAGGCTTTTAGGAAAAGGATATGCAGAAAC
Tupaia_belangeri|4456               NNNNNNNNNNNNNNACCAAAAGATGCAGTAAAAGCTTTGAAGAAGAGGATTTCCAAAAAC
Ornithorhynchus_anatinus|12277      ACCACTCAGGGAGGGCCAAGAGATGCCGTAAGAGCGCTGAAAAAAAGGCTCTCCCAAAAT
Felis_catus|46567                   NNNNNNNNNNNNNNGCCAAAAGATGCAGTAAAAGCTTTGAAGAAAAGNNNNNNNNNNNNN
Erinaceus_europaeus|13757           ACTGCTCACGATGGGCCAAAAGATGCAGTAAAAGCTTTGAAGAAAAGGATTTTCAAAAAT
Monodelphis_domestica|9113          ACCAGCAAAGACGGGTCAAAAGAAGCAGTAAGAGCTTTCAAGAAAAGGATTTCTAAAAAT
Macropus_eugenii|10709              ACCAGCAAAGATGGGCCAAAAGAAGCAGTAAGAGCTTTGAAGAAAAGGATTTCTAAAAAC
Anolis_carolinensis|12939           TCAACAGCACAAGGGCCAAAGGATGCCATCAGAGCTTTAAGGAAAAAGCTGTCCAAAAAC
Gallus_gallus|7181                  GCCACGGAGGAGGGGCCTAAGGATGCAGTCAAAGCGTTAAAGAAAAAGCTTTCAAAAAAC
Taeniopygia_guttata|4202            ---------------CCTAAAGATGCAGTTAAAGCACTGAAGAAGAAGCTTTCAAAAAAC
Dasypus_novemcinctus|7205           ACTATCCCTGATGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Myotis_lucifugus|7417               ---------------CCAAAGGATGCCGTAAAAGCTTTGAAGAAAAGGATTTCCAAAAAC
Procavia_capensis|8466              ACTGCCCAAGATGGGCCCAAAGATGCAGTAAAAGCTTTGAAGAAAAGGATTTCCAAAAAC
Choloepus_hoffmanni|5376            TCTGCCCACGATGGGCCAAAAGATGCAGTAAAAGCTTTGAAGAAAAGAATTTCCAAAAAC
Vicugna_pacos|1270                  ACTACCCAGGATGGGCCAAAAGATGCAGTGAAAGCTTTGAAGAAAAGGATTTCCAAAAAC
Sorex_araneus|3827                  ACTACCGGTGACGGGCCAAAAGATGCAGTAAAAGCTTTGAAGAAAAGGATTTCCAAAAAC
Ochotona_princeps|5227              ACAACCCAGGAAGGACCAAAAGATGCAGTGAAAGCTTTGAAGAAACGAATCTCCAAAAAC
Dipodomys_ordii|12963               GCCACCCAGGACGGGCCAAAAGATGCAGCAAAAGCTTTGAAGAAAAGGATCTCCAGAAAC
Spermophilus_tridecemlineatus|12163 ACTACCCAGGATGGGCCAAAAGATGCAGTGAAAGCTTTGAAGAAAAGAATTTCCAAAAAT
Ochotona_princeps|12652             ACAACACAGGAAGGACCAAAAGATGCAGTGAAGGCTTTGAAGAAACGAATCTCCAAAAAC
Oryctolagus_cuniculus|11447         ACCACCCAGGAAGGGCCAAAAGATGCAGTAAAAGCTTTGAAGAAAAGGATATCCAAAAAC
Sus_scrofa|3743                     ACTACCCAAGATGGGCCAAAAGATGCAGTAAAAGCTTTGAAGAAAAGGATTTCCAAAAAC
Echinops_telfairi|18178             ACCTCCCAAGATGGGCCAAAAGATGCAGTGAAAGCTTTGAAGAAAAGGATTTCCAAAAAC
Cavia_porcellus|18337               ACTACGCAGGATGGGCCAAAAGATGCAGTGAAAGCTTTGAAGAAAAGGATTTCCAAAAAC
Rattus_norvegicus|6711              ACCACACAAGACGGGCCAAAAGATGCAGTAAAAGCTTTGAAGAAAAGGATCTCCAAAAAC
Bos_taurus|9760                     ACCACCCAGGATGGGCCAAAAGATGCAGTAAAAGCTTTGAAGAAAAGGATTTCCAAAAAC
Loxodonta_africana|14919            ACTGTCCAGGATGGGCCAAAAGATGCAGTAAAAGCTTTGAAGAAAAGGATTTCCAAAAAC
Mus_musculus|7147                   ACCACACAGGACGGGCCAAAAGATGCAGTAAAAGCTTTGAAGAAAAGGATCTCCAAAAAC
Tursiops_truncatus|5172             ACTGCCCACGATGGGCCAAAAGATGCAGTAAAAGCTTTGAAGAAAAGGATTTCCAAAAAT
Canis_familiaris|27683              ACTGCCCACGATGGGCCAAAAGATGCAGTAAAAGCTTTGAAGAAAAGGATTTCCAAAAAC
Pteropus_vampyrus|12184             ACTGCCAACGATGGGCCAAAAGATGCAGTAAAAGCTTTGAAGAAAAGGATTTCTAAAAAC
Tarsius_syrichta|13906              ACTGCCCAGGATGGGCCAAAAGATGCAGTAAAAGCTTTGAAGAAAAGGATTTCCAAAAAT
Microcebus_murinus|5590             ACTACCCAGGATGGGCCAAAAGATGCAGTAAAAGCTTTGAAGAAAAGGATTTCCAAAAAC
Equus_caballus|4395                 ------------------------------------------------------------
Callithrix_jacchus|51275            ACCACGCAGGATGGGCCAAAAGATGCAGTGAAAGCTTTGAAGAAAAGGATTTCCAAAAAC
Rhesus_macaque|16910                ACTACCCAGGATGGGCCAAAAGATGCAGTGAAAGCTTTGAAGAAAAGGATTTCCAAAAAC
Homo_sapiens|35585                  ACTACCCAGGATGGGCCAAAAGATGCAGTGAAAGCTTTGAAGAAAAGGATTTCCAAAAAC
Pan_troglodytes|16522               ACTACCCAGGATGGGCCAAAAGATGCAGTGAAAGCTTTGAAGAAAAGGATTTCCAAAAAC
Gorilla_gorilla|19974               ACTACCCAGGATGGGCCAAAAGATGCAGTGAAAGCTTTGAAGAAAAGGATTTCCAAAAAC
Pongo_abelii|11826                  ACTACCCAGGATGGGCCAAAAGATGCAGTGAAAGCTTTGAAGAAAAGAATTTCCAAAAAC
Danio_rerio|21516                   ---------------CCTAAAGATGCAGTCAGAGCAATAAAGAAGAGGATTCTCGGAAAC
Tetraodon_nigroviridis|22877        AGTTCAGAAGAAGGACCCAAAGATGCAGTAAGAGCTATAAAGAAACGAATTGTGGGGAAC
Fugu_rubripes|18278                 AGTTCTGAAGAAGGACCCAAAGATGCAGTAAGAGCTATaaaaaaaCGGATTGTTGGGAAC
                                                                                                

Xenopus_tropicalis|13716            TACAACCAGAAGGAAGTGAAATTTTCACTTTTGCTGCTGGAGATGTGCATGCAGAATTGT
Tupaia_belangeri|4456               TACAATCATAAAGAAATCCAACTTACCTTATCACTTATTGACATGTGCATGCAGAACTGT
Ornithorhynchus_anatinus|12277      TGCAACCACAAGGAAATCCGCCTCACCCTCTCGCTGCTGGACCTGTGCGTGCGCAACTGT
Felis_catus|46567                   NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Erinaceus_europaeus|13757           TATAATCATAAAGAAATTCAACTTACATTGTCACTTATTGACATGTGCATGCAGAACTGC
Monodelphis_domestica|9113          TGTAATCATAAGGAGATCCAGCTTACCTTATCACTTCTTGACATGTGTATGCAGAACTGT
Macropus_eugenii|10709              TGTAATCACAAGGAGATCCAACTTACCTTATCGCTTATTGACATGTGTATGCAGAACTGT
Anolis_carolinensis|12939           TGCAATCATGTTGAGATCCGTCTTACCCTGTCGCTCCTTGAGATGTGCATGCAGAACTGT
Gallus_gallus|7181                  TGTAACCATAAGGAGATCAGGCTCACCCTGTCTCTGCTTGACATGTGTATGCAGAACTGT
Taeniopygia_guttata|4202            TGTAACCACAAGGAGATCAGGCTTACCTTGTCTCTGCTAGAGATGTGTATGGAGAACTGT
Dasypus_novemcinctus|7205           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Myotis_lucifugus|7417               TACAATCATAAAGAAATCGAACTTACTTTGTCGNNNNNNNNNNNNNNNNNNNNNNNNNNN
Procavia_capensis|8466              TACAATCATAAAGAAATCCAACTTACTTTATCGCTCATTGACATGTGTATGCAGAACTGT
Choloepus_hoffmanni|5376            TACAATCATAAAGAAATTCAACTTACCTTGTCANNNNNNNNNNNNNNNNNNNNNNNNNNN
Vicugna_pacos|1270                  TACAATCATAAAGAAATCCAACTCACCTTGTCACTTATTGACATGTGCGTGGAGAACTGT
Sorex_araneus|3827                  TACAATCATAAAGAAATCCAACTTACCTTGTCACTTATTGACATGTGCATGCAGAACTGT
Ochotona_princeps|5227              TACAATCATAAAGAAATCCAACTTACCTTGTCACTTATTGACATGTGCATGCAGAATTGT
Dipodomys_ordii|12963               TACAACCATAAGGAAATCCAACTCACCTTGTCACTGATTGACATGTGCATGCAGAACTGT
Spermophilus_tridecemlineatus|12163 TACAATCATAAAGAAATCCAACTTACCTTGTCACTCATTGACATGTGCATGCAGAACTGT
Ochotona_princeps|12652             TACAATCATAAAGAAATCCAACTTACCTTGTCACTTATTGACATGTGCATGCAGAATTGT
Oryctolagus_cuniculus|11447         TACAATCATAAAGAAATCCAACTTACCTTGTCACTTATAGACATGTGCATGCAGAACTGT
Sus_scrofa|3743                     TACAATCATAAAGAAATCCAGCTTACCTTGTCACTTATCGACATGTGTGTGCAGAATTGT
Echinops_telfairi|18178             TACAACCATAAAGAAATCCAACTTACTTTGTCACTTATTGACATGTGCATGCAGAACTGT
Cavia_porcellus|18337               TACAATCATAAAGAAATCCAACTCACCTTGTCACTTATTGACATGTGTATGCAGAACTGT
Rattus_norvegicus|6711              TACAACCACAAAGAAATCCAACTTTCCTTATCACTCATTGACATGTGCATGCAGAACTGT
Bos_taurus|9760                     TATAATCATAAAGAAATCCAACTCACCTTGTCACTTATTGACATGTGCATGCAGAACTGT
Loxodonta_africana|14919            TATAATCATAAAGAAATCCAACTTACTTTGTCACTTATTGACATGTGCGTGGAGAACTGT
Mus_musculus|7147                   TATAACCACAAAGAAATCCAACTTTCCTTATCACTCATTGACATGTGCGTGCAGAACTGT
Tursiops_truncatus|5172             TACAATCATAAAGAAATACAACTTACCTTGTCACTTATTGACGTGTGTATGCAGAACTGT
Canis_familiaris|27683              TACAATCATAAAGAAATCCAACTCACTTTGTCACTTATTGACATGTGCATGCAGAACTGT
Pteropus_vampyrus|12184             TACAATCATAAAGAAATCGAACTTACCTTGTCACTTATTGACATGTGCATGCAGAACTGT
Tarsius_syrichta|13906              TACAATCATAAAGAAATCCAACTTACCTTGTCACTTATTGACATGTGCGTGCAGAACTGT
Microcebus_murinus|5590             TACAATCATAAAGAAATACAACTTACCTTGTCACTTATTGACATGTGCATGCAGAACTGT
Equus_caballus|4395                 ------------------------------------------------------------
Callithrix_jacchus|51275            TACAATCATAAAGAAATTCAACTTACCTTGTCACTTATTGACATGTGCGTGCAGAACTGT
Rhesus_macaque|16910                TACAATCATAAAGAAATCCAACTTACCTTGTCACTTATTGACATGTGCGTGCAGAACTGT
Homo_sapiens|35585                  TACAATCATAAAGAAATCCAACTTACCTTGTCACTTATTGACATGTGTGTGCAGAACTGT
Pan_troglodytes|16522               TACAATCATAAAGAAATCCAACTTACCTTGTCACTTATTGACATGTGTGTGCAGAACTGT
Gorilla_gorilla|19974               TACAATCATAAAGAAATCCAACTTACCTTGTCACTTATTGACATGTGTGTGCAGAACTGT
Pongo_abelii|11826                  TACAATCATAAAGAAATCCAACTTACCTTGTCACTTATTGACATGTGTGTGCAGAACTGT
Danio_rerio|21516                   AGGAATTTCAAAGAGGTCATGCTGGCTTTGAGTGTTTTGGAAGCCTGTGTGAAGAACTGC
Tetraodon_nigroviridis|22877        AAAAACTTTAAGGAGGTTATGCTGGCACTCACAGTGCTGGAAGCTTGTGTAAAGAACTGT
Fugu_rubripes|18278                 AAGAATTTTAAGGAGGTTATGCTGACACTTACAGTGCTAGAAACTTGTGTGAAGAACTGT
                                                                                                

Xenopus_tropicalis|13716            GTCCCTACGTTCCATTCCTTGGTGCTGAAGAAGGACTTTTCCAAGGATGTGCTTGTCAAA
Tupaia_belangeri|4456               GGTCCAAGTTTCCAGTCTTTGATTGTGAAGAAGGAATTTGTGAAAGATGGTCTGGTTAAG
Ornithorhynchus_anatinus|12277      GGGCCAAGCTTCCGGGCTCTGGTTGTGAAGAAGGATTTTGCCAAAGACAAACTGACCGAG
Felis_catus|46567                   NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAAAGATAGTCTGGTTAAG
Erinaceus_europaeus|13757           GGTCCAAGTTTCCAGTCTCTAATTGTGAAGAAGGAATTTGTTAAAGATAGTCTAGCTAAA
Monodelphis_domestica|9113          GGCCCAACTTTCCATCAAACCTTGTCAAAACTTTTATTTCTAAAAAAAAAAACAAAAAAA
Macropus_eugenii|10709              GGCCCAAGTTTCCAGGCCCTGATTGTGAAGAGGGACTTCACTAAGGATCATCTAGTTAAG
Anolis_carolinensis|12939           GGTCCGCATTTCAAGTCTCTGGTTGTAAGAAGGGAATTCTGCAGAGACAGACTAGTGAAG
Gallus_gallus|7181                  GGTCCAAGGTTCCAGTCTTTAGTTGTGAAGAAGGACTTCTGCAAGGACAAGCTGGTGAAA
Taeniopygia_guttata|4202            GGCCCAAGATTCCAGTCTTTAGTTGTGAAGAAGGATTTCTGCAAAGACAAGCTGGTGAAA
Dasypus_novemcinctus|7205           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Myotis_lucifugus|7417               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Procavia_capensis|8466              GGTCCACGTTTCCAGTCTCTGATAGTGAAGAAGGAATTCTTGAAAGATGGTCTAGTTAAG
Choloepus_hoffmanni|5376            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Vicugna_pacos|1270                  GGTCCGAGTTTCCAGTCTCTGATTGTGAAGAAGGAATTTGTTAAAGACAGTCTAGTTAAG
Sorex_araneus|3827                  GGTCCACGTTTCCAGTCTCTGATTGTGAAGAAGGAATTCGTTAAAGATAGTTTAGTTAAG
Ochotona_princeps|5227              GGTCCAAGTTTCCAGTCTCTGATTGTGAAGAAGGACTTCATTAAAGATAGTCTAGTTAAG
Dipodomys_ordii|12963               GGACCGAATTTCCAGTCTTTGATTGTGAAGAAGGATTTTGTCAAAGATAGTCTAGNNNNN
Spermophilus_tridecemlineatus|12163 GGTCCAAGTTTCCAATCTCTGATTGTGAAGAAAGAATTCATTAAAGATAGTCTGGTTAAG
Ochotona_princeps|12652             GGTCCAAGTTTCCAGTCTCTGATTGTGAAGAAGGACTTAGTTAAAGATAGTCTAGTTAAG
Oryctolagus_cuniculus|11447         GGTCCAAGTTTCCAATCTCTGATTGTGAAGAAAGAATTCATTAAAGATAGTCTAGTTAAG
Sus_scrofa|3743                     GGTCCGCGTTTCCACTCTCTGATTGTGAAGAAGGAATTTGTTAAAGATAGTCTAGCTAAG
Echinops_telfairi|18178             GGTCCAAGTTTCCAATCTCTGATTGCAAAGAAGGAGTTCGTGAAAGATTGTCTAGTTAAG
Cavia_porcellus|18337               GGGCCGAGTTTCCAGGCTCTGATTGTGAAGAAGGACTTCATTAAAGATAGCCTCGTGAAG
Rattus_norvegicus|6711              GGGCCGAGTTTCCAATCTCTGATTGTGAAGAAGGAGTTCGTTAAAGATACTCTAGTTAAG
Bos_taurus|9760                     GGTCCGAGTTTCCAGTCTCTGATTGTGAAGAAGGAATTTGTTAAAGATAGTCTAGTTAAG
Loxodonta_africana|14919            GGTCCAAGTTTCCAGTCTCTGATTGTGAAGAAGGAATTCTTGAAAGATAGTCTAGTTAAG
Mus_musculus|7147                   GGCCCGAGTTTCCAATCTCTGATTGTGAAGAAGGAGTTCATTAAAGATACTCTAGTTAAG
Tursiops_truncatus|5172             GGTCCGAGTTTCCAGTCTCTGATTGTGAAGAAGGAATTCGTTAAAGATAGTCTAGTTAAG
Canis_familiaris|27683              GGTCCAAGTTTCCAATCTCTGATTGTGAAGAAGGAGTTCATTAAAGATAGTCTGGTTAAG
Pteropus_vampyrus|12184             GGTCCAAGTTTCCAATCTCTGATTGTGAAGAAGGAATTCATTAAAGATAGTCTAGTTAAG
Tarsius_syrichta|13906              GGTCCAAGTTTCCAGACTCTGATTGTGAAGAAGGAATTTGTTAAAGAGAGTCTGGTTAAG
Microcebus_murinus|5590             GGTCCTAGTTTCCAATCTTTGATTGTGAAGAAGGAATTCGTTAAAGAGAGTCTAGTTAAG
Equus_caballus|4395                 ------------------------------------------------------------
Callithrix_jacchus|51275            GGTCCAAGTTTCCAGTCTCTGATTGTGAAGAAGGAATTTGTTAAAGAGAATTTAGTTAAG
Rhesus_macaque|16910                GGTCCAAGTTTCCAGACTCTGATTGTGAAGAAGGAATTTGTTAAAGAGAATTTAGTTAAG
Homo_sapiens|35585                  GGTCCAAGTTTCCAGTCTCTGATTGTGAAGAAGGAATTTGTTAAAGAGAATTTAGTTAAG
Pan_troglodytes|16522               GGTCCAAGTTTCCAGTCTCTGATTGTGAAGAAGGAATTTGTTAAAGAGAATTTAGTTAAG
Gorilla_gorilla|19974               GGTCCAAGTTTCCAGTCTCTGATTGTGAAGAAGGAATTTGTTAAAGAGAATTTAGTTAAG
Pongo_abelii|11826                  GGTCCAAGTTTCCAGTCTCTGATTGTGAAGAAGGAATTTGTTAAAGAGAATTTAGTTAAG
Danio_rerio|21516                   GGACACAAATTTCACGTGTATGTGTCCACCAGAGACTTTGTGGAGAATGTATTGGTCCAA
Tetraodon_nigroviridis|22877        GGTTACAGATTTCACATACTGGTGACCACAAGGGATTTTGTAGAAGCGGTTTTAGTGAAA
Fugu_rubripes|18278                 GGTTACAAGTTTCACATACTGGTGACGGCAAGGGATTTTGTAGAAACGGTTTTGGTGCGG
                                                                                                

Xenopus_tropicalis|13716            ATGTTAAACCCAAAATACAATCTACCAGTGAGCCTGCAAAATAAAATCCTTTTTTTAATT
Tupaia_belangeri|4456               CTACTGAATCCCAGATACACCTTGCCATTAGATATTCAGAACAGAATCTTGAATTTCATC
Ornithorhynchus_anatinus|12277      CTCCTGAATCCCAGATACAACCTGCCGACGGACATACAGAATCAAATCTTGACCTTCGTC
Felis_catus|46567                   CTGCTGAACCCCAGATACACCTTGCCCTTAGACATTCAGAATAGAATCTTGAATTTCATT
Erinaceus_europaeus|13757           CTGCTGAGTCCCAGATACACCTTGCCATTAGACATTCAGAACAGAATCTTAAATTTAATT
Monodelphis_domestica|9113          ---------AACAAAGAAACTTTTATTTATCATATCAAGGAAAAAAAA---------AGC
Macropus_eugenii|10709              CTGCTGAGTCCCAGATACAACTTGCCTTTAGACATACAGAATAAGATTTTGAGTTTCATC
Anolis_carolinensis|12939           CTGTTGAATCCAAGATATAACCTGCCAGTTGATCTCCAAGAGAAGATCTTGACCTTTATC
Gallus_gallus|7181                  CTGCTGAATCCCAGATACAACCTGCCCATTGACTTACAGGAGAAAATCCTGACCTTTATC
Taeniopygia_guttata|4202            CTGCTGAACCCAAGATACAACCTGCCCATTGATATGCAGGAGAAAATCCTGACCTTTATT
Dasypus_novemcinctus|7205           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Myotis_lucifugus|7417               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Procavia_capensis|8466              CTGCTGAATCCCAGATACACTTTGCCATTAGACATTCAGAATAAAATCCTAAATTTCATT
Choloepus_hoffmanni|5376            NNNNNNNNNNNNNNNNNNNNNNNNNNNTTAGACATTCAGAATAAAATCCTGAATTTCATT
Vicugna_pacos|1270                  CTGCTGAATCCCAGATACACCTTGCCAGTAGATATTCAGAATAGAATTTTGAATTTTATT
Sorex_araneus|3827                  CTGCTGAGTCCCAGATACACCCTGCCATTAGACTTTCAGAATAGAATCTTAAGTTTCATT
Ochotona_princeps|5227              CTGCTGAATCCAAGGTACAACTTGCCGTTAGACATTCAGAACCGAATCTTGAACTTCATT
Dipodomys_ordii|12963               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|12163 CTGTTGGATCCTAAATACACCTTACCATTGGACATTCAGAATAGAATCTTGAATTTCATT
Ochotona_princeps|12652             CTGCTGAATCCCAGGTACAACTTGCCATTAGACATTCAGAATCGAATCTTGAATTTCATG
Oryctolagus_cuniculus|11447         CTGCTGAATCCCAGATACAACTTGCCGTTAGACATTCAGAATCGAATCTTGAATTTCATT
Sus_scrofa|3743                     CTGCTGAATCCCAGATACACCTTGCCAGTAGACATTCAGAATAGAATTTTGAGTTTCATT
Echinops_telfairi|18178             CTGCTGAATCCCAAATACAACTTGCCATTAGACACTCAGAATAAAATCTTGAATTTCATT
Cavia_porcellus|18337               CTGCTGAACCCCAGGTTCACCTTGCCTTTAGACATTCAGAATAGAATCTTGAATTTTATT
Rattus_norvegicus|6711              CTGCTGAACCCCAGATACACCTTACCGTTGGAGACTCAGAACAGAATCTTGAGTTTCATT
Bos_taurus|9760                     CTGCTGAATCCCAGATACACATTGCCAATAGACATTCAGAATAGAATTTTGAATTTCATT
Loxodonta_africana|14919            CTGCTGAATCCCAGATACGCTTTGCCATTAGACATTCAGAATAAAATCTTGAGTTTCATT
Mus_musculus|7147                   CTGCTGAATCCCAGATACACCTTACCGCTGGAGACCCAGAACAGAATCTTGAATTTCATT
Tursiops_truncatus|5172             CTGCTGAGTCCCAGATATACCTTGCCAATAGACATTCAGAATAGAATTTTGAATTTCATT
Canis_familiaris|27683              CTGCTGAACCCCAGATACACCTTGCCATTAGACATTCAGAATAGAATCTTGAATTTCATT
Pteropus_vampyrus|12184             CTGCTGAATCCCAGATACACCTTGCCATTAGACATTCAGAATAGAATCTTGAATTTCATT
Tarsius_syrichta|13906              CTGCTGAATCCCAGATACAACTTGCCATTAGATGTTCAG---AGAATTTTGATTTTCATT
Microcebus_murinus|5590             CTGCTGAATCCCAGATACAACTTGCCATTGGACATTCAGAATAAAATCTTGAATTTCATT
Equus_caballus|4395                 ------------------------------------------------------------
Callithrix_jacchus|51275            CTGCTGAATCCCAGATACAACTTGCCATTAGACATTCAGAATAGAATCTTGAATTTCATT
Rhesus_macaque|16910                CTACTGAATCCTAGATACAACTTGCCATTAGACATTCAGAATAGAATCTTGAATTTCATT
Homo_sapiens|35585                  CTACTGAATCCCAGATACAACTTGCCATTAGACATTCAGAATAGAATCTTGAATTTCATT
Pan_troglodytes|16522               CTACTGAATCCCAGATACAACTTGCCATTAGACATTCAGAATAGAATCTTGAATTTCATT
Gorilla_gorilla|19974               CTACTGAATCCCAGATACAACTTGCCATTAGACATTCAGAATAGAATCTTGAATTTCATT
Pongo_abelii|11826                  CTACTGAATCCCAGATACAACTTGCCATTAGACATTCAGAATAGAATCTTGAATTTCATT
Danio_rerio|21516                   ACCATCCTGCCAAAAAACAACGCACCAGTGGTTCTCCAAGACAGAGTCTTGATCATGATA
Tetraodon_nigroviridis|22877        TCAATCATTCCAAGAAATAGCCCTCCATTGGTTGTCCATGACAGAGTCCTCAGTATTATA
Fugu_rubripes|18278                 TCAATCATTCCAAGAAATAGTCCTCCATTAGTTGTTCATGACAGAGTCCTCAGTATTATA
                                                                                                

Xenopus_tropicalis|13716            ATGACATGGTCACATGATCCAAAATGGAAAATCAATGCAACTGAGATAAGAGAAGTGTAT
Tupaia_belangeri|4456               AAGACCTGGTCACAGGGTTTCCCAGGAGGTGTGGATGTAAGTGAAGTGAAAGAAGTGTAT
Ornithorhynchus_anatinus|12277      ATGACTTGGTCTCAGGGATTCGAAGGCACCGTGGACGTGACTCAAGTGAAGGAACTGTAC
Felis_catus|46567                   AAGACTTGGTCACAAGGTTTCCCAGGAGGTGTGGATGTAAGTGAAGTGAAAGAAGTGTAC
Erinaceus_europaeus|13757           AAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Monodelphis_domestica|9113          AAAACATGGTCACAGGGTTTCCCTGGAGGTGTGGACGTGAGTGACATCAAAGAAGTCTAC
Macropus_eugenii|10709              ATGATATGGTCACGGGGTTTCCCTGGAGGTGTAGATGTGAGTGAAGTCAAGGAAGTATAC
Anolis_carolinensis|12939           ATGACCTGGGCCAGAGGATTCCAAGGTGTTGTGGATGTAAGTGAAGTCAAAGAAGTTTAC
Gallus_gallus|7181                  ATGATATGGGCACGAGGGTTCCAAGGAATGGTGGATGTGACCGAAGTAAAAGAAGTTTAT
Taeniopygia_guttata|4202            ATGGTCTGGGCACGAGGTTTTCAAGGGATGGTGGATGTGAGTGAAGTAAAAGAAGTTTAC
Dasypus_novemcinctus|7205           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Myotis_lucifugus|7417               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Procavia_capensis|8466              AAGATTTGGTCTCGGGGTTTCCCAGGAGGTGTGGATGTAAGCGAAGTGAAAGAAGTGTAC
Choloepus_hoffmanni|5376            AAGACTTGGTCACAGGGCTTCCCAGGGGGTGTGGACGTAAGTGAAGTAAAAGAAGTGTAC
Vicugna_pacos|1270                  AAGACTTGGTCGCAGGGCTTCCCAGGAGGCGTGGATGTAAGTGAGGTGAAAGAAGTGTAC
Sorex_araneus|3827                  AAGAATTGGTCCCAGGGTTTTCCAGGAGGTGTGGATGTAAGTGAAGTGAAAGAGGTGTAC
Ochotona_princeps|5227              AAGACGTGGTCACAGGGTTTTCCAGGAGGTGTGGATGTGACTGAAGTGAAAGAAGTGTAC
Dipodomys_ordii|12963               NNNACTTGGTCACAGGGTTTTCCAGGAGGCGTGGAAGTAACTGAGGTGAAAGAAGTGTAC
Spermophilus_tridecemlineatus|12163 AAGGTG------CCATTCTACGTAGAGAGTGTAGATGTA------GTGAGTGAAGTGTAC
Ochotona_princeps|12652             AAGACGTGGTCACAGGGTTTTCCAGGAGGTGTGGATGTGACTGAAGTGAAAGAAGTGTAC
Oryctolagus_cuniculus|11447         AAGACGTGGTCACAGGGTTTCCCAGGAGGTGTGGATGTAACTGAAGTGAAAGAAGTGTAC
Sus_scrofa|3743                     AAGACTTGGTCACAGGGTTTCCCAGGAGGAGTGGATGTGAGTGAAGTAAAAGAAGTGTAC
Echinops_telfairi|18178             AAGACTTGGTCACAGGGCTTCCCGGGAGGTGTGGATGTAAGTGAAGTGAAGGAAGTGTAT
Cavia_porcellus|18337               AAGACCTGGTCACAAGGTTTCCCAGGAGGTGTGGATGTAAGTGAAGTGAAGGAAGTGTAC
Rattus_norvegicus|6711              AAGATGTGGTCCCAGGGCTTCCCGGGAGGTGTAGATGTCAGTGAAGTGAAGGAAGTGTAC
Bos_taurus|9760                     AAGACATGGTCGCAGGGTTTCCCAGGAGGCGTGGATGTCAGTGAAGTGAAAGATGTGTAC
Loxodonta_africana|14919            AAGACTTGGTCTCAGGGTTTTCCAGGAGGTGTGGATGTAAGTGAAGTAAAAGAAGTATAC
Mus_musculus|7147                   AAGACCTGGTCCCAGGGCTTCCCAGGAGGTGTAGATGTGAGTGAGGTGAAGGAAGTGTAC
Tursiops_truncatus|5172             AAGACATGGTCGCAGGGTTTTCCAGGAGCTGTGGATGTAAGTGAAGTGAAAGAAGTGTAC
Canis_familiaris|27683              AAGACTTGGTCACAAGGTTTCCCAGGAGGTGTGGATGTAAGCGAAGTGAAGGAAGTGTAC
Pteropus_vampyrus|12184             AAGACTTGGTCCCAGGGTTTCCCAGGAGGTGTGGATGTAAGTGAAGTGAAAGAAGTGTAC
Tarsius_syrichta|13906              ACGACTTGGTCACAGGGTTTCCCGGGAGGTGTGGATGTAAGTGAAGTGAAAGAAGTATAC
Microcebus_murinus|5590             AAGACGTGGTCACAGGGTTTCCCAGGAGGTGTGGACGTAAGTGAAGTGAAAGAGGTGTAC
Equus_caballus|4395                 ------------------------------------------------------------
Callithrix_jacchus|51275            AAGACTTGGTCACAGGGTTTTCCAGGAGGTGTGGATGTAAGCGAAGTGAAAGAAGTATAC
Rhesus_macaque|16910                AAGGCTTGGTCACAGGGTTTCCCAGGAGGTGTGGATGTAAGCGAAGTCAAAGAAGTATAC
Homo_sapiens|35585                  AAGACTTGGTCACAGGGCTTCCCAGGAGGTGTGGATGTAAGCGAAGTCAAAGAAGTATAC
Pan_troglodytes|16522               AAGACTTGGTCACAGGGCTTCCCAGGAGGTGTGGATGTAAGCGAAGTCAAAGAAGTATAC
Gorilla_gorilla|19974               AAGACTTGGTCACAGGGCTTCCCAGGAGGTGTGGATGTAAGCGAAGTCAAAGAAGTATAC
Pongo_abelii|11826                  AAGACTTGTTCACAGGGCTTCCCAGGAGGTGTGGATGTAAGCGAAGTCAAAGAAGTATAC
Danio_rerio|21516                   CAGGCATGGGCCGATGCCTTTCGCAGCTCTACGGATCTGACGGGTGTCGTGACTGTATAT
Tetraodon_nigroviridis|22877        CAGGCGTGGGCCGATGCATTCCGCAGCTCGCCTGATCTGACTGGCGTGGTGTCTGTGTAT
Fugu_rubripes|18278                 CAGGCATGGGCTGATGCATTCCGCAGTTCACCCGAGATGACTGGGGTGGTGTCAGTATAT
                                                                                                

Xenopus_tropicalis|13716            CTAGAGCTGATTAAAAGGGGAATCAAATTCCCATCCTTGCAAGAAAATGGAGAAATGCTG
Tupaia_belangeri|4456               CTCGACCTGCTAAAGAAAGGTGTTCACTTTCCTCCCTCAGATGCAGAAGCTGAAACAGCA
Ornithorhynchus_anatinus|12277      CTCGACCTGCTCAAAAAGGGCATCCGGTTTCCGTCCTCGAACACGGCGGCGGGGACGGAC
Felis_catus|46567                   CTTGACCTTCTTAAGAAAGGTGTTCAGTTTCCTCCCTCAGATGCAGAGGCTGAAACAGCA
Erinaceus_europaeus|13757           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Monodelphis_domestica|9113          CTAGAGCTTCTCAAGAAAGGAGTCCAGTTCCCCTCTTCAGAGAGAGAGATTGAGAAGGAG
Macropus_eugenii|10709              CTAGAACTGCTTAAGAAAGGAGTCCAGTTTCCCTCTTCAGAGATAGAGATTGGAACAGAG
Anolis_carolinensis|12939           TTGGATCTTCTAAAGAAAGGTGTTGAGTTTCCATCCTCTGAG------------------
Gallus_gallus|7181                  CTGGAATTGCTGAAGAAAGGAGTGGAGTTTCCATCTTCTGATACCAGCAAAGGAAGGCCT
Taeniopygia_guttata|4202            CTAGAACTGCTGAAGAAAGGAGTGGAGTTTCCATCCTCTGACACCAGCAatgAATTTTCA
Dasypus_novemcinctus|7205           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Myotis_lucifugus|7417               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Procavia_capensis|8466              CTTGATCTGCTCAAGAAAGGTGTACACTTTCCTTCCTCAGATGCTGAGGCTGAAACAACA
Choloepus_hoffmanni|5376            CTTGACCTGCTTAAGAAAGGCATTCAGTTTCCTCCTTCAGATGCAGAGGGTGAAACAGCA
Vicugna_pacos|1270                  CTGGATCTTCTTAAGAAAGGTGTTCAGTTTCCTCCATCAGATGCGGAGGCTGAAGCGGCC
Sorex_araneus|3827                  CTTGACCTGCTTAAGAAAGGTGTTCAATTTCCTCCCTCAGATGCTGAGAATGAAACA---
Ochotona_princeps|5227              CTTGATCTGCTCAAGAAAGGAGTTCAGTTTCCTTGCTCAGAGGCAGAGGTTCAAAGTACC
Dipodomys_ordii|12963               CTGGACTTGCTGAAGAAAGGTGTCCAGTTTCCTCCCTCAGACGCAGAGGCTGAAACA---
Spermophilus_tridecemlineatus|12163 CTGGAG------------GGTCAGTTCTCTCCCGATTCCGAGCCC---------ACAGCC
Ochotona_princeps|12652             CTTGATCTGCTTAAGAAAGGAGTTCAGTTTCCTTCCTCAGAGGCAGAGGCTCAAAGTACC
Oryctolagus_cuniculus|11447         CTTGATCTGCTTAAGAAGGGTGTTCAGTTTCCTCCCTCAGATGCAGAGGCTCAGAGTGCC
Sus_scrofa|3743                     CTGGACCTCCTCAAGAAAGGTGTTCAGTTTCCTCTATCACAGGCAGAGGCTGAAACAGCC
Echinops_telfairi|18178             CTTGACCTGCTTAAGAGAGGTGTGCAGTTTCCTCCTTCAGATGCAGAGGCGGAAACAACA
Cavia_porcellus|18337               CTTGACCTGCTGAAGAAAGGCGTTCAGTTTCCTTCCTCAGATGCAAACGCTGAAGCCACA
Rattus_norvegicus|6711              CTCGACCTGCTGAAGAAAGGGGTTCAATTCCCACCCTTGGATGGAGAGCCTGAGACA---
Bos_taurus|9760                     CTGGACCTCCTTAAGAAAGGGGTTCAGTTCCCTTCATCAGATGCAGAGACTGAAACAGCC
Loxodonta_africana|14919            CTTGACCTGCTTAAGAAAGGCGTACAGTTTCCTTCCTCAGATGCCGAGGCTGAAACA---
Mus_musculus|7147                   CTTGACCTGCTGAAGAAAGGGGTTCAATTCCCGCCCTCGGATGGAGAGCCTGAGACA---
Tursiops_truncatus|5172             CTGGACCTCCTTAAGAAAGGTGTTCAGTTTCCTCCATCAGATGCAGTGGCTGAAACAGCC
Canis_familiaris|27683              CTTGACCTCCTTAAGAAAGGTGTTCAGTTTCCTACCTCAGAGGCAGAGGCTGAAACAGCA
Pteropus_vampyrus|12184             CTTGACCTGCTTAAGAAAGGTGTTCATTTTCCTCCCTCAGATGCAGAGGCTGAAACAAAG
Tarsius_syrichta|13906              CTTGACCTGCTTAAGAAAGGTGTCCAGTTTCTTACCACAGATGCAGAGGCTGAAACAGCA
Microcebus_murinus|5590             CTTGACTTGCTTAAGAAAGGTGTTCAGTTTCCTCCTTCAGATGCAGAGGCAGAAACATCA
Equus_caballus|4395                 ------------------------------------------------------------
Callithrix_jacchus|51275            CTTGACCTGCTTAAAAAAGGTGTTCAGTTTCCTCCCTCAGAAGTAGAGGCTGAAACAGCA
Rhesus_macaque|16910                CTCGACCTGCTTAAGAAAGGCGTTCAGTTTCCTCCCTCAGAAGCAGAGGCTGAAACAGCA
Homo_sapiens|35585                  CTCGACCTGGTTAAGAAAGGCGTTCAGTTTCCTCCCTCAGAAGCAGAGGCTGAAACAGCA
Pan_troglodytes|16522               CTCGACCTGGTTAAGAAAGGCGTTCAGTTTCCTCCCTCAGAAGCAGAGGCTGAAACAGCA
Gorilla_gorilla|19974               CTCGACCTGGTTAAGAAAGGCGTTCAGTTTCCTCCCTCAGAAGCAGAGGCTGAAACAGCA
Pongo_abelii|11826                  CTCGACCTGGTTAAGAAAGGCGTTCAGTTTCCTCCCTCAGAAGCAGAGGCTGAAACAGCA
Danio_rerio|21516                   GAGGATCTCAGAAGAAGAGGAGTGGAGTTTCCCATGACCGAACTGAATGGATATTCCCCT
Tetraodon_nigroviridis|22877        GAGGATCTACGACGGAAAGGGCTGGAATTTCCCATGACAGAGCTGAATGGTTACCCAATT
Fugu_rubripes|18278                 GAAGACCTCCGACGGAAAGGGCTGGAGTTTCCCATTACAGAACTAAATGGTTACCCAAGC
                                                                                                

Xenopus_tropicalis|13716            ---------------------GAAACACAAGAGTCTCCC---AAGCAATCAATCCAATCC
Tupaia_belangeri|4456               CAACAGGAGNNNNNN------NNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|12277      GCCCCGGAACGCTCG---------------GCGGCGGCG---GCGGCTCCCGTCCCTTCG
Felis_catus|46567                   AGACAAGAGACCGCT------CACATCTCG---AACCCG---CCATCATCTGTTCCATCC
Erinaceus_europaeus|13757           NNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNN
Monodelphis_domestica|9113          AGACAAGGTGGAGCCTTGTCTCCGAGCATCACTAATCCA---CCACCATTTGTTCCGTCT
Macropus_eugenii|10709              AGAGAAGTGNNNNNN------NNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNN
Anolis_carolinensis|12939           ------------------------------------------------------------
Gallus_gallus|7181                  AAGCAGTCCCCATCT------CCTGCAAAGTCATCACCA---TCTTCTGCTAATCCCCCA
Taeniopygia_guttata|4202            CAAGAGCTTTGGGCA------GCATCCCCACTTCATCCT---TCATCCCCATCCTCTGCC
Dasypus_novemcinctus|7205           NNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNN
Myotis_lucifugus|7417               NNNNNNNNNACTGCT------CAAGTCTCATCAAATCCA---CCTACCTCTGTTCCTACT
Procavia_capensis|8466              AGCTCAGAGACTGTT------CAGATCTCATCTAATCCA---CCAACATGTGTTCCTACT
Choloepus_hoffmanni|5376            AGAAAAGAGACTGCT------CATGTATCT---AATCCG---CCAACATCTGTTCCTACT
Vicugna_pacos|1270                  AGAGAAGAGNNNNNN------NNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNN
Sorex_araneus|3827                  AGGCAAAAGACTAAT------CGGATCTCATCAGCTTCA---TCAACATCTGTTCCAACT
Ochotona_princeps|5227              CGGCACGAGACTGCC------CCAGTTTCATCACAGCCA---TCAACATCTGTTCCCACT
Dipodomys_ordii|12963               AGACAGGAGACTGCT------CCAATCTCATCCCATGCA---CCAACATCGGTCCCAACT
Spermophilus_tridecemlineatus|12163 AGGCAAGAGTCT---------CAGACCTCATTGACTCCA---CCAGCATCTGTTCCTACT
Ochotona_princeps|12652             CGGCACGAGACTGCC------CCAGTTTCATCACAGCCA---TCAACATCTGTTCCCACT
Oryctolagus_cuniculus|11447         CGACAGGAGACTGCT------CCAGTTTCATCACATCCG---TCAGCATCTGTCCCCACT
Sus_scrofa|3743                     AGACAAGAGATTGCT------CAGATCTCACCAAATCCA---CCACCATCTGTTCCTACT
Echinops_telfairi|18178             AGACCAGAGACTGCT------CCGATCCCGTCTAATCCA---CCAACATCTGTCCCTACG
Cavia_porcellus|18337               ACACAGGAGACTCCG------CGGAGCTTATCGAGTCCT---CCGACCCCTGTCCCAACC
Rattus_norvegicus|6711              AAACAGGAGGCTGGT------CAGATCTCACCAAGTCGA---CCGACATCTGTCCCCACT
Bos_taurus|9760                     AGACAAGAG---------------ATGTCCCTGAATCCA---CCACCGTCTGTTCCTTCT
Loxodonta_africana|14919            AGACCACAGACTACT------CAGATCTCATCTAATCCA---CCAACATCTGTTCCTACT
Mus_musculus|7147                   AGGCAGGAGGCTGGT------CAGATCTCACCAAATCGA---CCGACATCTGTCCCCACT
Tursiops_truncatus|5172             AGACAAGAGACTGCT------CAGATCTCACCAAATCCA---CCACCATCTGTTCCTACT
Canis_familiaris|27683              AGACAAGAGACCACT------GAGATCTCCTCGAGCCCA---TCAACGTCTGTTCCTACC
Pteropus_vampyrus|12184             CAACAGGAGACTGCT------CAGATCTCATCGAAACCA---CCAACATCTGGTCCTACT
Tarsius_syrichta|13906              AGACAAGAGACTGCT------CAGATCTCATCAAATCCA---CCATCATCTGTCCCTACT
Microcebus_murinus|5590             GGACAGGAGACTGCT------CAGATCTCATCGAATCCA---CCAACATCTGTCCCTACT
Equus_caballus|4395                 ------------------------------------------------------------
Callithrix_jacchus|51275            AGACAGGAGACTGCT------CAACTCTCATCAAATCCA---CCAACATCTGTCCCTACT
Rhesus_macaque|16910                AGACAAGAGACTGCT------CAAATCTCATCAAATCCT---CCAACATCTGTCCCTACT
Homo_sapiens|35585                  AGACAAGAGACTGCT------CAAATCTCATCAAATCCT---CCAACATCTGTCCCTACT
Pan_troglodytes|16522               AGACAAGAGACTGCT------CAAATCTCATCAAATCCT---CCAACATCTGTCCCTACT
Gorilla_gorilla|19974               AGACAAGAGACTGCT------CAAATCTCATCAAATCCT---CCAACATCTGTCCCTACT
Pongo_abelii|11826                  AGACAAGAGACTGCT------CAAATCTCATCAAATCCT---CCAACATCTGTCCCTACT
Danio_rerio|21516                   ATTCACACTCCCAAG------AGGTCTGTTGAAAATGTGTCTCCGGTAAAGGCTCACACG
Tetraodon_nigroviridis|22877        GGCCAACCTGCCCAAAAGACTTTGCCTGCTAATGGGCCCGATAGATCTAGTGTGCCTGCT
Fugu_rubripes|18278                 CAACTGACA------------CAAAAGACTTTGGCTGCT---AGAACTAGTGTGCCTGCT
                                                                                                

Xenopus_tropicalis|13716            CCA------CTCTCCCATCAT---------------TCAAAAACTGATTTACAC------
Tupaia_belangeri|4456               NNN------NNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNN------
Ornithorhynchus_anatinus|12277      GCC------CCCGGGGCTCCTCCGGAGGCTGTG---TGGAAAGCCCCGACCGTG------
Felis_catus|46567                   GCA------CCAGTTCTTCCTACTGTGATTGTT---CCCAAGAGCTCTACTATT------
Erinaceus_europaeus|13757           NNN------NNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNN------
Monodelphis_domestica|9113          GCA------TCAATACATTCGACTGCAACTGCT---CCTAAGCCCCCAACTATT------
Macropus_eugenii|10709              NNN------NNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNN------
Anolis_carolinensis|12939           ------------------------------------------------------------
Gallus_gallus|7181                  AAG------CGTTCTTTGTTGCCTCTG---------CCCACGGGCCCAACATTA------
Taeniopygia_guttata|4202            AGT------CCTGCCAAGCGTTCCTTGCTGCCTCTTCCCACGGGCCCAACGCTG------
Dasypus_novemcinctus|7205           NNN------NNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNN------
Myotis_lucifugus|7417               GCA------CCGGCTCTTTCTTCTGTAATTGCT---CCCAAGAATGCGACTATT------
Procavia_capensis|8466              GCA------CCGGCTCTTTCATCTATAGCTGCT---CCCAAGAACCCAACCATT------
Choloepus_hoffmanni|5376            GCA------CCGGCTCTTTCTTCTATAATTGCT---CCCAAGAACTCAACCATT------
Vicugna_pacos|1270                  NNN------NNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNN------
Sorex_araneus|3827                  GCA------CCAGCTCTTCCTTCTGTCATTGTT---CCCAAGAACTCGATGATT------
Ochotona_princeps|5227              GCA------CCAGCCCTTTCTCCTGTAAATGCT---CCCAAGACCACGACCATT------
Dipodomys_ordii|12963               GCT------CCTGCTCTTCCATCCATAACTGCT---ACCAAGAACCCGACTATT------
Spermophilus_tridecemlineatus|12163 GCA------CCAGCTCTTTCTTCAGTAATTCCT---CCCAGGAACTCAACTATT------
Ochotona_princeps|12652             ACA------CCAGCTCTTTCTCCTGTAAATGCT---CCCAAGACCACGACAACT------
Oryctolagus_cuniculus|11447         GCA------CCAGCTCTTTCTCCTGTAATTGCT---CCCAGGAACACGACTATT------
Sus_scrofa|3743                     GCG------CCTGCTCTTTCTTGTGTAGTT------CCCAAGAACGCCACCATT------
Echinops_telfairi|18178             GCA------CCGGCCCTTCCTTCTGTAGTCGCC---CCTAAGAACTCGACCATT------
Cavia_porcellus|18337               GCA------CCAGCTCTTTCTCCTGTAATTACT---GCCAGGAGCACAACTATT------
Rattus_norvegicus|6711              GCG------CCTGCTCTTTCTTCTATAATTGCT---CCCAAGAACCCGACTATT------
Bos_taurus|9760                     GCA------CCAGCTCTTCCTTCTATAGTT------CCCAAGATCTCCACTATT------
Loxodonta_africana|14919            GCA------CCGGCTCTTTCTGCTATAGTTGCT---CCCAAGAACCCGACCATT------
Mus_musculus|7147                   GCA------CCTGCACTTTCTTCTATAATTGCT---CCCAAGAACCCAACTATT------
Tursiops_truncatus|5172             GCA------CCAGCTCTTTCTTCTGTGGTT------TCCAAGAGCTCCACTATT------
Canis_familiaris|27683              GCA------CCAGCTCTTTCTTCTGTAATTGTT---CCCAAGAGCTCTACTCTT------
Pteropus_vampyrus|12184             GCA------CCAGCTCTTTCTTCTGTAATTGTT---CCCCGAAGCATGACTATT------
Tarsius_syrichta|13906              GCA------CCTGCTCTTTCTTCTGTAATCGCT---CCTAAGAACTCGACTATT------
Microcebus_murinus|5590             GCA------CCAGCCCTTTCTCCTGTAGCTGTT---CCCAAGAACTCTACTATT------
Equus_caballus|4395                 ------------------------------------------------------------
Callithrix_jacchus|51275            GCA------CCAGCTCTTTCTTCTGTAATTGCT---CCGAAGAACTCGACTATT------
Rhesus_macaque|16910                GCA------CCAGCTCTTTCTTCTGTAATTGCT---CCAAAGAACTCGACTATT------
Homo_sapiens|35585                  GCA------CCAGCTCTTTCTTCTGTAATTGCT---CCAAAGAACTCGACTGTT------
Pan_troglodytes|16522               GCA------CCAGCTCTTTCTTCTGTAATTGCT---CCAAAGAACTCAACGATT------
Gorilla_gorilla|19974               GCA------CCAGCTCTTTCTTCTGTAATTGCT---CCAAAGAACTCAACTATT------
Pongo_abelii|11826                  GCA------CCAGCGCTGTCTTCTGTAATTGCT---CCAAAGAACTCGACTATT------
Danio_rerio|21516                   GAAAGTCACCCTGTCACATCCTCACAACCACAGAATACAGAGACGCCTGTCACA------
Tetraodon_nigroviridis|22877        GCACTGCTGTCTTCCAAGCCATGTCTCATCACC---CCCTACACCTCTGAGCTAAAAGTT
Fugu_rubripes|18278                 GTACTGCTGTCTTCCAAACCAAGTCTCATCGCA---CCCCAGACCTCAGACCTAAAACTA
                                                                                                

Xenopus_tropicalis|13716            ------------AAC------CTTACTCCTGAGCAGATAGGTAAGTTGTACAGCGAAATG
Tupaia_belangeri|4456               ------------NNN------NNNNNNNNNNNNNNNATTGGAAAATTGCTCAGTGAATTA
Ornithorhynchus_anatinus|12277      ------------CTG------CTGGTTCCCGAACAGATCGGGAAGCTGAACAGCGAGCTC
Felis_catus|46567                   ------------ACA------TTGGTCCCAGAACAGATTGGAAAGTTGCACAGTGAATTG
Erinaceus_europaeus|13757           ------------NNN------NNNNNNNNNNNNNNNATCGGAAAATTGCATAGTGAATTG
Monodelphis_domestica|9113          ------------TTA------CTGGTCGCCGAACAGATTGGAAAATTGCACAGTGAAGTA
Macropus_eugenii|10709              ------------NNN------NNNNNNNNNNNNNNNATTGGAAAATTGCACAGTGAAGTG
Anolis_carolinensis|12939           ------------------------------------------------------------
Gallus_gallus|7181                  ------------CTG------TTGACACCTGAACAGATTGGGAAACTGTACAGTGAACTG
Taeniopygia_guttata|4202            ------------CTG------TTGGCTCCGGAGCagATTGGGAAACTGTACAGTGAGCTG
Dasypus_novemcinctus|7205           ------------NNN------NNNNNNNNNNNNNNNATTGGAAAATTGCACAGTGAATTG
Myotis_lucifugus|7417               ------------ACA------TTGGTCCCAGAACAGNNNNNNNNNNNNNNNNNNNNNNNN
Procavia_capensis|8466              ------------ACC------TTGGTCACAGAACAGATTGGGAAANNNNNNNNNNNNNNN
Choloepus_hoffmanni|5376            ------------ACG------TTGGTCCCAGAACAGATTGGAAAATTGCACAGTGAATTG
Vicugna_pacos|1270                  ------------NNN------NNNNNNNNNNNNNNNATCGGAAAACTGCACAGCGAATTG
Sorex_araneus|3827                  ------------ACA------CTGGTCCCAGAACAGATTGGAAAATTGCACAGTGAGTTG
Ochotona_princeps|5227              ------------ACA------TTGGTCCCAGAGCAGNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|12963               ------------TCA------TTAGTCCCAGAACAGATTGGAAAGTTGCACAGCGAATTG
Spermophilus_tridecemlineatus|12163 ------------ACT------TTGGTCCCAGAACAGATTGGAAAGCTGCACAGTGAATTG
Ochotona_princeps|12652             ------------ACA------TTGGTCCCAGAGCAGATTGGAAAATTGCACAGTGAATTG
Oryctolagus_cuniculus|11447         ------------ACG------TTAGTCCCAGAGCAGATTGGAAAATTGCACAGTGAATTG
Sus_scrofa|3743                     ------------ACA------TTGGTCCCAGAACAGATTGGAAAATTGCATAGTGAATTG
Echinops_telfairi|18178             ------------ACG------TTGGTCGCAGAACAGATCGGAAAACTGCACAGTGAGCTG
Cavia_porcellus|18337               ------------ACA------TTGGTCCCAGAACAGATTGGAAAATTGCACAGTGAGTTG
Rattus_norvegicus|6711              ------------TCC------TTAGTCCCTGAACAGATCGGGAAACTGCACAGTGAACTG
Bos_taurus|9760                     ------------ACA------TTGGTCCCAGAACAGATTGGAAAACTACACAGTGAATTG
Loxodonta_africana|14919            ------------ACA------TTGGTCCCAGAACAGATTGGAAAATTACACAGTGAGCTG
Mus_musculus|7147                   ------------TCC------TTAGTCCCAGAACAGATCGGGAAGCTGCATAGTGAACTA
Tursiops_truncatus|5172             ------------ATA------TTGGTCCCAGAACAGATTGGAAAACTGCGCAGTGAATTG
Canis_familiaris|27683              ------------ACA------TTGGTTCCAGAACAGATTGGAAAGTTGCACAGTGAATTG
Pteropus_vampyrus|12184             ------------ACA------TTGGTCCCAGAACAGATTGGAAAATTGCTCAGTGAGTTA
Tarsius_syrichta|13906              ------------ACA------TTGGTCCCGGAACAGATTGGAAAATTGCACAGTGAATTG
Microcebus_murinus|5590             ------------ACA------TTGGTTCCAGAACAGATTGGAAAATTGCACAGTGAATTG
Equus_caballus|4395                 ------------------------------------------------------------
Callithrix_jacchus|51275            ------------ACA------TTGGTCCCAGAACAGATTGGAAAATTGCACAGTGAATTG
Rhesus_macaque|16910                ------------ACA------TTGGTCCCAGAACAGATTGGAAAATTGCACAGTGAATTG
Homo_sapiens|35585                  ------------ACA------TTGGTCCCAGAACAGATTGGAAAACTGCACAGTGAATTG
Pan_troglodytes|16522               ------------ACA------TTGGTCCCAGAACAGATTGGAAAACTGCACAGTGAATTG
Gorilla_gorilla|19974               ------------ACA------TTGGTCCCAGAACAGATTGGAAAACTGCACAGTGAATTG
Pongo_abelii|11826                  ------------ACC------TTGGTCCCAGAACAGATTGGAAAACTGCACAGTGAATTG
Danio_rerio|21516                   ---------------------TTGTCTCCTAAACAGATGAAGACGATAAAGGCTGAACTA
Tetraodon_nigroviridis|22877        GCCCTTGATGGAACCAATGGTCTCACTCCCAGTCAGATCAAAATGCTGAAAGCTGAGCTG
Fugu_rubripes|18278                 GCCCTTGATGGAACCAGTGCCCTCACTCCCATTCAGgtaaaaatgctgaaaactgAGCTA
                                                                                                

Xenopus_tropicalis|13716            GATATGGTGAGAATGAACGTGAAGGTAATGTCAGAGATTTTACTAGAAACTAGACTTGGA
Tupaia_belangeri|4456               GATATGGTGAAAATGAATGTGAGAGTGATGTCTGCCATACTGATGGAGAATACTCCTGGA
Ornithorhynchus_anatinus|12277      GACGTGGTCAGGATGAACGTGGCCGTCATGCTGGCGATCCTAACGGAGAACACCCCCGGC
Felis_catus|46567                   GATATGGCAAAAATGAATGTGAGAGTGATGTCTGCCATACTGATGGAGAACATTCCTGGG
Erinaceus_europaeus|13757           GATATGGTGAAAATGAATGTGAGAGTAATGTTTGCTATACTGATGGAGAATATTCCTGGG
Monodelphis_domestica|9113          GATATGGTGAAAATGAATGTGAAAGTAATGTCTGCCATATTGGTGGAGAATACACCTGGA
Macropus_eugenii|10709              GATATGGTAAAAATGAATGTGAAAGTGATGTCATCCATATTGATGGAGAATACACCTGGA
Anolis_carolinensis|12939           ------------------------------------------------------------
Gallus_gallus|7181                  GATATGGCGAAAATGAATGTGAGAGTCATGTCATCAATATTAAAAGAAAATGTTCCTGGC
Taeniopygia_guttata|4202            GATATGGCAAAAATGAATGTGAGAGTCATGTCATCAATATTGAAAGAAAACGTTCCTGGC
Dasypus_novemcinctus|7205           GATATGGTGAAAATGAATGTGAGAGTGATGTCCACCATATTAATGGAGAATACTCCTAGT
Myotis_lucifugus|7417               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Procavia_capensis|8466              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|5376            GATATGGTGAAAATGAATGTGAGAATGATGTCCACCATATTAATGGAGAATACTCCTGAT
Vicugna_pacos|1270                  GATATGGTGAAAATGAACATGAGAGTCATGTCTGCCATACTGATGGAGAATATTCCTGGG
Sorex_araneus|3827                  GATATGGTGAAAATGAACGTGAGAGTGATGTCTGCCATATTGATGGAGAATGTTCCTGGG
Ochotona_princeps|5227              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|12963               GATATGGTGAAAATGAATGTGCGAGTGATGACTGCCATATTGCTGGAGAACACACCTGGG
Spermophilus_tridecemlineatus|12163 GATATGGTGAAAATGAACGTGAGAGTGATGTCTGCCATACTGATGGAGAACACTCCCGGA
Ochotona_princeps|12652             GATATGGTGAAAATGAACGTAAGCGTGATGTTTGAAATACTGTTGGAGAATAATCCAGGA
Oryctolagus_cuniculus|11447         GATATGGTGAAAATGAATGTGAGAGTGATGTTCGACATATTGTTGGAGAATACTCCTGGA
Sus_scrofa|3743                     GATATGGTGAAAATGAATGTGAAAGTGATGTCTGCCATATTAATGGAGAACATTCCTGGT
Echinops_telfairi|18178             GATATGGTGAAAATGATTTTGAGCGTGATGTTCACCATATTATTGGAGATTACCCCCGGG
Cavia_porcellus|18337               GATATGGTGAAAATGAATGTGAGGGTGATGTCTGCCATCCTGATGGAGAACACTCCCGGG
Rattus_norvegicus|6711              GACATGGTGAAAATGAACGTGAAAGTGATGACAGCCATATTGATGGAGAACACTCCTGGC
Bos_taurus|9760                     GATATGGTGAAAATGAATGTGAGAGTGATGTCTGCCATACTGATGGAGAATATTCCTGGC
Loxodonta_africana|14919            GATATGGTGAAAATGAATGTGAGAGTGATGTCCACCATATTAATGGAGAACACCCCCGGA
Mus_musculus|7147                   GATATGGTGAAAATGAATGTGAAAGTGATGACAGCCATATTGATGGAGAATACTCCTGGC
Tursiops_truncatus|5172             GATATGGTGAAAATGAATGTGAGAGTGATGTCTGCCATATTGATAGAGAATATTCCTGGG
Canis_familiaris|27683              GATATGGTGAAAATGAATGTGAGAGTGATGTCTGCAATATTGATGGAGAATATTCCTGGG
Pteropus_vampyrus|12184             GATATGGTGAAGATGAATGTGAGAGTGATGTCTAACATATTGATGGAGAATATTCCTGGA
Tarsius_syrichta|13906              GATATGGTGAAAATGAACGTGCGAGTGATGTCTGCCATATTGATGGAGAATACCCCTGAG
Microcebus_murinus|5590             GATATGGTTAAAATGAATGTGCGAGTGATGGCTGCCATACTGATGGAGAATACGCCTGGA
Equus_caballus|4395                 ------------------------------------------------------------
Callithrix_jacchus|51275            GATATGGTGAAAATGAATGTGCGAGTGATGTCTGCCATATTGATGGAGAATACTCCTGGG
Rhesus_macaque|16910                GATATGGTGAAAATGAATGTGCGAGTGATGTCCGCCATATTGATGGAGAATACGCCTGGG
Homo_sapiens|35585                  GATATGGTGAAAATGAATGTGCGAGTGATGTCCGCCATATTGATGGAGAATACTCCTGGG
Pan_troglodytes|16522               GATATGGTGAAAATGAATGTGCGAGTGATGTCCGCCATATTGATGGAGAATACTCCTGGG
Gorilla_gorilla|19974               GATATGGTGAAAATGAATGTGCGAGTGATGTCCGCCATATTGATGGAGAATACTCCTGGG
Pongo_abelii|11826                  GATATGGTGAAAATGAATGTGCGAGTGATGTCCGCCATATTGATGGAGAATACTCCCGGG
Danio_rerio|21516                   GAGGTGGTGCGGAATAATCTCTCAGTGATGTCAGACATGATGAATCAGATGGAGCCTGCG
Tetraodon_nigroviridis|22877        GGTGTTGTGCGGAACAACCTGACTATGATGTCAGATATGATGAGTCAACTGGATCCTGTT
Fugu_rubripes|18278                 GGTGTTGTGCGGAGCAACCTCACTATGATGTCAGATATGATGAGTCAACTGGATCCTGTT
                                                                                                

Xenopus_tropicalis|13716            GCTGAAAATCCTGAGGACATGGACCTTTTAGAGGAACTGCATAAAGCATGTCTGGAAATG
Tupaia_belangeri|4456               TCTGAAAACCATGAAGACATAGAACTTCTCCAGNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|12277      TCTGAAGACAGAGATGACCTGGAGCTTCTCCAGAAATTGTACCGGACGGGCCGGCAGATG
Felis_catus|46567                   TCTGAAGACCGTGAAGACATAGAGCTTCTGCAGAAGCTTTATAAGACATGTCGGGAGATG
Erinaceus_europaeus|13757           TCTGAAAACCGTGAAGATATAGAGCTTCTGCAGAAACTTTATAAGACATGTCGAGAGATG
Monodelphis_domestica|9113          TCAGAAAATCAGGAAGACATGGAACTCTTACAGAAATTGTATAAGACTGGTCGGGACATG
Macropus_eugenii|10709              TCTGAAAATCAGGAAGATATGGAACTCTTAGAGAAATTGTACAAGACTGGTCGAGACATG
Anolis_carolinensis|12939           ------------------------------------------------------------
Gallus_gallus|7181                  TCTGAAAATCCGGATGATATGAATCTTTTACAGAAGCTGTACAAGACGTGTCGGATGATG
Taeniopygia_guttata|4202            TCTGAAAATCCAGATGATATGAATCTTTTACAGAAATTGTACAAGACCTGTCGGATGATG
Dasypus_novemcinctus|7205           TCTGAAAACCACGAAGACATAGAACTTCTGCAGAAACTTTATAAGACAGGTCGGGAGATG
Myotis_lucifugus|7417               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAACTTTACAAGACGGGTCGGGAGATG
Procavia_capensis|8466              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACACTTTATAAGACGAGTCGAGAGATG
Choloepus_hoffmanni|5376            TCTCAAAACCATGAAGACATAGAACTTCTGCAGAAACTTTATAAGACAGGTCGGGAGATG
Vicugna_pacos|1270                  TCTGAAAACCGGGAAGACATGGAGCTTCTGCAGAAACTTTATAAGACTGGTCGGGAGATG
Sorex_araneus|3827                  TCTGAAAACTCTGAGGACATTGAGCTCCTGCAGNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|5227              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAACTTTATAAGACAAGTCGAGAGATG
Dipodomys_ordii|12963               TCTGAAAACCCAGATGACATAAAGCTTCTGCAGAAACTGTACAAGGTAGGCCGAGAGATG
Spermophilus_tridecemlineatus|12163 TCTGAGAACCATGAAGACCTAGAGCTTCTGCAGAAACTTTACAAGACCTGTCGGGAGATG
Ochotona_princeps|12652             TCTGAAAATCGAAAAGACATAGAACTTCTGCAG---------------------------
Oryctolagus_cuniculus|11447         TCTGAAAATCAAGAAGACGTAGAACTTCTGCAGAAACTTTATAAGACAAGTCGGGAGATG
Sus_scrofa|3743                     TCTGAAAACCGTGAAGACATAGAGCTTCTGCAGGTGTGGTATGATTTCGGG---GATAAT
Echinops_telfairi|18178             TCTGAAAACCAGGAAGACGTACAGCTTCTTCAGGAGCTTTATAAGACGTGCCGAGAGATG
Cavia_porcellus|18337               TCTGAAAACTCTGATGACCTCGAGCTTCTACAGAAACTTTATAAGACGGGTCGGGAGATG
Rattus_norvegicus|6711              TCCGAAAACCATGAAGACATAGAGCTCCTGAGGAAACTTTACAAGACGGGTCGGGAGATG
Bos_taurus|9760                     TCTGAGAACCATGAAGACATAGAGCTTCTGCAGAAACTTTATAAGACGGGTCGGGAGATG
Loxodonta_africana|14919            TCTGAAAACCATGAAGATATAGAGCTTTTGCAGAAACTTTATAAGACGAGTCGAGAGATG
Mus_musculus|7147                   TCTGAAAACCATGAAGACATCGAGCTCCTGCGGAAACTTTACAAGACAGGTCGGGAGATG
Tursiops_truncatus|5172             TCTGAAAACCATGAAGACACAGAGCTTCTGCAGAAACTTTATAAGACAGGTCGGGAGATG
Canis_familiaris|27683              TCTGAAAACCGCGAAGACATAGAGCTTCTGCAGAAACTTTATAAGACAAGTCGAGAGATG
Pteropus_vampyrus|12184             TCTGAAAACCATGAAGACATAGAGCTTCTGCAGAAACTTTATAAGACAGGTCGGGAGATG
Tarsius_syrichta|13906              TCTGCAAACCATGAAGACATAGAGCTTCTGGAGAAACTCTATAAGACGGGTCGTGAGATG
Microcebus_murinus|5590             TCTGAAAACCAGGAAGACATAGAGCTTCTGCAGAAACTTTATAAGACGGGTCGGGAGATG
Equus_caballus|4395                 ---------------------------------------------------------ATG
Callithrix_jacchus|51275            TCTGAAAACCATGAAGACATAGAGCTTCTGCAGAAACTCTATAAAACAGGTCGGGAGATA
Rhesus_macaque|16910                TCTGAAAACCATGAAGACATAGAGCTTCTGCAGAAACTCTATAAAACAGGTCGGGAGATG
Homo_sapiens|35585                  TCTGAAAACCATGAAGACATAGAGCTTCTGCAGAAACTCTATAAAACAGGTCGGGAGATG
Pan_troglodytes|16522               TCTGAAAACCATGAAGACATAGAGCTTCTGCAGAAACTCTATAAAACAGGTCGGGAGATG
Gorilla_gorilla|19974               TCTGAAAACCATGAAGACATAGAGCTTCTGCAGAAACTCTATAAAACAGGTCGGGAGATG
Pongo_abelii|11826                  TCTGAAAACCATGAAGACATAGAGCTTCTGCAGAAACTCTATAAAACAGGTCGGGAGATG
Danio_rerio|21516                   ACTTTTGAGCCGTCCGACACAGAGCTGCTACAGCAGCTCTACTCCATGACTAAGGACATG
Tetraodon_nigroviridis|22877        ACAGTAAAACAAGCAAACATTGAGCTTCTGCAGCAGTTATACACGGTATGTAAGGAAATG
Fugu_rubripes|18278                 ACTGTAAAGCAAGCAGATATGGAACTGCTGCAGCAGTTATACACAGTATGTAAGGAAATG
                                                                                                

Xenopus_tropicalis|13716            CAAAGGAGGATTCTCACACTTGTAGAAACAGTGCAAAATGAAGATGTCATTATTGAACTG
Tupaia_belangeri|4456               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|12277      CACGGCAGGATCACGGAGCTGTTGGCTACGGTGGAGAATGAGGACGTGGTGGCGGAGCTG
Felis_catus|46567                   CAGGAGAGGATCATGGACCTGCTTGTGGTGGTGGAGAATGAAGACGTAACCATTGAGCTA
Erinaceus_europaeus|13757           CAGGAGAGGATCATGGACCTGCTTGTCGTGGTGGAGAATGAAGACTTAACTGTTGAACTA
Monodelphis_domestica|9113          CAAGAAAGGATCATGGACCTGCTGGCCGTAGTAGAGAATGAGGATGTGACAATGGAGCTT
Macropus_eugenii|10709              CAGGAAAGAATCATGGATCTATTGGCAGTGGTAGAGAATGAAGATGTAACAATGGAGCTC
Anolis_carolinensis|12939           ------------------------------------------------------------
Gallus_gallus|7181                  CAGGAGCGGATCATGGAGCTGCTGGTGACAGTGGAGAATGAAGATGTGATAGTTGAGTTA
Taeniopygia_guttata|4202            CAGGAGAGGATCATGGAATTGTTGGTGACAGTGGAGAATGAAGATGTGATTGTTGAACTA
Dasypus_novemcinctus|7205           CAGGAAAGGATCATGGACCTCTTGGTGGTGGTGGAGAATGAAGATGTAACTGTTGAGCTA
Myotis_lucifugus|7417               CAGGATCGAATCATGGACCTGCTCGTGGTGGTGGAGAATGAAGACGTAACTATTGAGCTC
Procavia_capensis|8466              CATGAGAGGATCATGGACCTGCTGGTGGTGGTGGAGAATGAAGATGTTACTGTTGAGTTA
Choloepus_hoffmanni|5376            CAGGAGAGGATCATGGACCTCCTGGTGGTGGTAGAAAATGAAGATGTAACTGTTGAACTA
Vicugna_pacos|1270                  CAGGAGAGGATCATGGACCTGCTGGTGGTGGTGGAGAATGAGGATGTCACTGTTGAGCTG
Sorex_araneus|3827                  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ochotona_princeps|5227              CAGGAGAGGATCATGGACCTTCTTGTGGTGGTGGAAAATGAAGATGTAACTGCTGAGCTC
Dipodomys_ordii|12963               CAGGAGAGGATCATGGACCTGCTTGTGGTGGTGGAGAATGAGGACTTAACTGTGGAGCTC
Spermophilus_tridecemlineatus|12163 CAGGAGAGGATCATGGACCTGCTTGTGGTGGTGGAGAACGAAGATGTAACTGTTGAGCAA
Ochotona_princeps|12652             ------------------------------------------------------------
Oryctolagus_cuniculus|11447         CATAAGAGAATCATGGATCTACTTGTGGTGGTGGAAAATGAAGATGTAACTATTGAGCTA
Sus_scrofa|3743                     CAGTCACAGTGTCTCAAAGTTAttctc---------------------------------
Echinops_telfairi|18178             CAGGAGAGGATCATGGACCTACTGGCAGTAGTGGAGAATGAAGATGTAACTGTTGAGCTA
Cavia_porcellus|18337               CAGGAGAGGATCATGGACCTGCTCGTGGTGGTAGAGAATGAAGATGTAACCATTGAGCTA
Rattus_norvegicus|6711              CAGGAGAGGATCATGGACCTGCTGGTGGTAGTTGAGAATGAAGACGTGACAGTGGAACTG
Bos_taurus|9760                     CAGGAGAGGATCATGGACCTGCTTGTGGTGGTGGAGAATGAAGACGTCACTGCTGAGCTG
Loxodonta_africana|14919            CAGGAGAGGATCATGGACCTGCTGGTGGTGGTGGAGAATGAAGATGTAACTATTGAGCTA
Mus_musculus|7147                   CAGGAGAGGATCATGGACCTGCTGGTGGTGGTGGAAAATGAAGACGTGACTATGGAGCTA
Tursiops_truncatus|5172             CAGGAGAGGATCATGGACCTGCTTGTAGTGGTGGAGAATGAAGATGTCACTGTTGAGCTA
Canis_familiaris|27683              CAGGAGAGGATCATGGACCTGCTCATAGTGGTGGAGAATGAAGACGTAACCATGGAGCTG
Pteropus_vampyrus|12184             CAAGAGAGGATCATGGAGCTGCTCATCGTGGTGGAGAATGAAGATGTAACTGTTGAGCTA
Tarsius_syrichta|13906              CAGGAGAGGATCATGGACCTGCTTGTGGTGGTGGAGAATGAAGATGTAATGGTTGAGCTA
Microcebus_murinus|5590             CAAGAGAGAATCATGGACCTGCTTGTGGTGGTGGAAAATGAAGATGTAACTATTGAGCTA
Equus_caballus|4395                 CAGGAGAGGATCATGGACCTGCTCGTGGTGGTGGAGAATGAAGACGTAACAGTTGAGCTC
Callithrix_jacchus|51275            CAGGAGAGGATCATGGACCTGCTAGTGGTGGTGGAGAATGAAGATGTAACTGTTGAGCTA
Rhesus_macaque|16910                CAGGAGAGGATCATGGACCTGCTTGTGGTGGTGGAGAATGAAGATGTAACTGTTGAGCTA
Homo_sapiens|35585                  CAGGAGAGGATCATGGACCTGCTTGTGGTGGTGGAGAACGAAGATGTAACTGTTGAGCTA
Pan_troglodytes|16522               CAGGAGAGGATCATGGACCTGCTTGTGGTGGTGGAGAATGAAGATGTAACTGTTGAGCTA
Gorilla_gorilla|19974               CAGGAGAGGATCATGGACCTGCTTGTGGTGGTGGAGAATGAAGATGTAACTGTTGAGCTA
Pongo_abelii|11826                  CAGGAGAGGATCATGGACCTGCTTGTGGTGGTGGAGAATGAAGATGTAACTGTTGAGCTA
Danio_rerio|21516                   CAGAGCCGGATGGTGGAGGTCATTCCCACACTGACCGATGAGAAACTCACAGAACAGTTA
Tetraodon_nigroviridis|22877        CAGGAGAGGATAGTGAAGATTGTCCCTCGACTCAGTGAGGAGAAGCTGATCGAAGAGTTG
Fugu_rubripes|18278                 CAGGAGAGGATAGTGAAGATCGTCCCTCGACTCAGTGAGGAGAAGCTGATTGAAGAGTTG
                                                                                                

Xenopus_tropicalis|13716            GTGCAAGTAAATGATGACTTGAATAATGTTTTCCTAAGGCATGAAAGGTTCTCCCGTGCC
Tupaia_belangeri|4456               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|12277      ATTCGGGTGCACGAAAACCTCAGCGACGCCATCGTGAGATGTGAGCGGTTTTCCCAAACC
Felis_catus|46567                   ATTCAAGTGAATGAGGATTTGAATAATGCCATCCTTGGATGTGAGAGNNNNNNNNNNNNN
Erinaceus_europaeus|13757           ATTCAAGTAAATGAGAACTTGAATAATGCCATTCTTGGCTATGAAAGGTTTGTTCGAAAT
Monodelphis_domestica|9113          ATTCAAGTAAATGAGGATTTGAATCATGCTCTCCTTGGATATGAGAGGTTTTCTCGAAAT
Macropus_eugenii|10709              ATTCAAGTGAATGAGGATTTGAATCAGGCCCTCCTTGGATATGAGAGATTTTCTCGAAAT
Anolis_carolinensis|12939           ------------------------------------------------------------
Gallus_gallus|7181                  ATACAAGTAAACGAAGATCTGAATAATGTTCTCCTGGGACACGAAAGGTTCTCTCGCAAC
Taeniopygia_guttata|4202            ATACAAGTAAATGAAGATCTGAATAATGTCCTCCTGGGACATGAAAGG------------
Dasypus_novemcinctus|7205           CTTCAAGTGAATGAGGACTTGAATAATGCCCTTCTTGGATATGAGAGGTTTACTAGAAAC
Myotis_lucifugus|7417               ATTCAAGTGAATGAGGATCTGAATAATGCCATCCTTGGCTATGAGAGGTTTACTCGAAAC
Procavia_capensis|8466              ATTCAAGTGAAT---GATTTGAATAATGCGCTCCTTGGATGTGAGAGGTTTACTCGAAAC
Choloepus_hoffmanni|5376            CTTCAAGTGAATGAGGATTTGAATAATGCCCTTCTTGGATATGAGAGNNNNNNNNNNNNN
Vicugna_pacos|1270                  ATTCAAGTGAATGAGGATTTGAATAATGCCATCCTTGGGTGCGAGAGGTTTACTCGAAAC
Sorex_araneus|3827                  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTTGCTCGAAAC
Ochotona_princeps|5227              ATTCAAGTGAATGAGGATTTGAATAATGCCATCCTTGGATATGAAAGGTTCACTCGAAAC
Dipodomys_ordii|12963               ATTCAAGTGAATGAGGATTTGAATAATGCCATCCTTGGGTATGAGAGGTTTACTCGAAAC
Spermophilus_tridecemlineatus|12163 ATTCAAGTGAATGAGGATTTGAATAATGCCATCCTNNNNNNNNNNNNGTTTATTCGAAAC
Ochotona_princeps|12652             ------------------------------------------------------------
Oryctolagus_cuniculus|11447         ATTCAAGTAAATGAGGATTTGAATAATGCCATCCTTGGATATGAGAGGTTTACTCGAAAT
Sus_scrofa|3743                     ------------------------------------------------------------
Echinops_telfairi|18178             ATTAAAGTAAATGAGGATTTGAATAATGCCCTCCTTGGATATGAGAGATTCACTCGAAAC
Cavia_porcellus|18337               ATCCAAGTGAATGAAGATCTGAACGAGGCCATTCTTGGCTATGAGCGGTTTATTCGAAAC
Rattus_norvegicus|6711              ATTCAAGTGAACGAGGATCTGAATAATGCCATCCTCGGATACGAGAGGTTTACTCGAAAC
Bos_taurus|9760                     ATTCAAGTGAACGAGGATCTGAATAATGCCATCCTTGGGTGTGAGAGGTTTACTCGAAAC
Loxodonta_africana|14919            ATTCAAGTGAACGAGGATTTGAATAATGCCCTCCTTGGATATGAGAGGTTTGCTCGAAAC
Mus_musculus|7147                   ATTCAAGTGAACGAGGATCTGAATAATGCCGTCCTTGGATATGAGAGGTTTACTCGAAAC
Tursiops_truncatus|5172             ATTCAGGTGAATGAGGATTTGAATAACGCCATCCTTGGATATGAGAGGTTCATTCGAAAC
Canis_familiaris|27683              ATTCAAGTGAATGAGGATTTGAATAACGCCCTCCTTGGATGTGAGAGATTCACTCGGAAC
Pteropus_vampyrus|12184             ATTCAAGTGAATGAGGATTTGAACAATGCCATCCTTGGATATGAGAGGTTTACTAGAAAC
Tarsius_syrichta|13906              ATTCAAGTGAATGAGGATTTGAATAATGCTATCCTTGGATATGAGAGGTTTACTAGAAAC
Microcebus_murinus|5590             ATTCAAGTGAATGAGGATTTGAATAACGCCATCCTTGGGTATGAGAGNNNNNNNNNNNNN
Equus_caballus|4395                 ATTCAAGTCAATGAGGATTTGAATAATGCCATCCTTGGATGTGAGAGGTTTACTCGAAAC
Callithrix_jacchus|51275            ATTCAGGTGAATGAGGATTTGAATAATGCCATCCTTGGATGTGAACGGTTTACTAGAAAC
Rhesus_macaque|16910                ATTCAGGTGAACGAGGATTTGAATAATGCCATCCTTGGATATGAGAGGTTTACTAGAAAC
Homo_sapiens|35585                  ATTCAGGTGAATGAGGATTTGAATAATGCTATCCTTGGATATGAGAGGTTTACTAGAAAC
Pan_troglodytes|16522               ATTCAGGTGAATGAGGATTTGAATAATGCTATCCTTGGATATGAGAGGTTTACTAGAAAC
Gorilla_gorilla|19974               ATTCAGGTGAATGAGGATTTGAATAATGCTATCCTTGGATATGAGAGGTTTACTAGAAAC
Pongo_abelii|11826                  ATTCAGGTGAATGAGGATTTGAATAATGCCATCCTTGGATATGAGAGG------------
Danio_rerio|21516                   CTCAACGCCAATGATGACATCAACACCACGTTCACACAGTATCACAGATTCGAGAAACAT
Tetraodon_nigroviridis|22877        CTGGCAACTAATGATGAGATGAACACTGCATTTAATTGTTACCACAGGTGCTCCTTAAAG
Fugu_rubripes|18278                 CTGACAACTAATGATGAGATGAACACTGCA---------TTTACTCGTTTCCACAGGTTT
                                                                                                

Xenopus_tropicalis|13716            AAAGCTAATCAGTCGGCAGAACACAGAAGACAGGCT---------GAAATAATGACGTTT
Tupaia_belangeri|4456               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------NNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|12277      CGGAAAGACATCCGGGAGCAGACCGGACCCCTGATC---------GAATCCATCACGGTT
Felis_catus|46567                   NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------NNNNNNNNNNNNNNN
Erinaceus_europaeus|13757           CAGCAGAGAATTTTGGAAGAAAATAAGAACCAGAAT---------GGCAATATACATNNN
Monodelphis_domestica|9113          CAACAACGATATCAGGAGCAAAATCAGAGCCTACGG---------GAAGCCCAGAAGAAT
Macropus_eugenii|10709              CAGAAACGATTCCAGGAACAAAAACAGAGCCAAGAG---------GAAGCCCAGAGGAAT
Anolis_carolinensis|12939           ------------------------------------------------------------
Gallus_gallus|7181                  AGAGTTCGATTTTTGGAGAACCAGAGAATACAGCGTGAACGTGAGGAGAATGTTAAGCTG
Taeniopygia_guttata|4202            ------------------------------------------------------------
Dasypus_novemcinctus|7205           CAGCAAAGGATTTTGGAGCGAAATAAGAACTGGGAG---------GAAGCCACCAGTACT
Myotis_lucifugus|7417               CAACAAAGGATTTTGGAGCAAAAT---AATCAGAGA---------GAAGACACCAATGCT
Procavia_capensis|8466              CAACAAAGAATTCTGGAGCAAAATAGGAACCAAGAG---------GAAGCTGCCAAAGCT
Choloepus_hoffmanni|5376            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------NNNNNNNNNNNNACT
Vicugna_pacos|1270                  CAACAAAGGATTTTGGAGCAAAATAAGAACCAGCGG---------GAAGATGCCAATGCT
Sorex_araneus|3827                  CAACAAAGAATTTTGGAGCAAAATACAAACCAGAGA---------GAAGAAACCAATACC
Ochotona_princeps|5227              CAACAAAGGATTTTGGAGCAAAATAATAACTGGGAG---------GAAGCCACCAATCCT
Dipodomys_ordii|12963               CAACAGAGGCTTTTGGAGCAAAGGGGGAACCAGAAT---------GAAGCCACCCATACT
Spermophilus_tridecemlineatus|12163 CAGCAAAGGCTTTTGGAGCAACATACGAACCAGATG---------GAAGCCACCAATACT
Ochotona_princeps|12652             ------------------------------------------------------------
Oryctolagus_cuniculus|11447         CAGCAAAGGATTTTAGAGCAAAATAGAAACCAGGAG---------GAAGCCACCAATGCT
Sus_scrofa|3743                     ------------------------------------------------------------
Echinops_telfairi|18178             CAACAAAGGATTGTGGAGCAAAACGAGAACCAG------------GAGGCTGCCAATACG
Cavia_porcellus|18337               CAACAAAGGCTTTTGGAGCAAAATAAAATCCAGAAT---------GGAACTGCCAATACC
Rattus_norvegicus|6711              CAGCAAAGGCTTTTGGAACAGAAGAGGAACCCGACG---------GAAGCCAATCAGACT
Bos_taurus|9760                     CAACAAAGGATTTTAGAGCAAAATAAGAGCCAGAGG---------GAAGATGCCAATACT
Loxodonta_africana|14919            CAACAAAGGGTTTTGGAGAAAAATAACAACCAGGAG---------GAAGCTGCCAATGCT
Mus_musculus|7147                   CAACAAAGGCTTTTGGAACAGAAGAGGAACCGGACA---------GAAGCAACCCGTACT
Tursiops_truncatus|5172             CAACAAAGGATTTTGGAGCAAAATAAGAACCAGAGG---------GAAGATGCCAATACT
Canis_familiaris|27683              CAACAAAGAATTTTGGAGCAAAATAGGAACCAGAGG---------GAAGATGCCAATACT
Pteropus_vampyrus|12184             CAGCAAAGGATTTTGGAGGAAAAT---AACCAGAGG---------GAAGATGCCAATACT
Tarsius_syrichta|13906              CAGCAAAGGATTTTAGAGCAAAATAAGAACCAGCAA---------GAAGCCACCAATACT
Microcebus_murinus|5590             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------NNNNNNNNNNNNNNN
Equus_caballus|4395                 CAACAAAGGATTTTGGAGCAAAATAAGAACCAGACA---------GAAGATGCCAATATT
Callithrix_jacchus|51275            CAACAAAGGATTTTGGAGCAAAATAAGAACCAGAAG---------GAAGCCACCAATACT
Rhesus_macaque|16910                CAACAAAGGATTTTGGAGCAAAAT---AACCAGAAG---------GAAGCCACCAGTACT
Homo_sapiens|35585                  CAACAAAGGATTTTGGAGCAAAATAAGAACCAGAAG---------GAAGCCACCAATACT
Pan_troglodytes|16522               CAACAAAGGATTTTGGAGCAAAATAAGAACCAGAAG---------GAAGCCACCAATACT
Gorilla_gorilla|19974               CAACAAAGGATTTTGGAGCAAAATAAGAACCAGAAG---------GAAGCCACCAATACT
Pongo_abelii|11826                  ------------------------------------------------------------
Danio_rerio|21516                   CTGAGCAGACAGAGCAGT------------------------------------------
Tetraodon_nigroviridis|22877        TTTAAAAAACAGATAATGAAAAATCCAGAAAGG------------GAAGAGAAGAACCAC
Fugu_rubripes|18278                 GAGAAACGGATAACAAAGAATCCAGATAGAGCAAAG---------AAGAACCACGCAAGT
                                                                                                

Xenopus_tropicalis|13716            GATGACAATGGTCCTACAGCTCCTTTGTCTGAACTGATAGACTTGAATGTACCATCAGGC
Tupaia_belangeri|4456               NNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNN
Ornithorhynchus_anatinus|12277      TCC---CGGCAGCCCTCCGCCCCTTCCTACGAATTGGTCAGTTTAAGG---CCGGATCCC
Felis_catus|46567                   NNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNN
Erinaceus_europaeus|13757           NNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNN
Monodelphis_domestica|9113          AAC---TGTGAGCCTTCTGCCCCATCCTGTGATTTACTTGACTTAAGT---CCAAGTCCA
Macropus_eugenii|10709              AAT---TGTGAGCCTTCTGCTCCATCCTGTGATTTGCTTGACTTAAGT---CCAGGTCCA
Anolis_carolinensis|12939           ------------------------------------------------------------
Gallus_gallus|7181                  TACAGGAAACAGCCGTCTGCTCCCTCCAGTGATCTCCTTGACCTCTCT---ACAGATTCT
Taeniopygia_guttata|4202            ------------------------------------------------------------
Dasypus_novemcinctus|7205           TCC---AGTGAGCCTTCTGCTCCATCCTGTGATCTCCTTGACCTAAGT---CCCAGCCCC
Myotis_lucifugus|7417               GCC---ACGGAACCTTCTGCCCCATCCTGTGATCTTCTTGACCTAAGC---CCCAGCACT
Procavia_capensis|8466              ACC---AGTGAACCTTCTGCCCCATCCTGTGATCTCGTCGACCTAAGT---CCCAGTCCC
Choloepus_hoffmanni|5376            GCC---AGTGAGCCTTCTGCCCCATCCTGTGATCTCCTTGACCTAAGT---CCCGGTCCC
Vicugna_pacos|1270                  ACC---AGTGAACCTTCTGCCCCGTCCTCTGATCTCCTTGACCTAAGT---CCCAGCCCT
Sorex_araneus|3827                  TCC---AGTGAACCTTCCGCCCCATCCTGTGATCTCCTTGACCTAAGT---CCTAGCCCT
Ochotona_princeps|5227              GCC---AGCGAGCCTTCCGCTCCATCTTGTGACCTCCTGGACCTCAGT---CCCAGTCCC
Dipodomys_ordii|12963               GCC---AGTGAGCCTTCTGCTCCATCTTGTGATCTCTTGGACCTGAGT---CCCAGCTCT
Spermophilus_tridecemlineatus|12163 ACC---AGTGAGCCCTCCGCTCCATCTTGTGAGCTCCTGGATTTAAGT---CCCAGCACC
Ochotona_princeps|12652             ------------------------------------------------------------
Oryctolagus_cuniculus|11447         ACC---AGTGAGCCTTCCGCTCCATCTTGTGATCTCCTGGACCTCAGT---CCCAGTCCC
Sus_scrofa|3743                     ------------------------------------------------------------
Echinops_telfairi|18178             GCC---AGTGGACCTTCTGCCCCATCCTGTGATCTCCTGGACCTCACC---TCCAGTCAT
Cavia_porcellus|18337               TCC---AGCGAGCCTTCCGCACCGTCTTCTGACCTCCTTGACCTAAGT---CCCAGCCCC
Rattus_norvegicus|6711              TCC---AGCGAACCCTCTGCTCCTTCCTGCGATCTCCTCAACCTAGGT---CCCGTGGCG
Bos_taurus|9760                     ACC---AGTGAACCTTCTGCCCCATCCTCAGATCTCCTTGACCTGAGT---CCCAGCCTT
Loxodonta_africana|14919            ACC---AGTGAACCTTCTGCCCCATCTTATGATCTCCTCGACCTAAGC---CCCAGCCCC
Mus_musculus|7147                   TCC---AGCGAGCCCTCTGCTCCTTCCTGCGATCTCCTCGACCTAAGC---CCCATCGTG
Tursiops_truncatus|5172             ACC---AGTGAACCTTCTGCCCCATCCTCTGATCTCCTTGACCTGAGT---CGCAGCTCT
Canis_familiaris|27683              TCC---AGTGAACCTTCTGCCCCATCCTGTGATCTTTTAGACCTAAGG---CCCAGTCCA
Pteropus_vampyrus|12184             ACC---AGTGAACCTTCTGCCCCATCCTATGATCTTCTTGACCTAAGT---CCCAGCCCT
Tarsius_syrichta|13906              ACC---AGTGAGCCTTCTGCCCCATCTCATGATCTCCTTGACCTGAGT---CCCAGTCCT
Microcebus_murinus|5590             NNNNNNNNNNNNNNNNNNNNNNNNNNNTGTGATCTCCTGGACCTGAGT---CCCAGTCCT
Equus_caballus|4395                 ACC---AGTGAACCTTCTGCCCCGTCCTGTGATCTCCTTGACCTGAGT---CCCAGCCCC
Callithrix_jacchus|51275            ACA---AGTGAGCCTTCTGCCCCATCTCAAGATCTCCTTGACCTAAGT---CCCAGTCCC
Rhesus_macaque|16910                ACC---AGTGAGCCTTCTGCCCCATCTCAAGATCTCCTCGACCTAAGT---CCCAGTCCC
Homo_sapiens|35585                  ACC---AGTGAGCCTTCTGCCCCATCTCAAGATCTCCTCGACCTAAGT---CCCAGTCCC
Pan_troglodytes|16522               ACC---AGTGAGCCTTCTGCCCCATCTCAAGATCTCCTCGACCTAAGT---CCCAGTCCC
Gorilla_gorilla|19974               ACC---AGTGAGCCTTCTGCCCCATCTCAAGATCTCCTCGACCTAAGT---CCCAGTCCC
Pongo_abelii|11826                  ------------------------------------------------------------
Danio_rerio|21516                   ------GCACAGCCTAATGCACCCAGCACAAACCTCACAGACTTGGATTCTCCCAAACAG
Tetraodon_nigroviridis|22877        ACA---AATGCTGACCAAACCCCGAGGCTCAAATCAGTTGACGATGAG---AACTCCATT
Fugu_rubripes|18278                 ACTTTCGATACCCCGAGGCTCGAATCAGCTGATCATGAAAACTTCAAATACAAGTCCATC
                                                                                                

Xenopus_tropicalis|13716            ------CCTGTGCATCCTGTCCATTCTAATGGTTTCCTTCTGCCAGCTCCTACTATGCCA
Tupaia_belangeri|4456               ------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|12277      ------CCGGTTCCGGAG------------------------------------------
Felis_catus|46567                   ------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Erinaceus_europaeus|13757           ------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Monodelphis_domestica|9113          AGCTCTTTGACTTCTGGCTTGTTATTGGATGGAGTACATACCATGAGTTCTCAATTTTCT
Macropus_eugenii|10709              AGCTCTTTGACTTCTGGCTTGCCATTGGAAGGAGTCCATGCCATGAGTTCTCAATTTTCT
Anolis_carolinensis|12939           ------------------------------------------------------------
Gallus_gallus|7181                  ------CCATCTCCTGTGGCTGCAGTGCTGGGGACTGACCCTGCAGCATCTCAGTTTCCA
Taeniopygia_guttata|4202            ------------------------------------------------------------
Dasypus_novemcinctus|7205           ------CCAACTCCTCAGGCTTCTCTGCAAGAAATCAGTGCCATGAACACTCAGCTTTCA
Myotis_lucifugus|7417               ------CCGAATCATAGGGCTACTCTGGAAGAGGTCAACGCCATGAATGCTCAGCTTTCA
Procavia_capensis|8466              ------CCAACTCCTAGGGCCCCTCTGGGAGAAGTCAGCGCCATGAATGCTCAGCTTTCA
Choloepus_hoffmanni|5376            ------CCAACTCCTCGGGCCACTCTGCGAGGAATCAGTGCCATGAACGCTCAGCTTTCA
Vicugna_pacos|1270                  ------CGGATGCATAGGGCCTCTCTGGGAGAACTCAACACCCTGAATGCTCAGCTTTCA
Sorex_araneus|3827                  ------CCCATTCCTCGGGCCTATCTGGGGGACCGCAACACAGCGAATGCTCAGCTTTCA
Ochotona_princeps|5227              ------CCCATGCCCAGGGCCCCTCTGGGAGAACTCAACTCTGTGAATGCTCAGCTCTCA
Dipodomys_ordii|12963               ------TTCGTTCCTGCAGTCACTCAAGGAGAACTCAGCAACATGAATGCACAGTTTTCA
Spermophilus_tridecemlineatus|12163 ------TTGATGTCAATGGCCACTCAAGGAGAACTCAGCAACGTGAATTCTCAGCTTTCA
Ochotona_princeps|12652             ------------------------------------------------------------
Oryctolagus_cuniculus|11447         ------CCGATGCCTGGGGCCCCTCTGGGAGAACTCAACACCGTGAACGCTCAGCTTTCA
Sus_scrofa|3743                     ------------------------------------------------------------
Echinops_telfairi|18178             ------CCAACTCCTGAGGGCCCTCGGGGAGAACTCAACACCGTCAATGCTCAACTTTCA
Cavia_porcellus|18337               ------TTGATGCCTCCAGCCCCTCAGGGAGACTTCAACAGCATGAATGCTCAGCTTTCA
Rattus_norvegicus|6711              ------CCAGTGCCTGTGTCCAGTGAGGGACCACTCAACTCCGTGAACGCTCAGCTTTCC
Bos_taurus|9760                     ------CCAACGCCTAGGACCACCCTGGGAGAAGTCAGCACCCTGAATGCTCAGCTTTCA
Loxodonta_africana|14919            ------CTGACTCCTAGGGCCGCTCTGGGAGAACTCAGCACTATGAATGCTCAGCTTTCA
Mus_musculus|7147                   ------CCAGTGCCTACGCCCAATGAGGGAGCACTCAACTCCGTGAACGCCCAGCTTTCA
Tursiops_truncatus|5172             ------CTGATGCATAGGGCCACTTTGGGAGAACTCAGCACCCTGAATGCTCAGCTTTCA
Canis_familiaris|27683              ------CCAATGCCCAGGGCTAGTCTGGGAGAACTCACCACCATGAATGCTCAGCTTTCA
Pteropus_vampyrus|12184             ------CCAAATCACAGGGTCACACCGGGAGAAGACAACACCATGAATGCTCAGCTTTCA
Tarsius_syrichta|13906              ------CCGATGCCTGAGGCTTCTCTGGGAGAACTCAACACCATGAATGCTCAGCTTTCA
Microcebus_murinus|5590             ------CCGATGCCTAGGGCCACTCTGGGAGAACTCAGCACCAGGAATGCTCAGCTTCCA
Equus_caballus|4395                 ------CCGAAGCCGAGGGCCACTCTGGGAGAACTCAACTCCGTGAATGCTCAGCTCTCA
Callithrix_jacchus|51275            ------CGGATGTCTAGGGCCACTCTGGGAGAACTCAACACCATGAATGACCAACTTTCA
Rhesus_macaque|16910                ------CGGATGCCTAGGGACACTCTGGGAGAACTCAACACCATGAATAATCAACTTTCA
Homo_sapiens|35585                  ------CGGATGCCTAGGGCCACTCTGGGAGAACTCAACACCATGAATAATCAACTTTCA
Pan_troglodytes|16522               ------CGGATGCCTAGGGCCACTCTGGGAGAACTCAACACCATGAATAATCAACTTTCA
Gorilla_gorilla|19974               ------CGGATGCCTAGGGCCACTCTGGGAGAACTCAACACCATGAATAATCAACTTTCA
Pongo_abelii|11826                  ------------------------------------------------------------
Danio_rerio|21516                   TTAAAGGCAGCAAATGGTGCTCATCAATCAGCAGTCACCACACTCTCCAATCAGATGTCA
Tetraodon_nigroviridis|22877        TACCTGTCAACAGCTGATAGCTTGTTGAGTACGATGGCGAGACTTGGTAAGTGCTTTAAG
Fugu_rubripes|18278                 ---------------------------------ACTGATCATTTGTCGAGTAAGATGGCA
                                                                                                

Xenopus_tropicalis|13716            ATGCACCCT------TGGCCAACACACACTCCTCATTTTCCAGATAAAAGTGGTCTGGAG
Tupaia_belangeri|4456               NNNNNNNGT------TTCAGATCTCCGAGTCCTGTTGTAACAAAC---------------
Ornithorhynchus_anatinus|12277      ------------------------------------------------------------
Felis_catus|46567                   NNNNNNNAT------TTCAGGTCTCCGAGTCCTGTTGTAACGAAC---------------
Erinaceus_europaeus|13757           NNNNNNNAT------CTCAGCTCTCCAAGTCATGTTGTAACAAAC---------------
Monodelphis_domestica|9113          GACTTAAAT------GTCAAGTCTCCAACTGACAGTGATGGCAAC---------------
Macropus_eugenii|10709              GGCTTAAAG------GTCAGCTCTTCACGTTCCACTGATGCCATC---------------
Anolis_carolinensis|12939           ------------------------------------------------------------
Gallus_gallus|7181                  AGCCCTAAT------TCCATGTCTGCACACCCTGAAGATAGAAAA---------------
Taeniopygia_guttata|4202            ------------------------------------------------------------
Dasypus_novemcinctus|7205           GACTTAAAT------TTAAGCTCTCCAAGTCCTGTTGTAACAAAC---------------
Myotis_lucifugus|7417               CACTTAAGT------TTCAGCTCTCCAACTCCTGTGATAATGAAC---------------
Procavia_capensis|8466              GACTTAAGT------TTTAGGTCTTCAAGTCGTGTTGTGACAAAC---------------
Choloepus_hoffmanni|5376            GACTTAANN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------------
Vicugna_pacos|1270                  GACTTAAAT------TTCAGCTCTCCAAGTCCTGTTGTAACAAAC---------------
Sorex_araneus|3827                  GACTTAANN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNC---------------
Ochotona_princeps|5227              GACTTAAGT------CTCAACTTCATAAATCCTGTTGCAACAAAC---------------
Dipodomys_ordii|12963               AACTTAAGT------TTCAGTGCTCCAAATCCTGTAGTAACAAAC---------------
Spermophilus_tridecemlineatus|12163 AACTTAAGT------TTCAGCTCTCCAAGTCCTATTGTAAGAAAC---------------
Ochotona_princeps|12652             ------------------------------------------------------------
Oryctolagus_cuniculus|11447         GACTTAAGT------CTCAACTTTGTAAATCCTGCTGTAACAAAC---------------
Sus_scrofa|3743                     ------------------------------------------------------------
Echinops_telfairi|18178             GACTTAAGT------TTTCGATCTCCAACTCCTGTTTTAACAAAC---------------
Cavia_porcellus|18337               GACTTAAGT------TTCAGCTCTCCAAGTCCTATTGTAACAAAC---------------
Rattus_norvegicus|6711              GGCCTAAAT------GTCAGCTCTCAGAGTCCTGTTATAACAAAC---------------
Bos_taurus|9760                     GACTTAAAT------TTCAGCTCTCTGAGACCAGTTGTACCAAAC---------------
Loxodonta_africana|14919            GACTTAAAT------TTTAAATCTCCAAGTTCTGTTATGACAGAC---------------
Mus_musculus|7147                   GGCCTAAGT------GTCAGCTCTCTGAGCCCTGTTATAACAAAC---------------
Tursiops_truncatus|5172             GACTTAAAT------TTCAGCTCTACAAGTCCTGTTGTAACAAAC---------------
Canis_familiaris|27683              GACTTAAGTAATGCTTTGTCTTTATTCTCTTTGGTATTTGGGCAC---------------
Pteropus_vampyrus|12184             GACTTAAAT------TTCAGCTCTTCAAGTCCCGTTGTAACAAAC---------------
Tarsius_syrichta|13906              GACTTAGAT------TTCAGCTCTCCAAGTCATGAAGCC---------------------
Microcebus_murinus|5590             GACTTAANN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------------
Equus_caballus|4395                 GACCTAAAT------TTCACTTCTTCAAGTCCTGCTGTAACGAAC---------------
Callithrix_jacchus|51275            GACTTAAAT------TTCAGCTCTCCAAGTTCTGGTGTAACAAAC---------------
Rhesus_macaque|16910                GACTTAAAT------TTCAGCTCTCCAAGTTCTGATGTAACAAAC---------------
Homo_sapiens|35585                  GGCTTAAAT------TTCAGCCTTCCAAGTTCTGATGTAACAAAC---------------
Pan_troglodytes|16522               GGCTTAAAT------TTCAGCCTTCCAAGTTCTGATGTAACAAAC---------------
Gorilla_gorilla|19974               GGCTTAAAT------TTCAGCCTTCCAAGTTCTGATGTAACAAAC---------------
Pongo_abelii|11826                  ------------------------------------------------------------
Danio_rerio|21516                   GGATTGAGC------ACAAAAGAAGATGACCTAAATTTTAAAAGC---------------
Tetraodon_nigroviridis|22877        GGGAAAAAC------CTTAAGCAGGACCAGGCTCATGTGGGGGAT---------------
Fugu_rubripes|18278                 AAACTTGCT------ACAAGTGAATCAAtaaattcttTTTGGAGC---------------
                                                                                                

Xenopus_tropicalis|13716            AACCGGGTTCCTTTCCTTTATCCACAGATGGATTTACAAGGACTACGGGAAGCAGTAGAT
Tupaia_belangeri|4456               AACGTGAAACCTAGTCTTTATCCACAGATGGATTTGCTAGCTTCGGAAAATACAGAAGTA
Ornithorhynchus_anatinus|12277      ------------------------------------------------------------
Felis_catus|46567                   AACTTGAAACCCAGTCTTCATCCACAGGTGGATTTGCTAGCCTGGGAAGATACAGAAACA
Erinaceus_europaeus|13757           GACTTGAAACCCAGTATTTATCCACAGGAGGATTTATTAGCCTTGGAAAATACAGAAGTG
Monodelphis_domestica|9113          CACTCAAACCCAGTGATTTATCAAGAGCTGGATTTGCTGGCCTCAGAGAATCCAGAAATA
Macropus_eugenii|10709              CCCTCAAACCCCATGGTTCACTCACAGCTGGATTTACTGGCCTCAGAGAATCCAGAAATA
Anolis_carolinensis|12939           ------------------------------------------------------------
Gallus_gallus|7181                  AGGCTCCATCCATTCATTTATCCCCAGCTAGATTTAGCAGCTGCTGCGAAAGCTCAGCAG
Taeniopygia_guttata|4202            ------------------------------------------------------------
Dasypus_novemcinctus|7205           AACTTGAAACCCAGTCTTCATCTACCAGTGGATTTGCTAGCCTCTGAAAATACAGAAACA
Myotis_lucifugus|7417               AGCTTGCAGCCCAGTCCTCGCCCACAAATGGATCTGCTAGCCTTGGAAAACACGGACACA
Procavia_capensis|8466              AGTGTGAGCCACAGTCAACATCCGCAGATGGAATTGCTGGCCTCCGGACGTACAGAAACA
Choloepus_hoffmanni|5376            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Vicugna_pacos|1270                  AGCTTGAAACCCAGTCTTCATGCACAGGTGGATTTACTAGCCTTGGAAAACACAGAAACA
Sorex_araneus|3827                  AACATGAAACCCAGTCTTCATACACAGGAGGATTTGCTTGCGTTGGAA---CCAGGAGCT
Ochotona_princeps|5227              AACTTGAAACCTAGCCTTCCTCCAGAGGTAAATCTGCCAGCCTTTGAAAATACAGAAATA
Dipodomys_ordii|12963               AACTTGAGTCCCAGTCTTTATCCACAAATGGATTTGTTAGCNNNNNNNNNNNNNNNNNNN
Spermophilus_tridecemlineatus|12163 AACTTGAATCCCAGTCTTCATTCAAATGTGGATTTGCTAGCCTCGGAAAATACAGAAATG
Ochotona_princeps|12652             ------------------------------------------------------------
Oryctolagus_cuniculus|11447         AACTTGAAACCCAGTTTTCATCCAGAGGTGAATTTGTCAGCCTTTGAAAATACAGAAATG
Sus_scrofa|3743                     ------------------------------------------------------------
Echinops_telfairi|18178             AACATGAACCCCAGTCGTCATCCACAGGTGGATTTGCTAGCCTCAGAAAACACAGAAACA
Cavia_porcellus|18337               AACTCAAATTCCTGTGTTTATCCACATGTGGACTTGCTAGCCTTGGAAAATACAGAAGTA
Rattus_norvegicus|6711              AACTTGTATCCCAGTCTTCAGCCACAGATGGATTTACTAGCATCAGAAGATACAGAAGTA
Bos_taurus|9760                     AACTTCAAACCCAGTCTTAATACACAGGTGGATCTGCTAGCCTTGGAAAATACAGAAACA
Loxodonta_africana|14919            AACGTGAACCCCAGTTGCCATCCACAGTTGAACTTTGTAGCCTCAGGAAATACAGAAACA
Mus_musculus|7147                   AACTTGTATCCCAGTCTTCAGCCACAGAGGGATTTACTAGCATCAGAAGATATAGAAATA
Tursiops_truncatus|5172             AACTTGAAACCCAGTCTTCATCCACAGGTGGATTTGCTAGCCTCAGAAAACACAGAAACA
Canis_familiaris|27683              CAAAAGCTGGTGGGCATGGACACCAGAAGGCTATTGTTATATAAAATTAATTTATCATTG
Pteropus_vampyrus|12184             AACTTGCATCCCAGTCTTCACTCACGGCTGGATTTGCTAGCCTTGGAAAATACAGAAACA
Tarsius_syrichta|13906              ------------AGTCTTCATCCACAGATGGATTTGCTAGCCTTGGAAAACACAGAAATA
Microcebus_murinus|5590             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Equus_caballus|4395                 AACGTGAAACCTAGTCTTTGTCCACAGATGGATTTGCTAGCCTTGGAAAATACAGAAACA
Callithrix_jacchus|51275            AACTTAAAACCCAGTCTTCATCCACAGATGGACTTGCTAGCCTTGGAAAATACAGAAATA
Rhesus_macaque|16910                AACTTAAAACCCAGTCTTCATCCACAGATGGACTTGCTAGCCTTGGAGAATACAGAAATA
Homo_sapiens|35585                  AACTTAAAACCCAGTCTTCATCCACAGATGAACTTGCTAGCCTTGGAGAATACAGAGATA
Pan_troglodytes|16522               AACTTAAAACCCAGTCTTCATCCACAGATGAACTTGCTAGCCTTGGAGAATACAGAGATA
Gorilla_gorilla|19974               AACTTAAAACCCAGTCTTCATCCACAGATGAACTTGCTAGCCTTGGAGAATACAGAGATA
Pongo_abelii|11826                  ------------------------------------------------------------
Danio_rerio|21516                   AGCTCATTACTAAAAAGTCCGGAACGCTCTGCAGCTCTGGCCACACCTGGACGAGACACT
Tetraodon_nigroviridis|22877        ---------------------CCTCATGCTGATGGCCAGCTGGGTAAAGAGAGAAGAGAA
Fugu_rubripes|18278                 TTTTATAGGCTTCAGTCAAATAAAATACTAGCTCTGTTAGCATCCTTGGGTAAGAACATG
                                                                                                

Xenopus_tropicalis|13716            ---ACAAGA---TTTGAACTAGGAGTCCAGTTGCCAGAAGTACCTCCACAGAACATATAT
Tupaia_belangeri|4456               ---CCCCTG---TTTGCCCAAAGGACCAGC---CAAAACCTTACCTCGAGGCAAACGTAT
Ornithorhynchus_anatinus|12277      ------------------------------------------------------------
Felis_catus|46567                   ---CCCCTN---NNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNN
Erinaceus_europaeus|13757           ---CCTCTG---TTAACCAAAAGGATCAGT---GAAAACCTCACTTTGGGCCATATGTAT
Monodelphis_domestica|9113          ---TCCCTG---TTTCCACAAAGGACAGAT---------------------CATCTGTAT
Macropus_eugenii|10709              ---TCCCTN---NNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNN
Anolis_carolinensis|12939           ------------------------------------------------------------
Gallus_gallus|7181                  TTCCCATTTGCAGCTGAAGCACAAAACAATAGTGTAAGCACCCCAGCTGGACATACATAT
Taeniopygia_guttata|4202            ------------------------------------------------------------
Dasypus_novemcinctus|7205           ---CCCCTG---TTTGCCCAAAGGACCAGC---CAAAACCTCGCCTCAAGTCATACAAAT
Myotis_lucifugus|7417               ---GCCATG---TTTGCCCAAAGGACCAGC---CAAAACCCCGACTCAAGTCATACATAC
Procavia_capensis|8466              ---CCCTTG---TTTCCCCAAAGGACCAGC---CAAAACCTCGCCTCAAGTCACACATAT
Choloepus_hoffmanni|5376            ---NNNNNG---TTTGCCCAAAGGACCAGC---CAAAACCTCGCCTCAAGTCATACATAT
Vicugna_pacos|1270                  ---CCCCTN---NNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNN
Sorex_araneus|3827                  ---CCCCTG---TTTCCCCAGAGGACCAGC---CAAAACCTTGCCCCGGGTTCTGCTTAT
Ochotona_princeps|5227              ---CCCATG---TTTGCCCAAAGAACCAAC---CAAAACCTCGCCTCAAGTCATACATAT
Dipodomys_ordii|12963               ---NNNNNG---TTTGCCCAAAGGACCAGC---CAAAATCTCACCTCAAGTCACACATAC
Spermophilus_tridecemlineatus|12163 ---CACCTG---TTTGCCCAAAGGACACGC---CAAAACCACGACTCAAGTCACACATAT
Ochotona_princeps|12652             ------------------------------------------------------------
Oryctolagus_cuniculus|11447         ---CCCATAAAGTTTGCCCAAAGGACCCGC---CAAAACCTCGCCTCAAGTCATACATAT
Sus_scrofa|3743                     ------------------------------------------------------------
Echinops_telfairi|18178             ---CCCCTG---TTTCCCCAGAGGACCGGC---CAAAACCTCGCTTCAGGTCATACATAT
Cavia_porcellus|18337               ---TCCGTG---TTTGCCCAAAGGACCAGC---CCAAACCTCACTTCAAGTCATACATAT
Rattus_norvegicus|6711              ---CCCACCTTGTTTCCCCAGAGGACCAGC---CAAAACCTCGCCTCAAGCCACACATAT
Bos_taurus|9760                     ---CCCCTG---TTTGCCCAAAGGACCAGC---CAAAACCTCGCCTCAAGTCATACATAC
Loxodonta_africana|14919            ---CCCTTG---CTTCCCCAAAGGACCAGC---CAAAACCTCGCCTCAAGTCACACCTAT
Mus_musculus|7147                   ---CCCACCTTGTTTCCCCAGAGGACCAGC---CAAAACCTCGCCTCGAGTCACACATAT
Tursiops_truncatus|5172             ---CCCCTG---TTTGTCCAAAGGACCAGC---CAAAACCTCGCCTCAAGTCCTACATAT
Canis_familiaris|27683              CAGCCTGAAGGGTTTGCCCAAAGGACCAGC---CAAAACATCACAAGTCCTCCA---CAT
Pteropus_vampyrus|12184             ---CCACTG---TTTGCCCAAAGGACTGGC---CAAAACCTCACCTCAGGTCATACGTAT
Tarsius_syrichta|13906              ---CCCCTG---TTTGCCCCAAGGACCAGC---CAAAACCTCACCTCAAGTCATACATAT
Microcebus_murinus|5590             ---NNNNNG---TTTACCCAAAGGACCAGC---CAAAACCTCGCCTCCAGTCATACATAT
Equus_caballus|4395                 ---TCCCTG---TTTGCTCAAAGGACCAGC---CAAAACCTCTCCTCAAGTCATGCATAT
Callithrix_jacchus|51275            ---CCCTTG---TTTCCCCAAAGGACCAGC---CAAAACCTCACCTCAAGCCACACGTAT
Rhesus_macaque|16910                ---CCCCTG---TTTTCCCAAAGGATCAGC---CAAAACCTCACCTCAAGTCACGCATAT
Homo_sapiens|35585                  ---CCCCCG---TTTGCCCAAAGGACCAGC---CAAAACCTCACCTCAAGCCACGCATAT
Pan_troglodytes|16522               ---CCCCCG---TTTGCCCAAAGGACCAGC---CAAAACCTCACCTCAAGCCACGCATAT
Gorilla_gorilla|19974               ---CCCCCG---TTTGCCCAAAGGAACAGC---CAAAACCTCATCTCAAGCCACGCAAAT
Pongo_abelii|11826                  ------------------------------------------------------------
Danio_rerio|21516                   ---GGACTG---GATGAGAGTCGAGACTCC---ACCTCCCTCGGCAGCTCGCCTCAGTTT
Tetraodon_nigroviridis|22877        ---GGAGGG---ATGGATGGCAGCCCAGCC---TCAACCTGCAGCTCTTCACCAAAGTTA
Fugu_rubripes|18278                 ---TCTCTC------------------------AAGGATGTCAGCCcagcctccacctgc
                                                                                                

Xenopus_tropicalis|13716            GACAATACTCCAGCAGAACCAACTCTCCTTCCGACAGTTCCTGCCCTCAGCCCGACT---
Tupaia_belangeri|4456               GAAAATTTTTCAGAACATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---
Ornithorhynchus_anatinus|12277      ------------------------------------------------------------
Felis_catus|46567                   NNNNNNTTTCCAGAATATTCAAATTCAGTACTACTACAGCCAGTTAATGTGCAGAAC---
Erinaceus_europaeus|13757           GAGAATTGTCCAGAACATTCAAATTCAATACTACTGCAGCCAGTTAATCTACAGGAT---
Monodelphis_domestica|9113          GGCAATCTCTTAACTCATTTAAATCCAATCCTGATGCCTCCAGTGAACCTGCAAGCT---
Macropus_eugenii|10709              NNNNNNTTTTTAACCCATTTAAATCCAATCCTGATGCAGCCAGTGAACCTTCAGGCT---
Anolis_carolinensis|12939           ------------------------------------------------------------
Gallus_gallus|7181                  AGCAATCTGGCAACTCTTTTAAGTCCAGTGCCTCTGAATCCAGTAAATCAGCAGGCT---
Taeniopygia_guttata|4202            ------------------------------------------------------------
Dasypus_novemcinctus|7205           CACAATTTTCCGGAATATTCAAATTCAGCATTTCTACAGCCAGTGAGTCTAGAGACC---
Myotis_lucifugus|7417               GAGAGTCTTCCAGTGTATCAAAATTCAGTGTTACTACAGCCGGAGAGTCTACACACC---
Procavia_capensis|8466              GACAATTTTCCAAAAGATTCATGTTCATTATTACTACAGCTGGTTAGTCCACAGAAC---
Choloepus_hoffmanni|5376            CACAATTTCCCAGAATATTCCAATTCAGTAGTACTACAGCCGGTTAGCCTAGGGACC---
Vicugna_pacos|1270                  NNNNNNATTCCGGAATATTCAAATTCAGTATTACTGCAGCCGGTTAGTCTCCAGAAC---
Sorex_araneus|3827                  GAGAATTTTCTAGGACATCCAAGTTCAGTATTACTACAGCCTGTTAGTCTACCGAAC---
Ochotona_princeps|5227              GATAATTTTACAGAATTTTCACCGCCAGTATTGCTACAGCCAGTCAGTCTACAGAAT---
Dipodomys_ordii|12963               GATAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAGACC---
Spermophilus_tridecemlineatus|12163 GATAATTTTCTAGAACACTCAAATCCAGTATTACTACAGCCAGTTAGCCTACAGACT---
Ochotona_princeps|12652             ------------------------------------------------------------
Oryctolagus_cuniculus|11447         GATAACTTTCCAGAACACTCAAACTCAGTATTGCTACAGCCAGTTAGTCTACCGACC---
Sus_scrofa|3743                     ------------------------------------------------------------
Echinops_telfairi|18178             GACAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGATCAGTCCACAGAGC---
Cavia_porcellus|18337               GCTAATTTGCCACAGCACTCAAGTTCAGTATTACTACAGCCGATCAGTCTGCAGACC---
Rattus_norvegicus|6711              GATAACTTTCCGGATCACTCCAGTTCAGTATTGCTACAGCCAGTTAGCCTACACACT---
Bos_taurus|9760                     GAGAGTTTTCTGGAACATTCAAATTCAGTATTACTGCAGCCAGTTAGCCTACAGACC---
Loxodonta_africana|14919            GACAATGTAAGT------AATGAAACCCTTCTCTGGCAGTGCACCTACTTGAAACAAAGC
Mus_musculus|7147                   GATAATTTT------CACTCCAATTCAGTATTACTCCAGCCAGTTAGCCTACACACCGCC
Tursiops_truncatus|5172             GAGAGTTTTCCGGAATATTCAAATTCAGTATTACTACAGCCAGTTACTCTAAAGACC---
Canis_familiaris|27683              GAAAATCTTTCAGAATATTCAAATTCAGTATTGCTACAACCAGTTAGTCTGCAGAAC---
Pteropus_vampyrus|12184             GCAAATTTTCCAGAAAATTCAAATTCAGTGTTACTACAGCCAGTCAGTCTACAGACC---
Tarsius_syrichta|13906              GATAATTTTCTAGAT---TCAAATTCAGCATTACTACAGCCAGTTAGTCTACAGACC---
Microcebus_murinus|5590             GATAATGTTCCAGAACATTCAAATTCCGGATTGCTCAAGGTCAGGAGTCTACAGTCC---
Equus_caballus|4395                 GAGAAT---GTGAAACATTCAAATTCAGTGTTACTACAGCCAGTTAGTCTACAGACC---
Callithrix_jacchus|51275            GATAACTTTCTGGAACATTCAAATTCAGTGTTTCTACAGCCGGTTAGTCTACAAACC---
Rhesus_macaque|16910                GATAAC---------------------------------CCGGTTAGTCTACAAACC---
Homo_sapiens|35585                  GATAATTTTCTGGAACATTCAAATTCAGTGTTTCTACAGCCAGTTAGTCTACAAACC---
Pan_troglodytes|16522               GATAATTTTCTGGAACATTCAAATTCAGTGTTTCTACAGCCGGTTAGTCTACAAACC---
Gorilla_gorilla|19974               GATAACTTTCTGGAACATTCAAATTCAGTGTTTCTACAGCCAGTTAGTCTACAAACC---
Pongo_abelii|11826                  ------------------------------------------------------------
Danio_rerio|21516                   CTTTGGATGATTGAAAAGGGAATGATTCCTGTCAATCAGAGTGAAGTGATGGATGAC---
Tetraodon_nigroviridis|22877        GATTGGATGATTAAAAAAGGAATGATTCCTATCAATCAGTCGAATGTAATGGATGAC---
Fugu_rubripes|18278                 agctcctcaccAAAGTTAGATTGGATGATGAAAAAAGGAATGATTCCTATCAGTCAC---
                                                                                                

Xenopus_tropicalis|13716            GTTCTTCTAATACCGAATAACCCAACATCCAAACAACTAGCAGAAAACAAATCA------
Tupaia_belangeri|4456               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------
Ornithorhynchus_anatinus|12277      ACCGCACGGGAGAGGACCGACGGCCCGCCTTCCCAGTTTCCGGGCCGACGTGAG------
Felis_catus|46567                   GTTCCAGCAACACCATCAAGCCAGAGACTGCCATCCTTGCCCGTCAGTCATCCA------
Erinaceus_europaeus|13757           ATTCCAGCAGCACCATTAAGCCAGAGACTGCCACCCTTGCCCAGCAATCATCCA------
Monodelphis_domestica|9113          GGCCATGCCGAACCTTCAAACCAGAGGCCCCCCGCTTTGTCCAGCAATCTTCGAGCTAGC
Macropus_eugenii|10709              GGCCATGCTGGACCATCAAGCCACAGGCCCCCAGCATCATCTAGCAATCAACCA------
Anolis_carolinensis|12939           ------------------------------------------------------------
Gallus_gallus|7181                  GGATATACTGCATCATCAAATGGACCATCACCAGCAGTCTGTATTTACCCTTCA------
Taeniopygia_guttata|4202            ------------------------------------------------------------
Dasypus_novemcinctus|7205           ATTCCAGCAACACCATCAGACCAGAGGCTGCCATCCTTGCCCAGCAATCATCCA------
Myotis_lucifugus|7417               GTTCCAGCCTCACCGTCAAACCAGACACTGCCAGCCTTGCCCGCCAACCACCCA------
Procavia_capensis|8466              ATCCCACCAACATCGTCACCCCAGAGATTGCCAGCCTTGCCCAGCAATCATCCA------
Choloepus_hoffmanni|5376            ATCTCAGCAACACCATCAGACCAGAGGCTGCCACCCTTGCCCAGCAATCATCCA------
Vicugna_pacos|1270                  ATCCCAGCAACACCATCAAACCAGACACTGCCCTCCTTGCCCAGCAATCATCCA------
Sorex_araneus|3827                  ATTCCAGCAACAACATCAAATGAGGTACCGCCACCCTTGCCCAGCAATCATCCA------
Ochotona_princeps|5227              GTCACAGCAACACATTCAACCCACAGGCCGCCGTCTTTGCCCATCAATCATCCA------
Dipodomys_ordii|12963               ATCACAGCAACACCATCAAACCAAAGGTCACCACCTCCCAGCAGTCGA------------
Spermophilus_tridecemlineatus|12163 GCCACAGTAACACCGTCAAACCAGACACCGCCCTCCTTGCCCAACAATCATCCA------
Ochotona_princeps|12652             ------------------------------------------------------------
Oryctolagus_cuniculus|11447         ATTGCAGCAACACCCTCAAACCAGAAGCTACCATCCTTGCCCAGCAATCATCCAGCTGAA
Sus_scrofa|3743                     ------------------------------------------------------------
Echinops_telfairi|18178             AGCCCAGCAACATCATCAAACCCGTACCTGCCGCCCTTGCCCAGCAATCATCCA------
Cavia_porcellus|18337               ---ACCACGACACCACCAAACCAGAGGCCACCATCTTTGCTTAATAATCATCCAGCTAAA
Rattus_norvegicus|6711              GCCCCGGCAGCGCCGTCGAGCCAGAGGCTGCCACCCTTGCCGAGCAATCATCCA------
Bos_taurus|9760                     GTTCCAGCAACACCATCAAACCAGAGACTGCCACCTCTGCCCAGCAATCATCCA------
Loxodonta_africana|14919            ATCCCAGCAACATCATCAAACCAGAGGCTGCCATCCTTGCCCGGCAATCATCCA------
Mus_musculus|7147                   ACAGCAGCAGCAGCAGCAAACCAGAGGCTGCCACCCTTGCCAAGCAGTCATCCA------
Tursiops_truncatus|5172             ATTCCAGCAACACCATCAAACCAGACACCACCATCCCTGCCCAGCAATCATCCA------
Canis_familiaris|27683              ATTTCGGCAACACCATCAAGCCAGAGACTGCCTTCCTTACCCAGCAATCATCCA------
Pteropus_vampyrus|12184             ATTGCAGCTACACCACCAAACCCGAGACCACCATCCTTGCCCAACAATCATCCA------
Tarsius_syrichta|13906              ATTGCAGCAGCAGCATCAAACCAGAGGCTGCCAACTTTNNNNNNNNNNNNNNNN------
Microcebus_murinus|5590             GTTGCAGCAGCACCATCAAACCAGAGGCTACCACCTTTGCCCAGCAATCATCCA------
Equus_caballus|4395                 ATTCCAGCAACACCATCAAACCAGACACTGCCGTCCTTGCCCGGCAATCACCCA------
Callithrix_jacchus|51275            ATTGCAGCAGCACCGTCAAACCAGAGTCTGCCATCTTTGCCCGGCAATCATCCA------
Rhesus_macaque|16910                ACTGCAGCGGCACCATCAAACCAGAGTCTGCCACCTTTGCCCAGCAATCATCCA------
Homo_sapiens|35585                  ATTGCAGCAGCACCATCAAACCAGAGTCTGCCACCTTTGCCCAGCAATCATCCA------
Pan_troglodytes|16522               ATTGCAGCAGCACCATCAAACCAGAGTCTGCCACCTTTGCCCAGCAATCATCCA------
Gorilla_gorilla|19974               ATTGCAGTAGCACCATCAAACCAGAGTCTGCCACCTTTGCCCAGCAATCATCCA------
Pongo_abelii|11826                  ------------------------------------------------------------
Danio_rerio|21516                   ---------------ATTGAACAGTGGCTGGATGATGTGGATGATGAGGATGACTCTGAG
Tetraodon_nigroviridis|22877        ------------------GTTGAGAAGTGGCTGGCTTTAGATGATGAGTATGAT------
Fugu_rubripes|18278                 TCCAGTGTAATGGATGATCTTGAGATATGGCTGGCTTTAGAAGATGAGTAT---------
                                                                                                

Xenopus_tropicalis|13716            GGTGCATCAGAGAACAATTCTTTGTTGCCAAACTACTATGAACTGTTAGAATTTGATCCA
Tupaia_belangeri|4456               NCGATGACAAAGAATGATCTCCAGCCACACAATTACTACGAAGTAATGGAGTTTGATCCC
Ornithorhynchus_anatinus|12277      ------------------------------------------------------------
Felis_catus|46567                   GCAATGGCAGAGAATGATCTCCAGCCACCCAATTACTACGAGGTAATGGAGTTTGATCCC
Erinaceus_europaeus|13757           GCTATGACAAAGAATGATCTCCAGGCACCCAATTACTATGAGGTAATGGAGTTTGATCCC
Monodelphis_domestica|9113          CCTGTAACAAAGAATGACCTTCCGCCACCCAATTACTATGAAGTAATGGAGTTTGATCCT
Macropus_eugenii|10709              GCTATAGCAGGGAATGATCTTCAGCCACCCCATTACTATGAGGTAATGGAGTTTGACCCT
Anolis_carolinensis|12939           ------------------------------------------------------------
Gallus_gallus|7181                  GCTGCATCGAAGAACAAGTTGCAGTCACCTCATTACTACGAGATAATGGAATTTGATCCT
Taeniopygia_guttata|4202            ------------------------------------------------------------
Dasypus_novemcinctus|7205           GCAATGACAAAGAATGATCTTCAGCCACCCAATTACTATGAAGTAATGGAGTTTGATCCC
Myotis_lucifugus|7417               GCGATGACAAAGAATGATCTCCAGCTACCCAATTACTACGAGGTAATGGAGTTTGATCCC
Procavia_capensis|8466              GTGATGACAAAGAATGATCTTCATGCACCAAATTACTACGAGGTAATGGAGTTTGATCCC
Choloepus_hoffmanni|5376            GCAATGAGCAAAAATGATCTTCAGCCACCCAATTACTACGAAATAATGGAGTTTGATCCC
Vicugna_pacos|1270                  GCGATGTCAAAGAACGATCTCCGGCCACCCAATTACTACGAGGTAATGGAATTTGATCCC
Sorex_araneus|3827                  GCAATGACTAAAAATGATCTTCAGCCACCCCACTACTACGAAGTCATGGAGTTTGATCCC
Ochotona_princeps|5227              GCAATGACGAAGAAAGACACCCAGACACCCAATTACTATGAGGTAATGGAGTTTGATCCC
Dipodomys_ordii|12963               GCAATGATAAACAATGATAGCCAGCCACCCAATTACTACGAGGTAATGGAATTTGATCCT
Spermophilus_tridecemlineatus|12163 GCAATGACAAAGAATGATCACCAGCCACCCAATTACTATGAGGTAATGGAGTTTGATCCC
Ochotona_princeps|12652             ------------------------------------------------------------
Oryctolagus_cuniculus|11447         GTGATGACAAAGAAAGATATCCAGACACCCAATTACTATGAGGTGATGGAGTTTGATCCC
Sus_scrofa|3743                     ------------------------------------------------------------
Echinops_telfairi|18178             GCAATGACAAAGAATGATCTTCAGCCACCCAATTACTATGAGCTCATGGAGTTTGATCCC
Cavia_porcellus|18337               GCGATGACAAAGAATGATCTCCAGGGACCCAATTACTACGAGGTAATGGAGTTTGATCCC
Rattus_norvegicus|6711              GTGTTAAAAAACAGTGCTCTCCAACCACCCAGTTACTACGAGGTAATGGAGTTTGATCCC
Bos_taurus|9760                     GCGATGACAAAGAACGATCTCCAGCCACCCAATTACTGTGAAGTAATGGAGTTTGATCCC
Loxodonta_africana|14919            GCGATGACAAAGAATGATCTTCAGCCATCCAATTACTACGAGGTAATGGAGTTTGATCCC
Mus_musculus|7147                   GTGCTAAAAGACGGCGATCTCCAGCCACCCAATTACTACGAGGTAATGGAGTTTGATCCC
Tursiops_truncatus|5172             GCGATGACAAAGAATGATTTCCAGCCACCCAATTACTACGAGGTAATGGAGTTTGATCCC
Canis_familiaris|27683              GCAATGACAAAGAATGATCTCCAGCCACCCAATTACTACGAGGTAATGGAGTTTGATCCC
Pteropus_vampyrus|12184             GCAATGACAAAGAATGATCTCCAGCCACCCAATTACTATGAGGTAATGGAGTTTGATCCC
Tarsius_syrichta|13906              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|5590             GGGATGACAAAGAATGATCTCCAGCCACCCAATTACTACGAGGTAATGGAGTTTGATCCC
Equus_caballus|4395                 GCGATGACAAAGAATGATCTCCAGCTACCCCATTACTACGAGGTAATGGAGTTTGATCCC
Callithrix_jacchus|51275            GCGATGACAAAGAGTGATCTCCAGCCACCTAATTACTATGAGGTAATGGAGTTTGATCCC
Rhesus_macaque|16910                GCGATGACAAAAAGTGATCTCCAGCCACCTAATTACTACGAGGTAATGGAGTTTGATCCC
Homo_sapiens|35585                  GCGATGACAAAAAGTGATCTCCAGCCACCTAATTACTACGAGGTAATGGAGTTTGATCCC
Pan_troglodytes|16522               GCGATGACAAAAAGTGATCTCCAGCCACCTAATTACTACGAGGTAATGGAGTTTGATCCC
Gorilla_gorilla|19974               GCGATGACAAAAAGTGATCTCCAGCCACCTAATTACTACGAGGTAATGGAGTTTGATCCC
Pongo_abelii|11826                  ------------------------------------------------------------
Danio_rerio|21516                   GGAGTGACTAGTGAA---------------------------------GAGTTTGACAAG
Tetraodon_nigroviridis|22877        ---------------------------------------GACTTAGAAGATTCAGATGGT
Fugu_rubripes|18278                 ---------------GACTTTGAGGATTCAGATGGTGTGACAACCGAAGAGTTTGACAGA
                                                                                                

Xenopus_tropicalis|13716            ---TTGGCTGAAAGTAATAGAACCGAAGTCATATATGAAGAAATTGATACTTCATTGTGG
Tupaia_belangeri|4456               ---TTAGCGCCTGCTGTCACTGAAGAAACTATTTATGAAGAAATTGATGCTCACCTC---
Ornithorhynchus_anatinus|12277      ------------------------------------------------------------
Felis_catus|46567                   ---TTGGCTCCTGTTGTCACTACAGAAGCTGTTTATGAAGAAATTGATGTTCATCAC---
Erinaceus_europaeus|13757           ---TTAGCTCCTGCTGCCACTACCGAAACTATTTATGAAGAAATTGATGCTCATCAT---
Monodelphis_domestica|9113          ---TTGGCTCCAGATGCCACTGCAGAAACTCTTTATGAAGAGCTTGATGCTAATCAC---
Macropus_eugenii|10709              ---TTGGCTCCAGGTGCCACTACAGAACCTCTTTATGAAGACATTGATGCTAAATTT---
Anolis_carolinensis|12939           ------------------------------------------------------------
Gallus_gallus|7181                  ---TTGGCTCCT---------ACAGAAGCGATTTATGAAGAAATTGATGCTGCTGTGCTG
Taeniopygia_guttata|4202            ------------------------------------------------------------
Dasypus_novemcinctus|7205           ---TTAGCTCCCAGTGTCACTGTGGAACCTATTTATGAAGAAATTGATGTTCATCTC---
Myotis_lucifugus|7417               ---TTAGCTCCTGCTGTCACGACAGAAGCTATTTATGAAGAAATTGATGTTCATCAC---
Procavia_capensis|8466              ---TTAGCTCCTACTGCCACAGCAGAAGTTATTTATGAAGATATTGATGTTAACCAC---
Choloepus_hoffmanni|5376            ---TTAGCTCCCACTGTTACCACAGAAGCTGTTTATGAAGAAATTGATGTTCATCAC---
Vicugna_pacos|1270                  ---TTAGCGCCTGCTGTCACTACAGAAGCTATTTATGAAGACATTGATGTCCATCAC---
Sorex_araneus|3827                  ---TTAGCTCCTGTTACCACTACAGAAACTATTTATGAAGAAATTGATGATCGTCAC---
Ochotona_princeps|5227              ---TTAGCTCCTGCTGTCACTACA------------------------------------
Dipodomys_ordii|12963               ---TTAGCTCCTGCTGTTACCACAGAAGCTATTTATGAAGAAATTGATCTTCATTGC---
Spermophilus_tridecemlineatus|12163 ---TTAGCTCCTGCTGTCACTACAGAAGCTATTTATGAAGAAATAGATGTTTATCCC---
Ochotona_princeps|12652             ------------------------------------------------------------
Oryctolagus_cuniculus|11447         ---TTAGCTCCAGCCGTCACTACAGAAGCTATATATGAAGAAATTGATGTTCAACAC---
Sus_scrofa|3743                     ------------------------------------------------------------
Echinops_telfairi|18178             ---TTAGCTCCTGCTGTCACTACTGAAGCTATTTATGAAGAAATTGATGTTCATCGC---
Cavia_porcellus|18337               ---TTAGCTCCTGCTGCCACCGCAGAGCCTGTTTATGAAGAAATTGATGTTCATCTC---
Rattus_norvegicus|6711              ---TTAGCTCCC------ACTACAGAAGCTATTTATGAAGAAATTGATGCTTCCCAC---
Bos_taurus|9760                     ---TTAGCTCCTGCTGTCACCACAGAAGCTGTTTATGAAGAGATTGATGTTCATCCC---
Loxodonta_africana|14919            ---TTAGCTCCTGATGTCACTGCAGAAACTGTTTATGAAGAAATTGATGTGAATCAC---
Mus_musculus|7147                   ---TTAGCTCCC------ACTACAGAAGCTGTTTATGAAGAAATTGATGGTTACCAC---
Tursiops_truncatus|5172             ---TTAGCTCCTGCTGTCACCACAGAAGCTATTTATGAAGACATTGATGTTCACCAC---
Canis_familiaris|27683              ---TTAGCTCCTGCTGTCACTACAGAAGCGGTTTATGAAGAAATTGATGTTCAACAC---
Pteropus_vampyrus|12184             ---TTAGCTCCTGCTGTCACTACAGAAGCTATTTATGAAGAAATTGATGCTCATCAC---
Tarsius_syrichta|13906              ---NNNNNNNNNNNNNNNNNNNNNNNAGCTATTTATGAAGAAATTGATGCTCAT------
Microcebus_murinus|5590             ---TTAGCTCCTGCTGTCACTGCAGAAGCTATTTATGAAGAAATTGATGTTCATCAC---
Equus_caballus|4395                 ---TTAGCTCCTGCTGTCACTGCAGAAGCTATTTATGAAGAAATTGATGGTCATCAC---
Callithrix_jacchus|51275            ---TTAGCTCCTGCTGTCACTACAGAAGCTATTTATGAAGAAATTGACGCTCACCAG---
Rhesus_macaque|16910                ---TTAGCTCCTGCTGTCACTACAGAAGCTATTTATGAAGAAATTGATGCTCACCAG---
Homo_sapiens|35585                  ---TTAGCTCCTGCTGTCACTACAGAAGCTATTTATGAAGAAATTGATGCTCACCAG---
Pan_troglodytes|16522               ---TTAGCTCCTGCTGTCACTACAGAAGCTATTTATGAAGAAATTGATGCTCACCAG---
Gorilla_gorilla|19974               ---TTAGCTCCTGCTGTCACTACAGAAGCTATTTATGAAGAAATTGATGCTCACCAG---
Pongo_abelii|11826                  ------------------------------------------------------------
Danio_rerio|21516                   TTCTTGGCAGAAAGGGCGAAAGCAGCCGAACGTCTTCCTTCAGTAAAAGCATCACAT---
Tetraodon_nigroviridis|22877        ---GTGACGAGCGAAGGTCTGCATCGGTTTTTGGCAGAAAGAGCAAGCACCAGGAGC---
Fugu_rubripes|18278                 TTTTTGGCAGAAAGAGCAAAAGCAGCTGAGCACCTGCCATCACTCAATTCCTCCTCA---
                                                                                                

Xenopus_tropicalis|13716            AGGAAAACTGCAAATAGTGGCGCTGAGTGT---TAG
Tupaia_belangeri|4456               AAA------GGAAATCAGCATAGTAGCTGT---TGA
Ornithorhynchus_anatinus|12277      ---------------------------------TGA
Felis_catus|46567                   CAGAAAGGAGCCCAAAGTCACAGTGAC---------
Erinaceus_europaeus|13757           TTTAAAGGACCTCAAAGTCATAAAGAATGT---TGA
Monodelphis_domestica|9113          CGTAAACCAATTCAGAATCATACAAATGGT---TAA
Macropus_eugenii|10709              CATAAACCAATTCAGAATCATACAAATGGT---TGA
Anolis_carolinensis|12939           ------------------------------------
Gallus_gallus|7181                  AAGCCAGAAGCTGAAAAGCATTCACAGTGC---TGA
Taeniopygia_guttata|4202            ---------------------------------TAA
Dasypus_novemcinctus|7205           GACAAAGGAACTCAAAATCATACTGGCTGT---TGA
Myotis_lucifugus|7417               CGCAAAGGCACTCAAAATCATAGTGACTGT---TAA
Procavia_capensis|8466              CACAGAACAGTTCAAAGTCCTACTGATTGT---TGA
Choloepus_hoffmanni|5376            CACAGAGGAACTCAAAATCATACTGATTGTGGA---
Vicugna_pacos|1270                  CATAAAGGAGCTCAAAGTCACAGTGACTGC---TGA
Sorex_araneus|3827                  TTAAAAGAAACCCAGTCACATACTGAACGT---TGA
Ochotona_princeps|5227              ------------------------------------
Dipodomys_ordii|12963               CACAAAGGAGCTAAAAGTCACAGAGATCGT---TGA
Spermophilus_tridecemlineatus|12163 CACAAAGGAGCTCGAAGTCATAGTGACTGT---TGA
Ochotona_princeps|12652             ------------------------------------
Oryctolagus_cuniculus|11447         CAGAAAGAAACACAAAGCCATGGTAGTTGT---TGA
Sus_scrofa|3743                     ------------------------------------
Echinops_telfairi|18178             CACAAAAGAGAGTCAAGTCATACTGACTGT---TGA
Cavia_porcellus|18337               TACAAAGGAGCTCAAAGTAATAGTGACTAC------
Rattus_norvegicus|6711              AAGAAAGGAGCTCAAAGCCATAGTGAATGC---TGA
Bos_taurus|9760                     CACAAAGGAGCTCAAAGTCACAGTAATTGT---TGA
Loxodonta_africana|14919            CTCAGAAGAGTTCAGAGTTATACTGACTGT---TGA
Mus_musculus|7147                   CAGAAAGAAGCTCAAAGTCATAGTGACTGC---TAA
Tursiops_truncatus|5172             CACAAAGGAGCTCAAAGTCACAGTGACCGT---TGA
Canis_familiaris|27683              CAGAAAGGAGCTCAAAGCCATTTGAGTCTG------
Pteropus_vampyrus|12184             CACAAAGGAGCTCAAAGTCAGAGTGACTGC---TGA
Tarsius_syrichta|13906              CACAAGGGCACTCAAAGTCACAGTGATTGT---TGA
Microcebus_murinus|5590             CACAAAGGAGCTCAAAGTCATAGTGACTGT---TGA
Equus_caballus|4395                 CAAAAAGGAGCTGAAAGTCATAGTGATTGT---TGA
Callithrix_jacchus|51275            CACAAAGGAGCTCAGAATCATGTTGAC------TGA
Rhesus_macaque|16910                CACAAAGGAACTGAAAATCATGGTGAC------TGA
Homo_sapiens|35585                  CACAAAGGAGCTCAAAATGATGGTGAC------TGA
Pan_troglodytes|16522               CACAAAGGAGCTCAAAATGATGGTGAC------TGA
Gorilla_gorilla|19974               CACAAAGGAGCTCAAAATGATGGTGAC------TGA
Pongo_abelii|11826                  ------------------------------------
Danio_rerio|21516                   CACGATTCCGGCCGTTCACAACTG---------TAG
Tetraodon_nigroviridis|22877        ACTGTTTCTGCAGACTCTCCTCGTAGCTGCGCA---
Fugu_rubripes|18278                 ------CAAGACAATGAACACATCAAGTCT---TAA
                                                                        

multiple sequence alignment in CLUSTALW format


Xenopus_tropicalis|1331             -----------------MAFGKSSKDPFSTPVGHLIDIHTASTLQNEDWGQFMNICDVIN
Tupaia_belangeri|3837               -----------------MAFAKGHRDPYATSVGHLIXXXXXXXXXXXXXXXXXXXXXXXX
Ornithorhynchus_anatinus|11217      ------------------------------------EKSTVGTTRSENWDRFLRICDLIN
Felis_catus|12683                   -----------------MAHGKSHRDIYATFVGHFIXXXXXXXXXXXXXXXXXXXXXXXX
Erinaceus_europaeus|11317           -----------------MAFGKNHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDIIN
Monodelphis_domestica|13454         -----------------MAFGKSHKDPFGTSMGHLIEKATFAGVQTEDWGQFMHICDMII
Macropus_eugenii|9745               -------------------------------------KATFAGVQTEDWGQFMHICDMII
Anolis_carolinensis|16837           -----------------MAFGKSQKDPFGTAVGHLIEKATFGGLQTEEWGQFMHICDIIN
Gallus_gallus|9605                  --------------------GKVPKDPFGTAVGSLVERATFGSLQTEEWGQFMHICDVIN
Taeniopygia_guttata|13228           ------------------------------------------------------------
Dasypus_novemcinctus|6353           -----------------MAFGKSHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDMIN
Myotis_lucifugus|6680               ------------------------------------------------------------
Procavia_capensis|7938              -------------------------------------KATFAGVQTEDWGQFMHICDIIN
Choloepus_hoffmanni|4753            -------------------------------------KATFAGAQTEDWGRFMHICDIIN
Vicugna_pacos|1183                  -------------------------------------KATFAGAQTEDWGQFMHICDIIN
Sorex_araneus|3395                  -------------------------------------KATFAGVQTEDWGQFMHICDIIN
Ochotona_princeps|4535              -----------------MAFGKSHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDIIN
Dipodomys_ordii|12188               -----------------MAFGKSHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDIIN
Spermophilus_tridecemlineatus|10902 -----------------MAFGKSHRGPYGTFVGQLIEKATFAGVQTEDWGQFMHICDIIN
Ochotona_princeps|11042             -----------------MAFGKSHRDPYTTSVGHLIEKATFAGVQTEDWGQFMHIYDIIN
Oryctolagus_cuniculus|507           -----------------MAFGKSHRDPYATSVGHLIEKATFAGLQTEDWGQFMHICDIIN
Sus_scrofa|18591                    -----------------MAFGKSHRDPYATSVGQLIEKATFAGVQTEDWGQFMHICDIIN
Echinops_telfairi|14324             -------------------------------------KATFAGVQTEDWGQFMHICDVIN
Cavia_porcellus|14404               -----------------MAFGKGHRDPYATSVGHLVEKATFAGAQTEDWGQFMHICDIIN
Rattus_norvegicus|18627             -----------------MAFGKSHRDPYATSLGHLIEKATFAGVQTEDWGQFMHICDIIN
Bos_taurus|9611                     -----------------MAFGRSHRDPYANSLGQLIEKATFAGVQTEDWGQFMHICDIIN
Loxodonta_africana|11292            -----------------MAFGKSHRDPYGTPLGHLIEKATFAGVQTEDWGQFMHICDIIN
Mus_musculus|4743                   -----------------MAFGKSHRDPYATSVGHLIEKATFAGVLTEDWGQFLHICDIIN
Tursiops_truncatus|4873             -----------------MAFGKSHRDPYATSVGQLIEKATFAGVQTEDWGQFMHICYIIN
Canis_familiaris|6517               -----------------MAFGRSHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDIIN
Pteropus_vampyrus|11482             -----------------MAFGKSHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDIIN
Tarsius_syrichta|12749              -----------------MAFGKSHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDMIN
Microcebus_murinus|4758             -------------------------------------KATFAGVQTEDWGQFMHICDIIN
Equus_caballus|11918                ------------------------------------------------------------
Callithrix_jacchus|42275            -----------------MAFGKSHRDPYATSVGHLIEKATFAGVQTEDWGQFMNICDIIN
Rhesus_macaque|23916                -----------------MAFGKSHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDIIN
Homo_sapiens|77708                  -----------------MAFGKSHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDIIN
Pan_troglodytes|24764               -----------------MAFGKSHRDAYATSVGHLIEKATFAGVQTEDWGQFMHICDIIN
Gorilla_gorilla|15823               -----------------MAFGKSHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDIIN
Pongo_abelii|23522                  -----------------MAFGKSHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDIIN
Danio_rerio|8425                    ------------------------------------------------------------
Tetraodon_nigroviridis|21341        SPMDLPVCFSSEVALSRFNMEFLLGNPFGTAVGQRIESATGSSLVSEDWALIMEICNMIN
Fugu_rubripes|16326                 -----------------MEF--LLGNPFGTPVGQRIESATSSSLVSEDWTLNMEICDLIN
                                                                                                

Xenopus_tropicalis|1331             TTADGPKDAVKAFRKRICRNYNQKEVKFSLLLLEMCMQNCVPTFHSLVLKKDFSKDVLVK
Tupaia_belangeri|3837               XXXXXPKDAVKALKKRISKNYNHKEIQLTLSLIDMCMQNCGPSFQSLIVKKEFVKDGLVK
Ornithorhynchus_anatinus|11217      TTQGGPRDAVRALKKRLSQNCNHKEIRLTLSLLDLCVRNCGPSFRALVVKKDFAKDKLTE
Felis_catus|12683                   XXXXXPKDAVKALKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDSLVK
Erinaceus_europaeus|11317           TAHDGPKDAVKALKKRIFKNYNHKEIQLTLSLIDMCMQNCGPSFQSLIVKKEFVKDSLAK
Monodelphis_domestica|13454         TSKDGSKEAVRAFKKRISKNCNHKEIQLTLSLLDMCMQNCGPTFHQTLSKLLFLKKKTKK
Macropus_eugenii|9745               TSKDGPKEAVRALKKRISKNCNHKEIQLTLSLIDMCMQNCGPSFQALIVKRDFTKDHLVK
Anolis_carolinensis|16837           STAQGPKDAIRALRKKLSKNCNHVEIRLTLSLLEMCMQNCGPHFKSLVVRREFCRDRLVK
Gallus_gallus|9605                  ATEEGPKDAVKALKKKLSKNCNHKEIRLTLSLLDMCMQNCGPRFQSLVVKKDFCKDKLVK
Taeniopygia_guttata|13228           -----PKDAVKALKKKLSKNCNHKEIRLTLSLLEMCMENCGPRFQSLVVKKDFCKDKLVK
Dasypus_novemcinctus|6353           TIPDGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Myotis_lucifugus|6680               -----PKDAVKALKKRISKNYNHKEIELTLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Procavia_capensis|7938              TAQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCMQNCGPRFQSLIVKKEFLKDGLVK
Choloepus_hoffmanni|4753            SAHDGPKDAVKALKKRISKNYNHKEIQLTLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Vicugna_pacos|1183                  TTQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCVENCGPSFQSLIVKKEFVKDSLVK
Sorex_araneus|3395                  TTGDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCMQNCGPRFQSLIVKKEFVKDSLVK
Ochotona_princeps|4535              TTQEGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCMQNCGPSFQSLIVKKDFIKDSLVK
Dipodomys_ordii|12188               ATQDGPKDAAKALKKRISRNYNHKEIQLTLSLIDMCMQNCGPNFQSLIVKKDFVKDSLXX
Spermophilus_tridecemlineatus|10902 TTQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCMQNCGPSFQSLIVKKEFIKDSLVK
Ochotona_princeps|11042             TTQEGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCMQNCGPSFQSLIVKKDLVKDSLVK
Oryctolagus_cuniculus|507           TTQEGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCMQNCGPSFQSLIVKKEFIKDSLVK
Sus_scrofa|18591                    TTQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCVQNCGPRFHSLIVKKEFVKDSLAK
Echinops_telfairi|14324             TSQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCMQNCGPSFQSLIAKKEFVKDCLVK
Cavia_porcellus|14404               TTQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCMQNCGPSFQALIVKKDFIKDSLVK
Rattus_norvegicus|18627             TTQDGPKDAVKALKKRISKNYNHKEIQLSLSLIDMCMQNCGPSFQSLIVKKEFVKDTLVK
Bos_taurus|9611                     TTQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCMQNCGPSFQSLIVKKEFVKDSLVK
Loxodonta_africana|11292            TVQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCVENCGPSFQSLIVKKEFLKDSLVK
Mus_musculus|4743                   TTQDGPKDAVKALKKRISKNYNHKEIQLSLSLIDMCVQNCGPSFQSLIVKKEFIKDTLVK
Tursiops_truncatus|4873             TAHDGPKDAVKALKKRISKNYNHKEIQLTLSLIDVCMQNCGPSFQSLIVKKEFVKDSLVK
Canis_familiaris|6517               TAHDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCMQNCGPSFQSLIVKKEFIKDSLVK
Pteropus_vampyrus|11482             TANDGPKDAVKALKKRISKNYNHKEIELTLSLIDMCMQNCGPSFQSLIVKKEFIKDSLVK
Tarsius_syrichta|12749              TAQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCVQNCGPSFQTLIVKKEFVKESLVK
Microcebus_murinus|4758             TTQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCMQNCGPSFQSLIVKKEFVKESLVK
Equus_caballus|11918                ------------------------------------------------------------
Callithrix_jacchus|42275            TTQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCVQNCGPSFQSLIVKKEFVKENLVK
Rhesus_macaque|23916                TTQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCVQNCGPSFQTLIVKKEFVKENLVK
Homo_sapiens|77708                  TTQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCVQNCGPSFQSLIVKKEFVKENLVK
Pan_troglodytes|24764               TTQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCVQNCGPSFQSLIVKKEFVKENLVK
Gorilla_gorilla|15823               TTQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCVQNCGPSFQSLIVKKEFVKENLVK
Pongo_abelii|23522                  TTQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCVQNCGPSFQSLIVKKEFVKENLVK
Danio_rerio|8425                    -----PKDAVRAIKKRILGNRNFKEVMLALSVLEACVKNCGHKFHVYVSTRDFVENVLVQ
Tetraodon_nigroviridis|21341        SSEEGPKDAVRAIKKRIVGNKNFKEVMLALTVLEACVKNCGYRFHILVTTRDFVEAVLVK
Fugu_rubripes|16326                 SSEEGPKDAVRAIKKRIVGNKNFKEVMLTLTVLETCVKNCGYKFHILVTARDFVETVLVR
                                                                                                

Xenopus_tropicalis|1331             MLNPKYNLPVSLQNKILFLIMTWSHDPKWKINATEIREVYLELIKRGIKFPSLQENGEML
Tupaia_belangeri|3837               LLNPRYTLPLDIQNRILNFIKTWSQGFPGGVDVSEVKEVYLDLLKKGVHFPPSDAEAETA
Ornithorhynchus_anatinus|11217      LLNPRYNLPTDIQNQILTFVMTWSQGFEGTVDVTQVKELYLDLLKKGIRFPSSNTAAGTD
Felis_catus|12683                   LLNPRYTLPLDIQNRILNFIKTWSQGFPGGVDVSEVKEVYLDLLKKGVQFPPSDAEAETA
Erinaceus_europaeus|11317           LLSPRYTLPLDIQNRILNLIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Monodelphis_domestica|13454         ---NKETFIYHIKEKK---SKTWSQGFPGGVDVSDIKEVYLELLKKGVQFPSSEREIEKE
Macropus_eugenii|9745               LLSPRYNLPLDIQNKILSFIMIWSRGFPGGVDVSEVKEVYLELLKKGVQFPSSEIEIGTE
Anolis_carolinensis|16837           LLNPRYNLPVDLQEKILTFIMTWARGFQGVVDVSEVKEVYLDLLKKGVEFPSSE------
Gallus_gallus|9605                  LLNPRYNLPIDLQEKILTFIMIWARGFQGMVDVTEVKEVYLELLKKGVEFPSSDTSKGRP
Taeniopygia_guttata|13228           LLNPRYNLPIDMQEKILTFIMVWARGFQGMVDVSEVKEVYLELLKKGVEFPSSDTSNEFS
Dasypus_novemcinctus|6353           XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Myotis_lucifugus|6680               XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Procavia_capensis|7938              LLNPRYTLPLDIQNKILNFIKIWSRGFPGGVDVSEVKEVYLDLLKKGVHFPSSDAEAETT
Choloepus_hoffmanni|4753            XXXXXXXXXLDIQNKILNFIKTWSQGFPGGVDVSEVKEVYLDLLKKGIQFPPSDAEGETA
Vicugna_pacos|1183                  LLNPRYTLPVDIQNRILNFIKTWSQGFPGGVDVSEVKEVYLDLLKKGVQFPPSDAEAEAA
Sorex_araneus|3395                  LLSPRYTLPLDFQNRILSFIKNWSQGFPGGVDVSEVKEVYLDLLKKGVQFPPSDAENET-
Ochotona_princeps|4535              LLNPRYNLPLDIQNRILNFIKTWSQGFPGGVDVTEVKEVYLDLLKKGVQFPCSEAEVQST
Dipodomys_ordii|12188               XXXXXXXXXXXXXXXXXXXXXTWSQGFPGGVEVTEVKEVYLDLLKKGVQFPPSDAEAET-
Spermophilus_tridecemlineatus|10902 LLDPKYTLPLDIQNRILNFIKV--PFYVESVDV--VSEVYLE----GQFSPDSEP---TA
Ochotona_princeps|11042             LLNPRYNLPLDIQNRILNFMKTWSQGFPGGVDVTEVKEVYLDLLKKGVQFPSSEAEAQST
Oryctolagus_cuniculus|507           LLNPRYNLPLDIQNRILNFIKTWSQGFPGGVDVTEVKEVYLDLLKKGVQFPPSDAEAQSA
Sus_scrofa|18591                    LLNPRYTLPVDIQNRILSFIKTWSQGFPGGVDVSEVKEVYLDLLKKGVQFPLSQAEAETA
Echinops_telfairi|14324             LLNPKYNLPLDTQNKILNFIKTWSQGFPGGVDVSEVKEVYLDLLKRGVQFPPSDAEAETT
Cavia_porcellus|14404               LLNPRFTLPLDIQNRILNFIKTWSQGFPGGVDVSEVKEVYLDLLKKGVQFPSSDANAEAT
Rattus_norvegicus|18627             LLNPRYTLPLETQNRILSFIKMWSQGFPGGVDVSEVKEVYLDLLKKGVQFPPLDGEPET-
Bos_taurus|9611                     LLNPRYTLPIDIQNRILNFIKTWSQGFPGGVDVSEVKDVYLDLLKKGVQFPSSDAETETA
Loxodonta_africana|11292            LLNPRYALPLDIQNKILSFIKTWSQGFPGGVDVSEVKEVYLDLLKKGVQFPSSDAEAET-
Mus_musculus|4743                   LLNPRYTLPLETQNRILNFIKTWSQGFPGGVDVSEVKEVYLDLLKKGVQFPPSDGEPET-
Tursiops_truncatus|4873             LLSPRYTLPIDIQNRILNFIKTWSQGFPGAVDVSEVKEVYLDLLKKGVQFPPSDAVAETA
Canis_familiaris|6517               LLNPRYTLPLDIQNRILNFIKTWSQGFPGGVDVSEVKEVYLDLLKKGVQFPTSEAEAETA
Pteropus_vampyrus|11482             LLNPRYTLPLDIQNRILNFIKTWSQGFPGGVDVSEVKEVYLDLLKKGVHFPPSDAEAETK
Tarsius_syrichta|12749              LLNPRYNLPLDVQ-RILIFITTWSQGFPGGVDVSEVKEVYLDLLKKGVQFLTTDAEAETA
Microcebus_murinus|4758             LLNPRYNLPLDIQNKILNFIKTWSQGFPGGVDVSEVKEVYLDLLKKGVQFPPSDAEAETS
Equus_caballus|11918                ------------------------------------------------------------
Callithrix_jacchus|42275            LLNPRYNLPLDIQNRILNFIKTWSQGFPGGVDVSEVKEVYLDLLKKGVQFPPSEVEAETA
Rhesus_macaque|23916                LLNPRYNLPLDIQNRILNFIKAWSQGFPGGVDVSEVKEVYLDLLKKGVQFPPSEAEAETA
Homo_sapiens|77708                  LLNPRYNLPLDIQNRILNFIKTWSQGFPGGVDVSEVKEVYLDLVKKGVQFPPSEAEAETA
Pan_troglodytes|24764               LLNPRYNLPLDIQNRILNFIKTWSQGFPGGVDVSEVKEVYLDLVKKGVQFPPSEAEAETA
Gorilla_gorilla|15823               LLNPRYNLPLDIQNRILNFIKTWSQGFPGGVDVSEVKEVYLDLVKKGVQFPPSEAEAETA
Pongo_abelii|23522                  LLNPRYNLPLDIQNRILNFIKTCSQGFPGGVDVSEVKEVYLDLVKKGVQFPPSEAEAETA
Danio_rerio|8425                    TILPKNNAPVVLQDRVLIMIQAWADAFRSSTDLTGVVTVYEDLRRRGVEFPMTELNGYSP
Tetraodon_nigroviridis|21341        SIIPRNSPPLVVHDRVLSIIQAWADAFRSSPDLTGVVSVYEDLRRKGLEFPMTELNGYPI
Fugu_rubripes|16326                 SIIPRNSPPLVVHDRVLSIIQAWADAFRSSPEMTGVVSVYEDLRRKGLEFPITELNGYPS
                                                                                                

Xenopus_tropicalis|1331             -------ETQESP-KQSIQSP--LSHH-----SKTDLH------N--LTPEQIGKLYSEM
Tupaia_belangeri|3837               QQEXX--XXXXXX-XXXXXXX--XXXXXXXX-XXXXXX------X--XXXXXIGKLLSEL
Ornithorhynchus_anatinus|11217      APERS-----AAA-AAPVPSA--PGAPPEAV-WKAPTV------L--LVPEQIGKLNSEL
Felis_catus|12683                   RQETA--HIS-NP-PSSVPSA--PVLPTVIV-PKSSTI------T--LVPEQIGKLHSEL
Erinaceus_europaeus|11317           XXXXX--XXXXXX-XXXXXXX--XXXXXXXX-XXXXXX------X--XXXXXIGKLHSEL
Monodelphis_domestica|13454         RQGGALSPSITNP-PPFVPSA--SIHSTATA-PKPPTI------L--LVAEQIGKLHSEV
Macropus_eugenii|9745               REVXX--XXXXXX-XXXXXXX--XXXXXXXX-XXXXXX------X--XXXXXIGKLHSEV
Anolis_carolinensis|16837           ------------------------------------------------------------
Gallus_gallus|9605                  KQSPS--PAKSSP-SSANPPK--RSLLPL---PTGPTL------L--LTPEQIGKLYSEL
Taeniopygia_guttata|13228           QELWA--ASPLHP-SSPSSAS--PAKRSLLPLPTGPTL------L--LAPEQIGKLYSEL
Dasypus_novemcinctus|6353           XXXXX--XXXXXX-XXXXXXX--XXXXXXXX-XXXXXX------X--XXXXXIGKLHSEL
Myotis_lucifugus|6680               XXXTA--QVSSNP-PTSVPTA--PALSSVIA-PKNATI------T--LVPEQXXXXXXXX
Procavia_capensis|7938              SSETV--QISSNP-PTCVPTA--PALSSIAA-PKNPTI------T--LVTEQIGKXXXXX
Choloepus_hoffmanni|4753            RKETA--HVS-NP-PTSVPTA--PALSSIIA-PKNSTI------T--LVPEQIGKLHSEL
Vicugna_pacos|1183                  REEXX--XXXXXX-XXXXXXX--XXXXXXXX-XXXXXX------X--XXXXXIGKLHSEL
Sorex_araneus|3395                  RQKTN--RISSAS-STSVPTA--PALPSVIV-PKNSMI------T--LVPEQIGKLHSEL
Ochotona_princeps|4535              RHETA--PVSSQP-STSVPTA--PALSPVNA-PKTTTI------T--LVPEQXXXXXXXX
Dipodomys_ordii|12188               RQETA--PISSHA-PTSVPTA--PALPSITA-TKNPTI------S--LVPEQIGKLHSEL
Spermophilus_tridecemlineatus|10902 RQES---QTSLTP-PASVPTA--PALSSVIP-PRNSTI------T--LVPEQIGKLHSEL
Ochotona_princeps|11042             RHETA--PVSSQP-STSVPTT--PALSPVNA-PKTTTT------T--LVPEQIGKLHSEL
Oryctolagus_cuniculus|507           RQETA--PVSSHP-SASVPTA--PALSPVIA-PRNTTI------T--LVPEQIGKLHSEL
Sus_scrofa|18591                    RQEIA--QISPNP-PPSVPTA--PALSCVV--PKNATI------T--LVPEQIGKLHSEL
Echinops_telfairi|14324             RPETA--PIPSNP-PTSVPTA--PALPSVVA-PKNSTI------T--LVAEQIGKLHSEL
Cavia_porcellus|14404               TQETP--RSLSSP-PTPVPTA--PALSPVIT-ARSTTI------T--LVPEQIGKLHSEL
Rattus_norvegicus|18627             KQEAG--QISPSR-PTSVPTA--PALSSIIA-PKNPTI------S--LVPEQIGKLHSEL
Bos_taurus|9611                     RQE-----MSLNP-PPSVPSA--PALPSIV--PKISTI------T--LVPEQIGKLHSEL
Loxodonta_africana|11292            RPQTT--QISSNP-PTSVPTA--PALSAIVA-PKNPTI------T--LVPEQIGKLHSEL
Mus_musculus|4743                   RQEAG--QISPNR-PTSVPTA--PALSSIIA-PKNPTI------S--LVPEQIGKLHSEL
Tursiops_truncatus|4873             RQETA--QISPNP-PPSVPTA--PALSSVV--SKSSTI------I--LVPEQIGKLRSEL
Canis_familiaris|6517               RQETT--EISSSP-STSVPTA--PALSSVIV-PKSSTL------T--LVPEQIGKLHSEL
Pteropus_vampyrus|11482             QQETA--QISSKP-PTSGPTA--PALSSVIV-PRSMTI------T--LVPEQIGKLLSEL
Tarsius_syrichta|12749              RQETA--QISSNP-PSSVPTA--PALSSVIA-PKNSTI------T--LVPEQIGKLHSEL
Microcebus_murinus|4758             GQETA--QISSNP-PTSVPTA--PALSPVAV-PKNSTI------T--LVPEQIGKLHSEL
Equus_caballus|11918                ------------------------------------------------------------
Callithrix_jacchus|42275            RQETA--QLSSNP-PTSVPTA--PALSSVIA-PKNSTI------T--LVPEQIGKLHSEL
Rhesus_macaque|23916                RQETA--QISSNP-PTSVPTA--PALSSVIA-PKNSTI------T--LVPEQIGKLHSEL
Homo_sapiens|77708                  RQETA--QISSNP-PTSVPTA--PALSSVIA-PKNSTV------T--LVPEQIGKLHSEL
Pan_troglodytes|24764               RQETA--QISSNP-PTSVPTA--PALSSVIA-PKNSTI------T--LVPEQIGKLHSEL
Gorilla_gorilla|15823               RQETA--QISSNP-PTSVPTA--PALSSVIA-PKNSTI------T--LVPEQIGKLHSEL
Pongo_abelii|23522                  RQETA--QISSNP-PTSVPTA--PALSSVIA-PKNSTI------T--LVPEQIGKLHSEL
Danio_rerio|8425                    IHTPK--RSVENVSPVKAHTESHPVTSSQPQNTETPVT---------LSPKQMKTIKAEL
Tetraodon_nigroviridis|21341        GQPAQKTLPANGPDRSSVPAALLSSKPCLIT-PYTSELKVALDGTNGLTPSQIKMLKAEL
Fugu_rubripes|16326                 QLT----QKTLAA-RTSVPAVLLSSKPSLIA-PQTSDLKLALDGTSALTPIQVKMLKTEL
                                                                                                

Xenopus_tropicalis|1331             DMVRMNVKVMSEILLETRLGAENPEDMDLLEELHKACLEMQRRILTLVETVQNEDVIIEL
Tupaia_belangeri|3837               DMVKMNVRVMSAILMENTPGSENHEDIELLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Ornithorhynchus_anatinus|11217      DVVRMNVAVMLAILTENTPGSEDRDDLELLQKLYRTGRQMHGRITELLATVENEDVVAEL
Felis_catus|12683                   DMAKMNVRVMSAILMENIPGSEDREDIELLQKLYKTCREMQERIMDLLVVVENEDVTIEL
Erinaceus_europaeus|11317           DMVKMNVRVMFAILMENIPGSENREDIELLQKLYKTCREMQERIMDLLVVVENEDLTVEL
Monodelphis_domestica|13454         DMVKMNVKVMSAILVENTPGSENQEDMELLQKLYKTGRDMQERIMDLLAVVENEDVTMEL
Macropus_eugenii|9745               DMVKMNVKVMSSILMENTPGSENQEDMELLEKLYKTGRDMQERIMDLLAVVENEDVTMEL
Anolis_carolinensis|16837           ------------------------------------------------------------
Gallus_gallus|9605                  DMAKMNVRVMSSILKENVPGSENPDDMNLLQKLYKTCRMMQERIMELLVTVENEDVIVEL
Taeniopygia_guttata|13228           DMAKMNVRVMSSILKENVPGSENPDDMNLLQKLYKTCRMMQERIMELLVTVENEDVIVEL
Dasypus_novemcinctus|6353           DMVKMNVRVMSTILMENTPSSENHEDIELLQKLYKTGREMQERIMDLLVVVENEDVTVEL
Myotis_lucifugus|6680               XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLYKTGREMQDRIMDLLVVVENEDVTIEL
Procavia_capensis|7938              XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLYKTSREMHERIMDLLVVVENEDVTVEL
Choloepus_hoffmanni|4753            DMVKMNVRMMSTILMENTPDSQNHEDIELLQKLYKTGREMQERIMDLLVVVENEDVTVEL
Vicugna_pacos|1183                  DMVKMNMRVMSAILMENIPGSENREDMELLQKLYKTGREMQERIMDLLVVVENEDVTVEL
Sorex_araneus|3395                  DMVKMNVRVMSAILMENVPGSENSEDIELLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Ochotona_princeps|4535              XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLYKTSREMQERIMDLLVVVENEDVTAEL
Dipodomys_ordii|12188               DMVKMNVRVMTAILLENTPGSENPDDIKLLQKLYKVGREMQERIMDLLVVVENEDLTVEL
Spermophilus_tridecemlineatus|10902 DMVKMNVRVMSAILMENTPGSENHEDLELLQKLYKTCREMQERIMDLLVVVENEDVTVEQ
Ochotona_princeps|11042             DMVKMNVSVMFEILLENNPGSENRKDIELLQ-----------------------------
Oryctolagus_cuniculus|507           DMVKMNVRVMFDILLENTPGSENQEDVELLQKLYKTSREMHKRIMDLLVVVENEDVTIEL
Sus_scrofa|18591                    DMVKMNVKVMSAILMENIPGSENREDIELLQVWYDFG-DNQSQCLKVIL-----------
Echinops_telfairi|14324             DMVKMILSVMFTILLEITPGSENQEDVQLLQELYKTCREMQERIMDLLAVVENEDVTVEL
Cavia_porcellus|14404               DMVKMNVRVMSAILMENTPGSENSDDLELLQKLYKTGREMQERIMDLLVVVENEDVTIEL
Rattus_norvegicus|18627             DMVKMNVKVMTAILMENTPGSENHEDIELLRKLYKTGREMQERIMDLLVVVENEDVTVEL
Bos_taurus|9611                     DMVKMNVRVMSAILMENIPGSENHEDIELLQKLYKTGREMQERIMDLLVVVENEDVTAEL
Loxodonta_africana|11292            DMVKMNVRVMSTILMENTPGSENHEDIELLQKLYKTSREMQERIMDLLVVVENEDVTIEL
Mus_musculus|4743                   DMVKMNVKVMTAILMENTPGSENHEDIELLRKLYKTGREMQERIMDLLVVVENEDVTMEL
Tursiops_truncatus|4873             DMVKMNVRVMSAILIENIPGSENHEDTELLQKLYKTGREMQERIMDLLVVVENEDVTVEL
Canis_familiaris|6517               DMVKMNVRVMSAILMENIPGSENREDIELLQKLYKTSREMQERIMDLLIVVENEDVTMEL
Pteropus_vampyrus|11482             DMVKMNVRVMSNILMENIPGSENHEDIELLQKLYKTGREMQERIMELLIVVENEDVTVEL
Tarsius_syrichta|12749              DMVKMNVRVMSAILMENTPESANHEDIELLEKLYKTGREMQERIMDLLVVVENEDVMVEL
Microcebus_murinus|4758             DMVKMNVRVMAAILMENTPGSENQEDIELLQKLYKTGREMQERIMDLLVVVENEDVTIEL
Equus_caballus|11918                ---------------------------------------MQERIMDLLVVVENEDVTVEL
Callithrix_jacchus|42275            DMVKMNVRVMSAILMENTPGSENHEDIELLQKLYKTGREIQERIMDLLVVVENEDVTVEL
Rhesus_macaque|23916                DMVKMNVRVMSAILMENTPGSENHEDIELLQKLYKTGREMQERIMDLLVVVENEDVTVEL
Homo_sapiens|77708                  DMVKMNVRVMSAILMENTPGSENHEDIELLQKLYKTGREMQERIMDLLVVVENEDVTVEL
Pan_troglodytes|24764               DMVKMNVRVMSAILMENTPGSENHEDIELLQKLYKTGREMQERIMDLLVVVENEDVTVEL
Gorilla_gorilla|15823               DMVKMNVRVMSAILMENTPGSENHEDIELLQKLYKTGREMQERIMDLLVVVENEDVTVEL
Pongo_abelii|23522                  DMVKMNVRVMSAILMENTPGSENHEDIELLQKLYKTGREMQERIMDLLVVVENEDVTVEL
Danio_rerio|8425                    EVVRNNLSVMSDMMNQMEPATFEPSDTELLQQLYSMTKDMQSRMVEVIPTLTDEKLTEQL
Tetraodon_nigroviridis|21341        GVVRNNLTMMSDMMSQLDPVTVKQANIELLQQLYTVCKEMQERIVKIVPRLSEEKLIEEL
Fugu_rubripes|16326                 GVVRSNLTMMSDMMSQLDPVTVKQADMELLQQLYTVCKEMQERIVKIVPRLSEEKLIEEL
                                                                                                

Xenopus_tropicalis|1331             VQVNDDLNNVFLRHERFSRAKANQSAEHRRQA---EIMTFDDNGPTAPLSELIDLNVPSG
Tupaia_belangeri|3837               XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXX-XXXXXXXXXXXXXX-XXX
Ornithorhynchus_anatinus|11217      IRVHENLSDAIVRCERFSQTRKDIREQTGPLI---ESITVS-RQPSAPSYELVSLR-PDP
Felis_catus|12683                   IQVNEDLNNAILGCEXXXXXXXXXXXXXXXXX---XXXXXX-XXXXXXXXXXXXXX-XXX
Erinaceus_europaeus|11317           IQVNENLNNAILGYERFVRNQQRILEENKNQN---GNIHXX-XXXXXXXXXXXXXX-XXX
Monodelphis_domestica|13454         IQVNEDLNHALLGYERFSRNQQRYQEQNQSLR---EAQKNN-CEPSAPSCDLLDLS-PSP
Macropus_eugenii|9745               IQVNEDLNQALLGYERFSRNQKRFQEQKQSQE---EAQRNN-CEPSAPSCDLLDLS-PGP
Anolis_carolinensis|16837           ------------------------------------------------------------
Gallus_gallus|9605                  IQVNEDLNNVLLGHERFSRNRVRFLENQRIQREREENVKLYRKQPSAPSSDLLDLS-TDS
Taeniopygia_guttata|13228           IQVNEDLNNVLLGHER--------------------------------------------
Dasypus_novemcinctus|6353           LQVNEDLNNALLGYERFTRNQQRILERNKNWE---EATSTS-SEPSAPSCDLLDLS-PSP
Myotis_lucifugus|6680               IQVNEDLNNAILGYERFTRNQQRILEQN-NQR---EDTNAA-TEPSAPSCDLLDLS-PST
Procavia_capensis|7938              IQVN-DLNNALLGCERFTRNQQRILEQNRNQE---EAAKAT-SEPSAPSCDLVDLS-PSP
Choloepus_hoffmanni|4753            LQVNEDLNNALLGYEXXXXXXXXXXXXXXXXX---XXXXTA-SEPSAPSCDLLDLS-PGP
Vicugna_pacos|1183                  IQVNEDLNNAILGCERFTRNQQRILEQNKNQR---EDANAT-SEPSAPSSDLLDLS-PSP
Sorex_araneus|3395                  XXXXXXXXXXXXXXXXFARNQQRILEQNTNQR---EETNTS-SEPSAPSCDLLDLS-PSP
Ochotona_princeps|4535              IQVNEDLNNAILGYERFTRNQQRILEQNNNWE---EATNPA-SEPSAPSCDLLDLS-PSP
Dipodomys_ordii|12188               IQVNEDLNNAILGYERFTRNQQRLLEQRGNQN---EATHTA-SEPSAPSCDLLDLS-PSS
Spermophilus_tridecemlineatus|10902 IQVNEDLNNAILXXXXFIRNQQRLLEQHTNQM---EATNTT-SEPSAPSCELLDLS-PST
Ochotona_princeps|11042             ------------------------------------------------------------
Oryctolagus_cuniculus|507           IQVNEDLNNAILGYERFTRNQQRILEQNRNQE---EATNAT-SEPSAPSCDLLDLS-PSP
Sus_scrofa|18591                    ------------------------------------------------------------
Echinops_telfairi|14324             IKVNEDLNNALLGYERFTRNQQRIVEQNENQ----EAANTA-SGPSAPSCDLLDLT-SSH
Cavia_porcellus|14404               IQVNEDLNEAILGYERFIRNQQRLLEQNKIQN---GTANTS-SEPSAPSSDLLDLS-PSP
Rattus_norvegicus|18627             IQVNEDLNNAILGYERFTRNQQRLLEQKRNPT---EANQTS-SEPSAPSCDLLNLG-PVA
Bos_taurus|9611                     IQVNEDLNNAILGCERFTRNQQRILEQNKSQR---EDANTT-SEPSAPSSDLLDLS-PSL
Loxodonta_africana|11292            IQVNEDLNNALLGYERFARNQQRVLEKNNNQE---EAANAT-SEPSAPSYDLLDLS-PSP
Mus_musculus|4743                   IQVNEDLNNAVLGYERFTRNQQRLLEQKRNRT---EATRTS-SEPSAPSCDLLDLS-PIV
Tursiops_truncatus|4873             IQVNEDLNNAILGYERFIRNQQRILEQNKNQR---EDANTT-SEPSAPSSDLLDLS-RSS
Canis_familiaris|6517               IQVNEDLNNALLGCERFTRNQQRILEQNRNQR---EDANTS-SEPSAPSCDLLDLR-PSP
Pteropus_vampyrus|11482             IQVNEDLNNAILGYERFTRNQQRILEEN-NQR---EDANTT-SEPSAPSYDLLDLS-PSP
Tarsius_syrichta|12749              IQVNEDLNNAILGYERFTRNQQRILEQNKNQQ---EATNTT-SEPSAPSHDLLDLS-PSP
Microcebus_murinus|4758             IQVNEDLNNAILGYEXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXXXCDLLDLS-PSP
Equus_caballus|11918                IQVNEDLNNAILGCERFTRNQQRILEQNKNQT---EDANIT-SEPSAPSCDLLDLS-PSP
Callithrix_jacchus|42275            IQVNEDLNNAILGCERFTRNQQRILEQNKNQK---EATNTT-SEPSAPSQDLLDLS-PSP
Rhesus_macaque|23916                IQVNEDLNNAILGYERFTRNQQRILEQN-NQK---EATSTT-SEPSAPSQDLLDLS-PSP
Homo_sapiens|77708                  IQVNEDLNNAILGYERFTRNQQRILEQNKNQK---EATNTT-SEPSAPSQDLLDLS-PSP
Pan_troglodytes|24764               IQVNEDLNNAILGYERFTRNQQRILEQNKNQK---EATNTT-SEPSAPSQDLLDLS-PSP
Gorilla_gorilla|15823               IQVNEDLNNAILGYERFTRNQQRILEQNKNQK---EATNTT-SEPSAPSQDLLDLS-PSP
Pongo_abelii|23522                  IQVNEDLNNAILGYER--------------------------------------------
Danio_rerio|8425                    LNANDDINTTFTQYHRFEKHLSRQSS----------------AQPNAPSTNLTDLDSPKQ
Tetraodon_nigroviridis|21341        LATNDEMNTAFNCYHRCSLKFKKQIMKNPER----EEKNHT-NADQTPRLKSVDDE-NSI
Fugu_rubripes|16326                 LTTNDEMNTA---FTRFHRFEKRITKNPDRAK---KNHASTFDTPRLESADHENFKYKSI
                                                                                                

Xenopus_tropicalis|1331             --PVHPVHSNGFLLPAPTMPMHP--WPTHTPHFPDKSGLENRVPFLYPQMDLQGLREAVD
Tupaia_belangeri|3837               --XXXXXXXXXXXXXXXXXXXXX--FRSPSPVVTN-----NVKPSLYPQMDLLASENTEV
Ornithorhynchus_anatinus|11217      --PVPE------------------------------------------------------
Felis_catus|12683                   --XXXXXXXXXXXXXXXXXXXXX--FRSPSPVVTN-----NLKPSLHPQVDLLAWEDTET
Erinaceus_europaeus|11317           --XXXXXXXXXXXXXXXXXXXXX--LSSPSHVVTN-----DLKPSIYPQEDLLALENTEV
Monodelphis_domestica|13454         SSLTSGLLLDGVHTMSSQFSDLN--VKSPTDSDGN-----HSNPVIYQELDLLASENPEI
Macropus_eugenii|9745               SSLTSGLPLEGVHAMSSQFSGLK--VSSSRSTDAI-----PSNPMVHSQLDLLASENPEI
Anolis_carolinensis|16837           ------------------------------------------------------------
Gallus_gallus|9605                  --PSPVAAVLGTDPAASQFPSPN--SMSAHPEDRK-----RLHPFIYPQLDLAAAAKAQQ
Taeniopygia_guttata|13228           ------------------------------------------------------------
Dasypus_novemcinctus|6353           --PTPQASLQEISAMNTQLSDLN--LSSPSPVVTN-----NLKPSLHLPVDLLASENTET
Myotis_lucifugus|6680               --PNHRATLEEVNAMNAQLSHLS--FSSPTPVIMN-----SLQPSPRPQMDLLALENTDT
Procavia_capensis|7938              --PTPRAPLGEVSAMNAQLSDLS--FRSSSRVVTN-----SVSHSQHPQMELLASGRTET
Choloepus_hoffmanni|4753            --PTPRATLRGISAMNAQLSDLX--XXXXXXXXXX-----XXXXXXXXXXXXXXXXXXXX
Vicugna_pacos|1183                  --RMHRASLGELNTLNAQLSDLN--FSSPSPVVTN-----SLKPSLHAQVDLLALENTET
Sorex_araneus|3395                  --PIPRAYLGDRNTANAQLSDLX--XXXXXXXXXX-----NMKPSLHTQEDLLALE-PGA
Ochotona_princeps|4535              --PMPRAPLGELNSVNAQLSDLS--LNFINPVATN-----NLKPSLPPEVNLPAFENTEI
Dipodomys_ordii|12188               --FVPAVTQGELSNMNAQFSNLS--FSAPNPVVTN-----NLSPSLYPQMDLLAXXXXXX
Spermophilus_tridecemlineatus|10902 --LMSMATQGELSNVNSQLSNLS--FSSPSPIVRN-----NLNPSLHSNVDLLASENTEM
Ochotona_princeps|11042             ------------------------------------------------------------
Oryctolagus_cuniculus|507           --PMPGAPLGELNTVNAQLSDLS--LNFVNPAVTN-----NLKPSFHPEVNLSAFENTEM
Sus_scrofa|18591                    ------------------------------------------------------------
Echinops_telfairi|14324             --PTPEGPRGELNTVNAQLSDLS--FRSPTPVLTN-----NMNPSRHPQVDLLASENTET
Cavia_porcellus|14404               --LMPPAPQGDFNSMNAQLSDLS--FSSPSPIVTN-----NSNSCVYPHVDLLALENTEV
Rattus_norvegicus|18627             --PVPVSSEGPLNSVNAQLSGLN--VSSQSPVITN-----NLYPSLQPQMDLLASEDTEV
Bos_taurus|9611                     --PTPRTTLGEVSTLNAQLSDLN--FSSLRPVVPN-----NFKPSLNTQVDLLALENTET
Loxodonta_africana|11292            --LTPRAALGELSTMNAQLSDLN--FKSPSSVMTD-----NVNPSCHPQLNFVASGNTET
Mus_musculus|4743                   --PVPTPNEGALNSVNAQLSGLS--VSSLSPVITN-----NLYPSLQPQRDLLASEDIEI
Tursiops_truncatus|4873             --LMHRATLGELSTLNAQLSDLN--FSSTSPVVTN-----NLKPSLHPQVDLLASENTET
Canis_familiaris|6517               --PMPRASLGELTTMNAQLSDLSNALSLFSLVFGH-----QKLVGMDTRRLLLYKINLSL
Pteropus_vampyrus|11482             --PNHRVTPGEDNTMNAQLSDLN--FSSSSPVVTN-----NLHPSLHSRLDLLALENTET
Tarsius_syrichta|12749              --PMPEASLGELNTMNAQLSDLD--FSSPSHEA-----------SLHPQMDLLALENTEI
Microcebus_murinus|4758             --PMPRATLGELSTRNAQLPDLX--XXXXXXXXXX-----XXXXXXXXXXXXXXXXXXXX
Equus_caballus|11918                --PKPRATLGELNSVNAQLSDLN--FTSSSPAVTN-----NVKPSLCPQMDLLALENTET
Callithrix_jacchus|42275            --RMSRATLGELNTMNDQLSDLN--FSSPSSGVTN-----NLKPSLHPQMDLLALENTEI
Rhesus_macaque|23916                --RMPRDTLGELNTMNNQLSDLN--FSSPSSDVTN-----NLKPSLHPQMDLLALENTEI
Homo_sapiens|77708                  --RMPRATLGELNTMNNQLSGLN--FSLPSSDVTN-----NLKPSLHPQMNLLALENTEI
Pan_troglodytes|24764               --RMPRATLGELNTMNNQLSGLN--FSLPSSDVTN-----NLKPSLHPQMNLLALENTEI
Gorilla_gorilla|15823               --RMPRATLGELNTMNNQLSGLN--FSLPSSDVTN-----NLKPSLHPQMNLLALENTEI
Pongo_abelii|23522                  ------------------------------------------------------------
Danio_rerio|8425                    LKAANGAHQSAVTTLSNQMSGLS--TKEDDLNFKS-----SSLLKSPERSAALATPGRDT
Tetraodon_nigroviridis|21341        YLSTADSLLSTMARLGKCFKGKN--LKQDQAHVGD------------PHADGQLGKERRE
Fugu_rubripes|16326                 -----------TDHLSSKMAKLA--TSESINSFWS-----FYRLQSNKILALLASLGKNM
                                                                                                

Xenopus_tropicalis|1331             -TR-FELGVQLPEVPPQNIYDNTPAEPTLLPTVPALSPT-VLLIPNNPTSKQLAENKS--
Tupaia_belangeri|3837               -PL-FAQRTS-QNLTSRQTYENFSEHXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXX--
Ornithorhynchus_anatinus|11217      ----------------------------------------TARERTDGPPSQFPGRRE--
Felis_catus|12683                   -PL-XXXXXX-XXXXXXXXXXXFPEYSNSVLLQPVNVQN-VPATPSSQRLPSLPVSHP--
Erinaceus_europaeus|11317           -PL-LTKRIS-ENLTLGHMYENCPEHSNSILLQPVNLQD-IPAAPLSQRLPPLPSNHP--
Monodelphis_domestica|13454         -SL-FPQRTD-------HLYGNLLTHLNPILMPPVNLQA-GHAEPSNQRPPALSSNLRAS
Macropus_eugenii|9745               -SL-XXXXXX-XXXXXXXXXXXFLTHLNPILMQPVNLQA-GHAGPSSHRPPASSSNQP--
Anolis_carolinensis|16837           ------------------------------------------------------------
Gallus_gallus|9605                  FPFAAEAQNNSVSTPAGHTYSNLATLLSPVPLNPVNQQA-GYTASSNGPSPAVCIYPS--
Taeniopygia_guttata|13228           ------------------------------------------------------------
Dasypus_novemcinctus|6353           -PL-FAQRTS-QNLASSHTNHNFPEYSNSAFLQPVSLET-IPATPSDQRLPSLPSNHP--
Myotis_lucifugus|6680               -AM-FAQRTS-QNPDSSHTYESLPVYQNSVLLQPESLHT-VPASPSNQTLPALPANHP--
Procavia_capensis|7938              -PL-FPQRTS-QNLASSHTYDNFPKDSCSLLLQLVSPQN-IPPTSSPQRLPALPSNHP--
Choloepus_hoffmanni|4753            -XX-FAQRTS-QNLASSHTYHNFPEYSNSVVLQPVSLGT-ISATPSDQRLPPLPSNHP--
Vicugna_pacos|1183                  -PL-XXXXXX-XXXXXXXXXXXIPEYSNSVLLQPVSLQN-IPATPSNQTLPSLPSNHP--
Sorex_araneus|3395                  -PL-FPQRTS-QNLAPGSAYENFLGHPSSVLLQPVSLPN-IPATTSNEVPPPLPSNHP--
Ochotona_princeps|4535              -PM-FAQRTN-QNLASSHTYDNFTEFSPPVLLQPVSLQN-VTATHSTHRPPSLPINHP--
Dipodomys_ordii|12188               -XX-FAQRTS-QNLTSSHTYDNXXXXXXXXXXXXXXXQT-ITATPSNQRSPPPSSR----
Spermophilus_tridecemlineatus|10902 -HL-FAQRTR-QNHDSSHTYDNFLEHSNPVLLQPVSLQT-ATVTPSNQTPPSLPNNHP--
Ochotona_princeps|11042             ------------------------------------------------------------
Oryctolagus_cuniculus|507           -PIKFAQRTR-QNLASSHTYDNFPEHSNSVLLQPVSLPT-IAATPSNQKLPSLPSNHPAE
Sus_scrofa|18591                    ------------------------------------------------------------
Echinops_telfairi|14324             -PL-FPQRTG-QNLASGHTYDNXXXXXXXXXXXXISPQS-SPATSSNPYLPPLPSNHP--
Cavia_porcellus|14404               -SV-FAQRTS-PNLTSSHTYANLPQHSSSVLLQPISLQT--TTTPPNQRPPSLLNNHPAK
Rattus_norvegicus|18627             -PTLFPQRTS-QNLASSHTYDNFPDHSSSVLLQPVSLHT-APAAPSSQRLPPLPSNHP--
Bos_taurus|9611                     -PL-FAQRTS-QNLASSHTYESFLEHSNSVLLQPVSLQT-VPATPSNQRLPPLPSNHP--
Loxodonta_africana|11292            -PL-LPQRTS-QNLASSHTYDNVS--NETLLWQCTYLKQSIPATSSNQRLPSLPGNHP--
Mus_musculus|4743                   -PTLFPQRTS-QNLASSHTYDNF--HSNSVLLQPVSLHTATAAAAANQRLPPLPSSHP--
Tursiops_truncatus|4873             -PL-FVQRTS-QNLASSPTYESFPEYSNSVLLQPVTLKT-IPATPSNQTPPSLPSNHP--
Canis_familiaris|6517               QPEGFAQRTS-QNITSPP-HENLSEYSNSVLLQPVSLQN-ISATPSSQRLPSLPSNHP--
Pteropus_vampyrus|11482             -PL-FAQRTG-QNLTSGHTYANFPENSNSVLLQPVSLQT-IAATPPNPRPPSLPNNHP--
Tarsius_syrichta|12749              -PL-FAPRTS-QNLTSSHTYDNFLD-SNSALLQPVSLQT-IAAAASNQRLPTXXXXXX--
Microcebus_murinus|4758             -XX-FTQRTS-QNLASSHTYDNVPEHSNSGLLKVRSLQS-VAAAPSNQRLPPLPSNHP--
Equus_caballus|11918                -SL-FAQRTS-QNLSSSHAYEN-VKHSNSVLLQPVSLQT-IPATPSNQTLPSLPGNHP--
Callithrix_jacchus|42275            -PL-FPQRTS-QNLTSSHTYDNFLEHSNSVFLQPVSLQT-IAAAPSNQSLPSLPGNHP--
Rhesus_macaque|23916                -PL-FSQRIS-QNLTSSHAYDN-----------PVSLQT-TAAAPSNQSLPPLPSNHP--
Homo_sapiens|77708                  -PP-FAQRTS-QNLTSSHAYDNFLEHSNSVFLQPVSLQT-IAAAPSNQSLPPLPSNHP--
Pan_troglodytes|24764               -PP-FAQRTS-QNLTSSHAYDNFLEHSNSVFLQPVSLQT-IAAAPSNQSLPPLPSNHP--
Gorilla_gorilla|15823               -PP-FAQRNS-QNLISSHANDNFLEHSNSVFLQPVSLQT-IAVAPSNQSLPPLPSNHP--
Pongo_abelii|23522                  ------------------------------------------------------------
Danio_rerio|8425                    -GL-DESRDS-TSLGSSPQFLWMIEKGMIPVNQSEVMDD------IEQWLDDVDDEDDSE
Tetraodon_nigroviridis|21341        -GG-MDGSPA-STCSSSPKLDWMIKKGMIPINQSNVMDD-------VEKWLALDDEYD--
Fugu_rubripes|16326                 -SL--------KDVSPASTCSSSPKLDWMMKKGMIPISH-SSVMDDLEIWLALEDEY---
                                                                                                

Xenopus_tropicalis|1331             GASENNSLLPNYYELLEFDP-LAESNRTEVIYEEIDTSLWRKTANSGAEC-
Tupaia_belangeri|3837               XMTKNDLQPHNYYEVMEFDP-LAPAVTEETIYEEIDAHL-K--GNQHSSC-
Ornithorhynchus_anatinus|11217      ---------------------------------------------------
Felis_catus|12683                   AMAENDLQPPNYYEVMEFDP-LAPVVTTEAVYEEIDVHH-QKGAQSHSD--
Erinaceus_europaeus|11317           AMTKNDLQAPNYYEVMEFDP-LAPAATTETIYEEIDAHH-FKGPQSHKEC-
Monodelphis_domestica|13454         PVTKNDLPPPNYYEVMEFDP-LAPDATAETLYEELDANH-RKPIQNHTNG-
Macropus_eugenii|9745               AIAGNDLQPPHYYEVMEFDP-LAPGATTEPLYEDIDAKF-HKPIQNHTNG-
Anolis_carolinensis|16837           ---------------------------------------------------
Gallus_gallus|9605                  AASKNKLQSPHYYEIMEFDP-LAP---TEAIYEEIDAAVLKPEAEKHSQC-
Taeniopygia_guttata|13228           ---------------------------------------------------
Dasypus_novemcinctus|6353           AMTKNDLQPPNYYEVMEFDP-LAPSVTVEPIYEEIDVHL-DKGTQNHTGC-
Myotis_lucifugus|6680               AMTKNDLQLPNYYEVMEFDP-LAPAVTTEAIYEEIDVHH-RKGTQNHSDC-
Procavia_capensis|7938              VMTKNDLHAPNYYEVMEFDP-LAPTATAEVIYEDIDVNH-HRTVQSPTDC-
Choloepus_hoffmanni|4753            AMSKNDLQPPNYYEIMEFDP-LAPTVTTEAVYEEIDVHH-HRGTQNHTDCG
Vicugna_pacos|1183                  AMSKNDLRPPNYYEVMEFDP-LAPAVTTEAIYEDIDVHH-HKGAQSHSDC-
Sorex_araneus|3395                  AMTKNDLQPPHYYEVMEFDP-LAPVTTTETIYEEIDDRH-LKETQSHTER-
Ochotona_princeps|4535              AMTKKDTQTPNYYEVMEFDP-LAPAVTT-----------------------
Dipodomys_ordii|12188               AMINNDSQPPNYYEVMEFDP-LAPAVTTEAIYEEIDLHC-HKGAKSHRDR-
Spermophilus_tridecemlineatus|10902 AMTKNDHQPPNYYEVMEFDP-LAPAVTTEAIYEEIDVYP-HKGARSHSDC-
Ochotona_princeps|11042             ---------------------------------------------------
Oryctolagus_cuniculus|507           VMTKKDIQTPNYYEVMEFDP-LAPAVTTEAIYEEIDVQH-QKETQSHGSC-
Sus_scrofa|18591                    ---------------------------------------------------
Echinops_telfairi|14324             AMTKNDLQPPNYYELMEFDP-LAPAVTTEAIYEEIDVHR-HKRESSHTDC-
Cavia_porcellus|14404               AMTKNDLQGPNYYEVMEFDP-LAPAATAEPVYEEIDVHL-YKGAQSNSDY-
Rattus_norvegicus|18627             VLKNSALQPPSYYEVMEFDP-LAP--TTEAIYEEIDASH-KKGAQSHSEC-
Bos_taurus|9611                     AMTKNDLQPPNYCEVMEFDP-LAPAVTTEAVYEEIDVHP-HKGAQSHSNC-
Loxodonta_africana|11292            AMTKNDLQPSNYYEVMEFDP-LAPDVTAETVYEEIDVNH-LRRVQSYTDC-
Mus_musculus|4743                   VLKDGDLQPPNYYEVMEFDP-LAP--TTEAVYEEIDGYH-QKEAQSHSDC-
Tursiops_truncatus|4873             AMTKNDFQPPNYYEVMEFDP-LAPAVTTEAIYEDIDVHH-HKGAQSHSDR-
Canis_familiaris|6517               AMTKNDLQPPNYYEVMEFDP-LAPAVTTEAVYEEIDVQH-QKGAQSHLSL-
Pteropus_vampyrus|11482             AMTKNDLQPPNYYEVMEFDP-LAPAVTTEAIYEEIDAHH-HKGAQSQSDC-
Tarsius_syrichta|12749              XXXXXXXXXXXXXXXXXXXX-XXXXXXXXAIYEEIDAH--HKGTQSHSDC-
Microcebus_murinus|4758             GMTKNDLQPPNYYEVMEFDP-LAPAVTAEAIYEEIDVHH-HKGAQSHSDC-
Equus_caballus|11918                AMTKNDLQLPHYYEVMEFDP-LAPAVTAEAIYEEIDGHH-QKGAESHSDC-
Callithrix_jacchus|42275            AMTKSDLQPPNYYEVMEFDP-LAPAVTTEAIYEEIDAHQ-HKGAQNHVD--
Rhesus_macaque|23916                AMTKSDLQPPNYYEVMEFDP-LAPAVTTEAIYEEIDAHQ-HKGTENHGD--
Homo_sapiens|77708                  AMTKSDLQPPNYYEVMEFDP-LAPAVTTEAIYEEIDAHQ-HKGAQNDGD--
Pan_troglodytes|24764               AMTKSDLQPPNYYEVMEFDP-LAPAVTTEAIYEEIDAHQ-HKGAQNDGD--
Gorilla_gorilla|15823               AMTKSDLQPPNYYEVMEFDP-LAPAVTTEAIYEEIDAHQ-HKGAQNDGD--
Pongo_abelii|23522                  ---------------------------------------------------
Danio_rerio|8425                    GVTSE-----------EFDKFLAERAKAAERLPSVKASH-HDSGRSQL---
Tetraodon_nigroviridis|21341        -------------DLEDSDG-VTSEGLHRFLAERASTRS-TVSADSPRSCA
Fugu_rubripes|16326                 -----DFEDSDGVTTEEFDRFLAERAKAAEHLPSLNSSS---QDNEHIKS-