Orthologs Set ID: EOG4006BW


Orthology Database
OrthoDB4
Gene Symbol(s)
PP2D1

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Bos taurus 1081 177, 1582
Branchiostoma floridae 6242 1582
Callithrix jacchus 11240 188, 1582, 2550
Canis familiaris 13176 1582
Cavia porcellus 486 188, 1582
Dasypus novemcinctus 15278 999, 1044, 1059, 1582, 2202
Equus caballus 9313 1586, 1705, 2087, 2398
Erinaceus europaeus 17421 207, 213, 453, 486, 1582, 2375, 2550
Felis catus 16327 1527, 1536, 1582, 2086, 2173
Gallus gallus 8502 1582, 2004, 2227
Gorilla gorilla 11587 188, 1582
Homo sapiens 61131 188, 1582
Loxodonta africana 16871 431, 801, 1582
Macropus eugenii 6140 218, 228, 406, 418, 436, 471, 477, 493, 506, 1269, 1295, 1324, 1499, 1521, 1545, 1557
Monodelphis domestica 32120 1582, 2176
Mus musculus 17846 188, 1582
Myotis lucifugus 11869
Nematostella vectensis 23553
Nematostella vectensis 8224 892
Ochotona princeps 11539 1582, 2401, 2403, 2553
Ornithorhynchus anatinus 18147 1582, 2012, 2286, 2560
Pan troglodytes 25778 1582
Pongo abelii 19964 188, 1582
Procavia capensis 10079 1582, 2017, 2046
Pteropus vampyrus 14421 1582
Rattus norvegicus 35105 188, 1582
Rhesus macaque 23840 188, 1582
Sorex araneus 2780 195, 231, 417, 441, 447, 495, 513, 1509, 1515, 1582, 2043, 2049, 2079, 2094
Spermophilus tridecemlineatus 12389 585, 1582, 2029, 2045
Tarsius syrichta 2954 1582
Tupaia belangeri 9125 1582
Vicugna pacos 1326 912, 936, 1582
Xenopus tropicalis 11325 479, 486

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Bos taurus 1081 ENSBTAT00000005303 532104 ENSBTAG00000004061 PP2D1 bosTau4
Branchiostoma floridae 6242 fgenesh2_pg.scaffold_322000032 braFlo1
Callithrix jacchus 11240 ENSCJAT00000007155 100413877 ENSCJAG00000003735 PP2D1 calJac3
Canis familiaris 13176 ENSCAFT00000009360 477053 ENSCAFG00000005813 PP2D1 canFam2
Cavia porcellus 486 ENSCPOT00000027651 100719570 ENSCPOG00000027100 PP2D1 cavPor3
Dasypus novemcinctus 15278 ENSDNOT00000023921 101426996 ENSDNOG00000025911 PP2D1 dasNov2
Equus caballus 9313 ENSECAT00000019749 102151087 ENSECAG00000018679 PP2D1 equCab2
Erinaceus europaeus 17421 ENSEEUT00000015685 ENSEEUG00000015680 PP2D1 eriEur1
Felis catus 16327 ENSFCAT00000004457 101080476 ENSFCAG00000004457 PP2D1 felCat3
Gallus gallus 8502 ENSGALT00000031172 ENSGALG00000019635 PP2D1 galGal3
Gorilla gorilla 11587 ENSGGOT00000012075 101145281 ENSGGOG00000012034 PP2D1 gorGor3
Homo sapiens 61131 ENST00000389050 151649 ENSG00000183977 PP2D1 hg19,GRCh37
Loxodonta africana 16871 ENSLAFT00000008322 ENSLAFG00000008322 PP2D1 loxAfr3
Macropus eugenii 6140 ENSMEUT00000006151 ENSMEUG00000006125 PP2D1 Meug_1.0
Monodelphis domestica 32120 ENSMODT00000018835 100031176 ENSMODG00000014795 PP2D1 monDom5
Mus musculus 17846 ENSMUST00000056198, NM_173449 110332 ENSMUSG00000044957 Pp2d1 mm9
Myotis lucifugus 11869 ENSMLUT00000011698 102434569 ENSMLUG00000011709 PP2D1 myoLuc1
Nematostella vectensis 8224 estExt_fgenesh1_pg.C_50231 Nemve1
Nematostella vectensis 23553 estExt_GenewiseH_1.C_1030118 Nemve1
Ochotona princeps 11539 ENSOPRT00000011276 101522132 ENSOPRG00000011286 PP2D1 OchPri2.0
Ornithorhynchus anatinus 18147 ENSOANT00000007912 ENSOANG00000004988 PP2D1 ornAna1
Pan troglodytes 25778 ENSPTRT00000027470 470767 ENSPTRG00000014683 PP2D1 panTro2
Pongo abelii 19964 ENSPPYT00000016365 100447898 ENSPPYG00000014073 PP2D1 ponAbe2
Procavia capensis 10079 ENSPCAT00000016750 ENSPCAG00000016782 PP2D1 proCap1
Pteropus vampyrus 14421 ENSPVAT00000006731 ENSPVAG00000006731 PP2D1 pteVam1
Rattus norvegicus 35105 ENSRNOT00000006325, NM_001134567 316157 ENSRNOG00000004719 Pp2d1 rn4
Rhesus macaque 23840 ENSMMUT00000009769 697964 ENSMMUG00000006993 PP2D1 rheMac2
Sorex araneus 2780 ENSSART00000002736 ENSSARG00000002723 PP2D1 sorAra1
Spermophilus tridecemlineatus 12389 ENSSTOT00000012390 101965677 ENSSTOG00000012388 PP2D1 speTri1
Tarsius syrichta 2954 ENSTSYT00000007621 103275062 ENSTSYG00000007660 PP2D1 tarSyr1
Tupaia belangeri 9125 ENSTBET00000009126 ENSTBEG00000009136 PP2D1 tupBel1
Vicugna pacos 1326 ENSVPAT00000002803 102527142 ENSVPAG00000002805 PP2D1 vicPac1
Xenopus tropicalis 11325 ENSXETT00000013604 ENSXETG00000026969 C3orf48 xenTro2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Bos taurus 22700 ENSBTAP00000005303 532104 ENSBTAG00000004061 PP2D1 bosTau4
Branchiostoma floridae 7042 fgenesh2_pg.scaffold_322000032 braFlo1
Callithrix jacchus 4062 ENSCJAP00000006776 100413877 ENSCJAG00000003735 PP2D1 calJac3
Canis familiaris 16285 ENSCAFP00000008687 477053 ENSCAFG00000005813 PP2D1 canFam2
Cavia porcellus 331 ENSCPOP00000014420 100719570 ENSCPOG00000027100 PP2D1 cavPor3
Dasypus novemcinctus 13505 ENSDNOP00000017156 101426996 ENSDNOG00000025911 PP2D1 dasNov2
Equus caballus 16255 ENSECAP00000016185 102151087 ENSECAG00000018679 PP2D1 equCab2
Erinaceus europaeus 14318 ENSEEUP00000014320 ENSEEUG00000015680 PP2D1 eriEur1
Felis catus 14904 ENSFCAP00000004113 101080476 ENSFCAG00000004457 PP2D1 felCat3
Gallus gallus 14005 ENSGALP00000030536 ENSGALG00000019635 PP2D1 galGal3
Gorilla gorilla 9628 ENSGGOP00000011735 101145281 ENSGGOG00000012034 PP2D1 gorGor3
Homo sapiens 47250 ENSP00000373702 151649 ENSG00000183977 PP2D1 hg19,GRCh37
Loxodonta africana 5101 ENSLAFP00000015854 ENSLAFG00000008322 PP2D1 loxAfr3
Macropus eugenii 5598 ENSMEUP00000005606 ENSMEUG00000006125 PP2D1 Meug_1.0
Monodelphis domestica 18464 ENSMODP00000018502 100031176 ENSMODG00000014795 PP2D1 monDom5
Mus musculus 20976 ENSMUSP00000056682 110332 ENSMUSG00000044957 Pp2d1 mm9
Myotis lucifugus 10667 ENSMLUP00000010655 102434569 ENSMLUG00000011709 PP2D1 myoLuc1
Nematostella vectensis 15853 estExt_GenewiseH_1.C_1030118 Nemve1
Nematostella vectensis 24168 estExt_fgenesh1_pg.C_50231 Nemve1
Ochotona princeps 10069 ENSOPRP00000010292 101522132 ENSOPRG00000011286 PP2D1 OchPri2.0
Ornithorhynchus anatinus 13337 ENSOANP00000007910 ENSOANG00000004988 PP2D1 ornAna1
Pan troglodytes 12648 ENSPTRP00000025329 470767 ENSPTRG00000014683 PP2D1 panTro2
Pongo abelii 3859 ENSPPYP00000015743 100447898 ENSPPYG00000014073 PP2D1 ponAbe2
Procavia capensis 9436 ENSPCAP00000015675 ENSPCAG00000016782 PP2D1 proCap1
Pteropus vampyrus 13583 ENSPVAP00000006354 ENSPVAG00000006731 PP2D1 pteVam1
Rattus norvegicus 20976 ENSRNOP00000006325 316157 ENSRNOG00000004719 Pp2d1 rn4
Rhesus macaque 10521 ENSMMUP00000009174 697964 ENSMMUG00000006993 PP2D1 rheMac2
Sorex araneus 2466 ENSSARP00000002476 ENSSARG00000002723 PP2D1 sorAra1
Spermophilus tridecemlineatus 11101 ENSSTOP00000011101 101965677 ENSSTOG00000012388 PP2D1 speTri1
Tarsius syrichta 2709 ENSTSYP00000006979 103275062 ENSTSYG00000007660 PP2D1 tarSyr1
Tupaia belangeri 7919 ENSTBEP00000007908 ENSTBEG00000009136 PP2D1 tupBel1
Vicugna pacos 1237 ENSVPAP00000002594 102527142 ENSVPAG00000002805 PP2D1 vicPac1
Xenopus tropicalis 8052 ENSXETP00000013604 ENSXETG00000026969 C3orf48 xenTro2

multiple sequence alignment in CLUSTALW format


Nematostella_vectensis|8224         ATGCTTCACAGTGAAAAAATCCAACTAGAGCCGGTAGCTATAGAGAAATGTGATGATGAA
Branchiostoma_floridae|6242         ------------------------------------------------------------
Nematostella_vectensis|23553        ------------------------------------------------------------
Xenopus_tropicalis|11325            ------------------------------------------------------------
Gallus_gallus|8502                  ------------------------------------------------------------
Monodelphis_domestica|32120         ------------------------------------------------------------
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          ------------------------------------------------------------
Ornithorhynchus_anatinus|18147      ------------------------------------------------------------
Erinaceus_europaeus|17421           ------------------------------------------------------------
Sorex_araneus|2780                  ------------------------------------------------------------
Mus_musculus|17846                  ------------------------------------------------------------
Rattus_norvegicus|35105             ------------------------------------------------------------
Cavia_porcellus|486                 ------------------------------------------------------------
Ochotona_princeps|11539             ------------------------------------------------------------
Bos_taurus|1081                     ------------------------------------------------------------
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             ------------------------------------------------------------
Loxodonta_africana|16871            ------------------------------------------------------------
Spermophilus_tridecemlineatus|12389 ------------------------------------------------------------
Tupaia_belangeri|9125               ------------------------------------------------------------
Vicugna_pacos|1326                  ------------------------------------------------------------
Pteropus_vampyrus|14421             ------------------------------------------------------------
Canis_familiaris|13176              ------------------------------------------------------------
Felis_catus|16327                   ------------------------------------------------------------
Equus_caballus|9313                 ------------------------------------------------------------
Tarsius_syrichta|2954               ------------------------------------------------------------
Callithrix_jacchus|11240            ------------------------------------------------------------
Rhesus_macaque|23840                ------------------------------------------------------------
Pongo_abelii|19964                  ------------------------------------------------------------
Pan_troglodytes|25778               ------------------------------------------------------------
Gorilla_gorilla|11587               ------------------------------------------------------------
Homo_sapiens|61131                  ------------------------------------------------------------
                                                                                                

Nematostella_vectensis|8224         GATGAAGGTCATAGCCTCTTAGACCAGTCACGACCGAAGAGCGAGCGCTTGGATGACTAC
Branchiostoma_floridae|6242         ------------------------------------------------------------
Nematostella_vectensis|23553        ------------------------------------------------------------
Xenopus_tropicalis|11325            ------------------------------------------------------------
Gallus_gallus|8502                  ------------------------------------------------------------
Monodelphis_domestica|32120         ------------------------------------------------------------
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          ------------------------------------------------------------
Ornithorhynchus_anatinus|18147      ------------------------------------------------------------
Erinaceus_europaeus|17421           ------------------------------------------------------------
Sorex_araneus|2780                  ------------------------------------------------------------
Mus_musculus|17846                  ------------------------------------------------------------
Rattus_norvegicus|35105             ------------------------------------------------------------
Cavia_porcellus|486                 ------------------------------------------------------------
Ochotona_princeps|11539             ------------------------------------------------------------
Bos_taurus|1081                     ------------------------------------------------------------
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             ------------------------------------------------------------
Loxodonta_africana|16871            ------------------------------------------------------------
Spermophilus_tridecemlineatus|12389 ------------------------------------------------------------
Tupaia_belangeri|9125               ------------------------------------------------------------
Vicugna_pacos|1326                  ------------------------------------------------------------
Pteropus_vampyrus|14421             ------------------------------------------------------------
Canis_familiaris|13176              ------------------------------------------------------------
Felis_catus|16327                   ------------------------------------------------------------
Equus_caballus|9313                 ------------------------------------------------------------
Tarsius_syrichta|2954               ------------------------------------------------------------
Callithrix_jacchus|11240            ------------------------------------------------------------
Rhesus_macaque|23840                ------------------------------------------------------------
Pongo_abelii|19964                  ------------------------------------------------------------
Pan_troglodytes|25778               ------------------------------------------------------------
Gorilla_gorilla|11587               ------------------------------------------------------------
Homo_sapiens|61131                  ------------------------------------------------------------
                                                                                                

Nematostella_vectensis|8224         GTGTTGGTTAAAATGAACCAGATCAGGAAAACTAGCGGCTTCGCGTATGGATTTCTCAAA
Branchiostoma_floridae|6242         ---------------------------------------------ATGATAAAGCCACAG
Nematostella_vectensis|23553        ------------------------------------------ATGCACGCAGTTACAGTC
Xenopus_tropicalis|11325            ---------------------------------------------CGAAAAAATCGCAAC
Gallus_gallus|8502                  ------------------------------------------------------------
Monodelphis_domestica|32120         ------------------------------------------------------------
Macropus_eugenii|6140               ---------------------------------------------AATATCTCTCCCCCT
Dasypus_novemcinctus|15278          ---------------------------------------------AATATCTTTCATCCT
Ornithorhynchus_anatinus|18147      ------------------------------------------------------------
Erinaceus_europaeus|17421           ---------------------------------------------GACATCTTCCATCCT
Sorex_araneus|2780                  ---------------------------------------------AATAACTTTTGTCTT
Mus_musculus|17846                  ------------------------------------ATGAATTGGGAACTGTATTCTTCT
Rattus_norvegicus|35105             ---------------------------------------ATGGATTTTGAAATATATAGC
Cavia_porcellus|486                 ---------------------------------------------ATGAACGTGTCGAGT
Ochotona_princeps|11539             ---------------------------------------------TTTTTTTTTTATCCT
Bos_taurus|1081                     ------------------------------AAAAATTGGTTGGTGAGGCAAAGCCAGCCT
Myotis_lucifugus|11869              ---------------------------------------------AATATCTTTCCTCCT
Procavia_capensis|10079             ---------------------------------------------ACTATCTTTCATCCT
Loxodonta_africana|16871            ---------------------------------------CATGTAAATATCTTTCATCCT
Spermophilus_tridecemlineatus|12389 ------------------------------------------------------------
Tupaia_belangeri|9125               ---------------------------------------------AATATCTTTCTTCCC
Vicugna_pacos|1326                  ------------------------------------------------------------
Pteropus_vampyrus|14421             ---------------------------------------------AATACCTTTCATCCT
Canis_familiaris|13176              ------------------------------------TGGCATGTAAATATCGTTTATCCT
Felis_catus|16327                   ---------------------------------------------AATATCTTTTATCCT
Equus_caballus|9313                 ------------------------------------------------------------
Tarsius_syrichta|2954               ------------------------------------------------------------
Callithrix_jacchus|11240            ---------------------------------------------ATGAGCATCAGTAAT
Rhesus_macaque|23840                ---------------------------------------------ATGAGCGCCAATAAT
Pongo_abelii|19964                  ---------------------------------------------ATGAGCACCAATAAT
Pan_troglodytes|25778               ---------------------------------------------AATATCTTTCATCCT
Gorilla_gorilla|11587               ---------------------------------------------ATAAGCACCAATAAT
Homo_sapiens|61131                  ---------------------------------------------ATGAGCACCAATAAT
                                                                                                

Nematostella_vectensis|8224         TCCCACGGCGATTTTGCACGCTCAAAAACCTCAGCACGTCATACAACAGCTAGTAGGACA
Branchiostoma_floridae|6242         CTGGTCCAC------------------------AGCGACTCTGAACAGAGTTCAAACTCT
Nematostella_vectensis|23553        GCGCTGCGCGAGCAGTCGTCGTCTTCGGGTTTGGAAGAAACTTCTTCCTCCGCTAATAAC
Xenopus_tropicalis|11325            ATTTTGCGCAACTTTTGGAATGGCTAC---------------------------------
Gallus_gallus|8502                  ------------------------------------------------------------
Monodelphis_domestica|32120         ------------------------------------------------------------
Macropus_eugenii|6140               GTTTGCAGAATGCTATGGAGGTCTAAGGTATCGAATATGAAGATGACAACATCTGAAAAT
Dasypus_novemcinctus|15278          GTTTGCAGAGTATTTTGGAAATCAAGAAATTGGCATGCGAGTAAATCC------AATGCA
Ornithorhynchus_anatinus|18147      ------------------------------------------------------------
Erinaceus_europaeus|17421           GTTTGCAGGGTGTATATGAGAGCAAGAACACTT---------------------------
Sorex_araneus|2780                  ATTTTCAGAGTGCTT---AATGCAAGGCAATGGTTTAAGAACTCAAGACAGTTTGAATCA
Mus_musculus|17846                  CCTTTAAGAGTGTTTTGGAGATCAAAAGTGTGGGATGAGAAAACTTCAACATTTACTTCT
Rattus_norvegicus|35105             CCTGTAAGAGTTTTTTTGAAATCAAAACAATGGGATGAGAAAACTTCAAAATTTACTTCA
Cavia_porcellus|486                 GCGTTAAGAGTGTTTGGGAAGTCAAGAGAATGGGACAGGAAGAAATCAACCTTTGATTCA
Ochotona_princeps|11539             CTTTGCAGAGTGTTTTGGAAACAAAGGAAGTGGAATTTAAGGAAATCAATATTTGATTCA
Bos_taurus|1081                     GTTCACAGAGTGTTTTGGAAAGCAAGGCAGTTGTACACGAGAAAACCAACAGCTGATTCA
Myotis_lucifugus|11869              GCTTGCAGAATATTTTGGAGAGTGATGAAATGGAATATGAAAAAA------TATGATTCA
Procavia_capensis|10079             CTCTGTAGAGTGTTTTGGAAATCAAGAGAATGGAGAAGGAAAGCATCAACATATGAGTTC
Loxodonta_africana|16871            CTTTGTAGAGTGTTCTGGAAATCAAGAGAATGGAAAATGAGAATATCAACATTTGATTCA
Spermophilus_tridecemlineatus|12389 ------------------------------------------------------------
Tupaia_belangeri|9125               ATTGGCAGGGTGTTTTGGAAATCAAAGAAATGGAATATGAGAACATCGACACTTAATTCA
Vicugna_pacos|1326                  ------------------------------------------------------------
Pteropus_vampyrus|14421             GTTTGCAGAGTGTTTTGGAAATCGAGAGATTGGAATGAGAGAAAATCGACATTTGATTCA
Canis_familiaris|13176              GTTTGCAGAGTGTTTTGGAAATCAAGGGAATGGAATGTGAGAAAATCAACACATGATTCA
Felis_catus|16327                   GTTTGCAGAGTGTTTTGGAAATCAAGGGAATGGAATGTGAGAAAGTCGACATTTAATTCA
Equus_caballus|9313                 ------------------------------------------------------------
Tarsius_syrichta|2954               ------------------------------------------------------------
Callithrix_jacchus|11240            GCTTTAAGAGTGTTTTGGAAATCAAGAGAATGGAATACGAGAACATCAACATTTGATACA
Rhesus_macaque|23840                GCTTTAAGGGTGTTTTGGAAATCAAGAGAATGGAATATGAAAACATCAACATTTGATTCA
Pongo_abelii|19964                  GCTTTAAGAGTGTTTTGGAAATCAAGAGAATGGAATATGAAAACATCAGCATTTGATTCA
Pan_troglodytes|25778               GTTTGCAGAGTGTTTTGGAAATCAAGAGAATGGAATATGAAAACATCAACATTTGATCCA
Gorilla_gorilla|11587               GCTTTAAGAGTGTTTTGGAAATCAAGAGAATGGAATATGAAAACATCAACATTTGATTCA
Homo_sapiens|61131                  GCTTTAAGAGTGTTTTGGAAATCAAGAGAATGGAATATGAAAACATCAACATTTGATTCA
                                                                                                

Nematostella_vectensis|8224         GTCAACCCTGTGGAGGATAAGAGCAAAATGGCTAAACAAGACACAGTGTCGGACAAATTC
Branchiostoma_floridae|6242         ------------------------------------------------------------
Nematostella_vectensis|23553        ------------------------------------------------------------
Xenopus_tropicalis|11325            ------------------------------------------------------------
Gallus_gallus|8502                  ------------------------------------------------------------
Monodelphis_domestica|32120         ------------------------------------------------------------
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          ------------------------------------------------------------
Ornithorhynchus_anatinus|18147      ------------------------------------------------------------
Erinaceus_europaeus|17421           ------------------------------------------------------------
Sorex_araneus|2780                  ------------------------------------------------------------
Mus_musculus|17846                  ------------------------------------------------------------
Rattus_norvegicus|35105             ------------------------------------------------------------
Cavia_porcellus|486                 ------------------------------------------------------------
Ochotona_princeps|11539             ------------------------------------------------------------
Bos_taurus|1081                     ------------------------------------------------------------
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             ------------------------------------------------------------
Loxodonta_africana|16871            ------------------------------------------------------------
Spermophilus_tridecemlineatus|12389 ------------------------------------------------------------
Tupaia_belangeri|9125               ------------------------------------------------------------
Vicugna_pacos|1326                  ------------------------------------------------------------
Pteropus_vampyrus|14421             ------------------------------------------------------------
Canis_familiaris|13176              ------------------------------------------------------------
Felis_catus|16327                   ------------------------------------------------------------
Equus_caballus|9313                 ------------------------------------------------------------
Tarsius_syrichta|2954               ------------------------------------------------------------
Callithrix_jacchus|11240            ------------------------------------------------------------
Rhesus_macaque|23840                ------------------------------------------------------------
Pongo_abelii|19964                  ------------------------------------------------------------
Pan_troglodytes|25778               ------------------------------------------------------------
Gorilla_gorilla|11587               ------------------------------------------------------------
Homo_sapiens|61131                  ------------------------------------------------------------
                                                                                                

Nematostella_vectensis|8224         GCCTCTGTGACCGTCAACCTTATATCTGAGGTTGCATCGGAACGCAAAGACGTCGAAGAA
Branchiostoma_floridae|6242         ------------------------------------------------------------
Nematostella_vectensis|23553        ------------------------------------------------------------
Xenopus_tropicalis|11325            ------------------------------------------------------------
Gallus_gallus|8502                  ------------------------------------------------------------
Monodelphis_domestica|32120         ------------------------------------------------------------
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          ------------------------------------------------------------
Ornithorhynchus_anatinus|18147      ------------------------------------------------------------
Erinaceus_europaeus|17421           ------------------------------------------------------------
Sorex_araneus|2780                  ------------------------------------------------------------
Mus_musculus|17846                  ------------------------------------------------------------
Rattus_norvegicus|35105             ------------------------------------------------------------
Cavia_porcellus|486                 ------------------------------------------------------------
Ochotona_princeps|11539             ------------------------------------------------------------
Bos_taurus|1081                     ------------------------------------------------------------
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             ------------------------------------------------------------
Loxodonta_africana|16871            ------------------------------------------------------------
Spermophilus_tridecemlineatus|12389 ------------------------------------------------------------
Tupaia_belangeri|9125               ------------------------------------------------------------
Vicugna_pacos|1326                  ------------------------------------------------------------
Pteropus_vampyrus|14421             ------------------------------------------------------------
Canis_familiaris|13176              ------------------------------------------------------------
Felis_catus|16327                   ------------------------------------------------------------
Equus_caballus|9313                 ------------------------------------------------------------
Tarsius_syrichta|2954               ------------------------------------------------------------
Callithrix_jacchus|11240            ------------------------------------------------------------
Rhesus_macaque|23840                ------------------------------------------------------------
Pongo_abelii|19964                  ------------------------------------------------------------
Pan_troglodytes|25778               ------------------------------------------------------------
Gorilla_gorilla|11587               ------------------------------------------------------------
Homo_sapiens|61131                  ------------------------------------------------------------
                                                                                                

Nematostella_vectensis|8224         GACGAACGCAAAGCGCACGGGAGACTAGACTTGGGGCTGATAGATGAGACGGCTGACAGT
Branchiostoma_floridae|6242         ------------------------------------------GATCAAGAGGAGCTCCAG
Nematostella_vectensis|23553        ------------------------------------------AGCCCAGAGAAAAGTTTG
Xenopus_tropicalis|11325            ------------------------------------------GAAAAAGGCGCGACAATT
Gallus_gallus|8502                  ------------------------------------------------------------
Monodelphis_domestica|32120         ------------------------------------------------------------
Macropus_eugenii|6140               ------------------------------------------TCAGACGAAGAGAATCTA
Dasypus_novemcinctus|15278          ------------------------------------------GCCAGAGGAATCCCATCT
Ornithorhynchus_anatinus|18147      ------------------------------------------------------------
Erinaceus_europaeus|17421           ------------------------------------------GAGGAGGAAATACCAACC
Sorex_araneus|2780                  ------------------------------------------GACGATGAAACTCTATTG
Mus_musculus|17846                  ------------------------------------------GATGAGAATCTCAAGATT
Rattus_norvegicus|35105             ------------------------------------------GATGAGGCTCTCCCAACT
Cavia_porcellus|486                 ------------------------------------------GACGAAGATATTTCACCT
Ochotona_princeps|11539             ------------------------------------------------GATGTGAATCTT
Bos_taurus|1081                     ------------------------------------------GAGTATGAAGTCCCACTG
Myotis_lucifugus|11869              ------------------------------------------GAAGAGGAATTCCTAGTG
Procavia_capensis|10079             ------------------------------------------GATGAGGCAATTTTAACT
Loxodonta_africana|16871            ------------------------------------------GATGAGGAAATCTCAACT
Spermophilus_tridecemlineatus|12389 ------------------------------------------------------------
Tupaia_belangeri|9125               ------------------------------------------AACGAGGGAATCCCACGT
Vicugna_pacos|1326                  ------------------------------------------------------------
Pteropus_vampyrus|14421             ------------------------------------------GGTGAAGAAATTCCACCT
Canis_familiaris|13176              ------------------------------------------GATCAGGAGACCCCACTT
Felis_catus|16327                   ------------------------------------------GACCAGGAAATACCACTT
Equus_caballus|9313                 ------------------------------------------------------------
Tarsius_syrichta|2954               ------------------------------------------------------------
Callithrix_jacchus|11240            ------------------------------------------GATGAG---TTTCTACTT
Rhesus_macaque|23840                ------------------------------------------TATGTGGATATTTCACTT
Pongo_abelii|19964                  ------------------------------------------GATGAGGATATTCTACTT
Pan_troglodytes|25778               ------------------------------------------GATGAGGATATTCTACTT
Gorilla_gorilla|11587               ------------------------------------------GATGAGGATATTCTACTT
Homo_sapiens|61131                  ------------------------------------------GATGAGGATATTCTACTT
                                                                                                

Nematostella_vectensis|8224         CTATCTAGACGGGAGTCCAGTGCAAGGGAAAATCAGAGTACCGAAAAAGGAGGCGAGGAC
Branchiostoma_floridae|6242         GGCCCGTCCACGACCGGACGTAGGACCACCCGGTACACGGGAACACGGAAGGGTCGGGAA
Nematostella_vectensis|23553        TCGCCACGTACCAGTTACTTATCCGACCTTCACCTCCCA---CCGATAGACCAGAAAAGC
Xenopus_tropicalis|11325            TTCCGAAAAATCGCAAAATACCGATCATTACGAAAAAAACGCAATCGGCCCGTTCGTGGG
Gallus_gallus|8502                  ------------------------------------------------------------
Monodelphis_domestica|32120         ------------------------------------------------------------
Macropus_eugenii|6140               GATTTTCCAACAACAAAACTTTCCAAAAAGCAG---------AAGGAGGAACTCAGAATC
Dasypus_novemcinctus|15278          CTCGGGAAAAAAAAGCATTCTAGAAAGAAGAGA------------AAACCATCGACACAT
Ornithorhynchus_anatinus|18147      ------------------------------------------------------------
Erinaceus_europaeus|17421           CCAGTAGGAAGAAAACCATTTAGAAAGAAGAGG------------------GCAAGATCC
Sorex_araneus|2780                  CCAAAGGGAAGTAAGCATTCTAAGAGAAAATCA------------------CTTAGAAAC
Mus_musculus|17846                  GGCAAAATGGTTGGCAAAAGGAGAAGGCCTAGA---------CCAAAGCGCTCCATCGAC
Rattus_norvegicus|35105             GTCAGAACAAATGTCAGAAGGCGTAGTAGACTGCCACGAATGAATGACCCAGAGGAGTCC
Cavia_porcellus|486                 GTACTTAAAAAAGAGAGTTTTCCAAAGAAACAG---------TCAAGCCCGTCAGAACAC
Ochotona_princeps|11539             TCACTCAGGAAAAGGTCTTCTAAAAAGAAAAAA---------GCCAAATTCTCAAAAAAG
Bos_taurus|1081                     ACATGGAAAAGAAAGCATTTTAAAAGGAAGAAG---------AAGAGACCATCAAAAGAA
Myotis_lucifugus|11869              TTGTGGAGAAGAAAGCATTTTAGAAGGAAGGAG---------GAAAGACCATCATGTTAT
Procavia_capensis|10079             TCACTCAAAAAAAAATATCTTAGAAAAAGAAGAAGAAGGAGGAAAAGGCTACTGAAAAAC
Loxodonta_africana|16871            TCATACAAAAGAAAGAAAAAGAGGAAGAAGAGG---------------CCATTGGAAAAC
Spermophilus_tridecemlineatus|12389 ------------------------------------------------------------
Tupaia_belangeri|9125               TCACTCAGAAGACGACGTGGTAAAAGGAAAAAG---------TCGAAACCATCGGAAGAC
Vicugna_pacos|1326                  ------------------------------------------------------------
Pteropus_vampyrus|14421             CCATGTAGAAAAAAACCTGTAAGAAAGAAGAAGAAGGAG---GAGAGACCAAAAAGAGAC
Canis_familiaris|13176              TCCCTGAGAAGGAGGTACTTTAGAAGGAAGAAAACGAGATTATCAAGATACTCAAAATAC
Felis_catus|16327                   TCATTGAGAAGAAGGTATTTTAAGAGGAAGAAAAAG------GGCAGACCATCCAGAGAC
Equus_caballus|9313                 ------------------------------------------------------------
Tarsius_syrichta|2954               ------------------------------------------------------------
Callithrix_jacchus|11240            TTACCCAAAAGAAGACGTTTTAGAAAGAAAAGG---------TCAAGAGCATTGAGAGAC
Rhesus_macaque|23840                TTACCCAAAAGAAAACGTTTTAGAAAGAAAAAG---------CCAAGACCAGTGAGACAC
Pongo_abelii|19964                  TTACCCAAAAGAAAACGTTTTAGAAAGAAAAAG---------TCAAGACCAGTGAGACAC
Pan_troglodytes|25778               TTACCCAAAAGAAAACGTTTTAGAAAGAAAAAG---------TCAAGACCAGTGAGACAC
Gorilla_gorilla|11587               TTACCCAAAAGAAAACGTTTTAGAAAGAAAAAG---------TCAAGACCAGCAAGACAC
Homo_sapiens|61131                  TTACCCAAAAGAAAACGTTTTAGAAAGAAAAAG---------TCAAGACCAGTGAGACAC
                                                                                                

Nematostella_vectensis|8224         TCGGATGGCGAGAGCTCCGAGCAGCACGAATTCACATCCGTGTACTCCGAGAATTCTAGC
Branchiostoma_floridae|6242         GACGGCGCAAAGAGTCCCGAGACACTGATCACAGACTACCCCATCAAG------------
Nematostella_vectensis|23553        GGCGATGAAATCATAGAGCCGATAAAAGAAGTAACC------------------------
Xenopus_tropicalis|11325            AAGAAGAGCTTGAGAAGTGATGATGATGATGTTAAT------------------------
Gallus_gallus|8502                  ------------------------------------------------------------
Monodelphis_domestica|32120         ------------------------------------------------------------
Macropus_eugenii|6140               CCACCCCTTCAAAAGCTACAGGTTCATGCTTACAGG------------------------
Dasypus_novemcinctus|15278          TCTGAAGACTGCGGGGAGCTGCAGGAC---TTTGAG------------------------
Ornithorhynchus_anatinus|18147      ------------------------------------------------------------
Erinaceus_europaeus|17421           CTCGAGTCTGAAGTAACTCAGCAAGATTACTACACA------------------------
Sorex_araneus|2780                  ACTGAACAGCAGCATCAT------------GGCGAT------------------------
Mus_musculus|17846                  CTGGAGGATTCCACTGAGCAGCTGATTTCTGGTGAC------------------------
Rattus_norvegicus|35105             ACTGACCAGCTGACTTCGGTTGACATGGGT------------------------------
Cavia_porcellus|486                 AGTGCAGATTATAACGAGCCCCAGGAC---TTCCAA------------------------
Ochotona_princeps|11539             AATAAAGATGCCAAGGAGCAATCGGCC---TCCGAC------------------------
Bos_taurus|1081                     GTCTCTGAGAAACACTCTCTAGTGCAGGACTACAAT------------------------
Myotis_lucifugus|11869              GCTGCAGACCAGCAAGAGCAGCAGCTC---CGCGAT------------------------
Procavia_capensis|10079             ATTGACCGCCATGAAGATGAGGAGCTGACCTCTGAG------------------------
Loxodonta_africana|16871            ATTGACGACCATAAAGAGCAGGAGAGC---TCTGAG------------------------
Spermophilus_tridecemlineatus|12389 ---------------------------------AAA------------------------
Tupaia_belangeri|9125               ATCGAACTCGATGATGAGCGGCAAATC---TACGAT------------------------
Vicugna_pacos|1326                  ------------------------------------------------------------
Pteropus_vampyrus|14421             TCTGAAGACTATCAAGATCAAGTGATTACATGTGAT------------------------
Canis_familiaris|13176              TCTGAAGACCATGAGAAGCCGCAGTCC---TGTGAT------------------------
Felis_catus|16327                   TCTGAAGAGTATGATAAGCAACAGGTC---GGTGAT------------------------
Equus_caballus|9313                 ------------------------------------------------------------
Tarsius_syrichta|2954               ------------------------------------------------------------
Callithrix_jacchus|11240            ACCAAAAGCCATGAAGAGGAGCAGGTC---TATGAG------------------------
Rhesus_macaque|23840                ACCAAACGCCATGAAGAGGAGCAGGTC---TATGAG------------------------
Pongo_abelii|19964                  ACCAAACGCCATGAAGAGGAGCAGGTC---TATGAG------------------------
Pan_troglodytes|25778               ACCAAACGCCATGAAGAGGAGCAGGTC---TATGAG------------------------
Gorilla_gorilla|11587               ACCAAACGCCATGAAGAGGAGCAGGTC---TGTGAG------------------------
Homo_sapiens|61131                  ACCAAACGCCATGAAGAGGAGCAGGTC---TATGAG------------------------
                                                                                                

Nematostella_vectensis|8224         GAGGGAGAAACTCGGCTCGCGTTACCAAACATTGTGTTACCGTGCTCGAAATGCGGCGAG
Branchiostoma_floridae|6242         ------------------------CCAGACATCACCATCCAGTGTGAACAGTGCAGGAAC
Nematostella_vectensis|23553        ------------------------GAAGGCATTAAGCTACTCTGTATGACATGCGAGGAA
Xenopus_tropicalis|11325            ---------------------------GAAGTCTGGATTCCCTGTTCAATATGCAAACTT
Gallus_gallus|8502                  ------------------------------ATTTCAATTCTCTGCTCAGTGTGTCAACAA
Monodelphis_domestica|32120         ------------------------------CTCACCATTCCCTGTTCCTTATGCAATGAG
Macropus_eugenii|6140               ------------------------------CTCACTATTCCCTGTTCATTATGCAACCAA
Dasypus_novemcinctus|15278          ------------------------CAAGCAATCACATTTCCCTGCTCCACATGCGGACAT
Ornithorhynchus_anatinus|18147      ------------------------------ATCAAGTTTCCCTGTTCGGTATGCAAACAA
Erinaceus_europaeus|17421           ------------------------CAAGACCCCACATTTCCCTGCTCCACGTGCAACCGT
Sorex_araneus|2780                  ------------------------CAAGAGATCACAGTTCCCTGTTCCAAATGCAAAAAT
Mus_musculus|17846                  ---------------------------ATGGTCACATTCCCCTGCTCTGTCTGCTACCGA
Rattus_norvegicus|35105             ------------------------GACATGGTCACATTCCCCTGCTCTGTCTGCCACCAA
Cavia_porcellus|486                 ------------------------CCAGGGATCACATTTCCCTGTTCCTTGTGCAAGGAG
Ochotona_princeps|11539             ------------------------CACGTGATCACATTCCCCTGTTCCACATGCAAGCAG
Bos_taurus|1081                     ------------------------GCGATGCTCACATTCCCCTGCTCCATTTGCAAGCGT
Myotis_lucifugus|11869              ------------------------CAAGCGATCACAATCCCCTGTTCCATATGCAAGAAG
Procavia_capensis|10079             ------------------------CAACTGATCACATTTCCCTGTTTTACATGCAAACAT
Loxodonta_africana|16871            ------------------------CAAGCGATCACCTTTCCCTGTTCCATATGCAAGCAC
Spermophilus_tridecemlineatus|12389 ------------------------CGAGAGATCACATTCCCCTGT---TTATGCAAGCAG
Tupaia_belangeri|9125               ------------------------GAAACCATCACGTTACCCTGTTCCACGTGCAAACAT
Vicugna_pacos|1326                  ------------------------------------------------------------
Pteropus_vampyrus|14421             ------------------------CAAGTGATTACATTTCCCTGTTCCAAATGTAAGTGT
Canis_familiaris|13176              ------------------------CAAATGATTACATTTCCCTGTTCCATATGTAAGCAT
Felis_catus|16327                   ------------------------CACATGATAACATTTCCCTGTTCCATATGCAAGCAC
Equus_caballus|9313                 ------------------------------ATCACATTTCCCTGTTCCATATGCAAGCAT
Tarsius_syrichta|2954               ------------------------------------------------------------
Callithrix_jacchus|11240            ------------------------CAAGTGACCACGTTACCGTGTTTCATATGCAAGCAA
Rhesus_macaque|23840                ------------------------CAAGCGACCACATTACCCTGTTCCATATGCAAGCAC
Pongo_abelii|19964                  ------------------------CAACGGACCACATTACCCTGTTCTATATGCAAGCAC
Pan_troglodytes|25778               ------------------------CAAGGGACCACATTACCCTGTTCCATATGCAAGCAC
Gorilla_gorilla|11587               ------------------------CAAGGGACCACATTACCCTGTTCCATATGCAAGCAC
Homo_sapiens|61131                  ------------------------CAAGGGACCACATTACCCTGTTCCATATGCAAGCAC
                                                                                                

Nematostella_vectensis|8224         AGTATAAACATCTGCCGACTTCAAAGCCACAGGGACTTGCATAATGCACTTCAAGTTCTC
Branchiostoma_floridae|6242         TTCATGGATATACGTGACTTCAGCGAACACAGGACATTCCATAAGGCGTTGAAGATGTAT
Nematostella_vectensis|23553        GAGATACGAGTTCAAGATTTGAAGATTCATCGCGAGTTTCATCGCGCTCTACAGATC---
Xenopus_tropicalis|11325            CCAATTAATCCACACTGCCACTGCCACCATAAACAGCAGCACAAGGCTGAAACCCAGCTG
Gallus_gallus|8502                  GCAATATATCCACACCATCTTTTTAATCACAAAAAAACCCACAAAGCCCTAACTTTGTTG
Monodelphis_domestica|32120         GAACTTCGTCCATCTGAATTTTTCATCCATAAGAAAAAGCACAAGGCCATGGGCGTGTTG
Macropus_eugenii|6140               GAACTTCATCCATCTCAATTTTTTGCCCATAAGAAACAGCACAAAGCAATGGCCGTGATG
Dasypus_novemcinctus|15278          GAAATTGACCCACATAGTTTTTTCTTCCATAAAAAGCAACATTTAGCTCTGGTCACATTG
Ornithorhynchus_anatinus|18147      GATACCTGTCCGTCTGACTTTTTTTATCACAAAAAACTACACAAAGCTATGGCCACAATG
Erinaceus_europaeus|17421           GAAATTGACATACCTGGAACTTTCCACCATAAAAAAAGACATGTAGCTCTGGCCACGCTG
Sorex_araneus|2780                  GAAATTATTCTACCTAATTTTTTTCTACATCAGAAGCAACATGTAGCTCTGTATACACTG
Mus_musculus|17846                  GAACTGAACAAAGCTAGGAATTTTCTCCATAAGAAACATCACAATGCTCTGAGTATGCTG
Rattus_norvegicus|35105             GAACTGAACACAGCTGGGAATTTTCTCCATAAGAAACATCACAATGCTCTGAGTACGCTG
Cavia_porcellus|486                 GAGATAGAAATCACCGGTGCTTTTTTCCACAAGAAGGAACACATTGCACAGGCTACCTTG
Ochotona_princeps|11539             GAAATTGACATACGGGGTGCTTTTGGTCATAAAAAGCAACACGTGGCGCTGGCGACTTTG
Bos_taurus|1081                     GAGGTTGGCCTGCCTGGAGTTTTCTCCCACAAGAAGCAGCACATGGCTCTGAGCACGCTG
Myotis_lucifugus|11869              GAAATTGACCTAACTGGATTTTTCCTACACAAAAGGCAACATGAAGCTCTAGCCGCACTG
Procavia_capensis|10079             GAAATTGATCCACCTGGTTCTTTCTTCCATAAAAAGCAACATACAGCTCTCACCTCACTG
Loxodonta_africana|16871            GAAATTGATCTACCTGGCTTTTTCTTCCATAAAAAGCAACATATAGCCCTGACCTCATTG
Spermophilus_tridecemlineatus|12389 GAAATTGTCACGACTGGCATTTTCTTCCACAAGAAGCAACATGCAGTTCTGGCTACATTG
Tupaia_belangeri|9125               GAGGTCGATGTAAGAGGTGTCTTTTTCCACAAAAAGCAACATATAGCCCTGGCCACACTG
Vicugna_pacos|1326                  ------------------------------------------------------------
Pteropus_vampyrus|14421             GAAATTGATCTACCTGGAGTTTTTCTCCATAAAAAGCAGCATGCAGCCTTGACCACACTG
Canis_familiaris|13176              GAAATTGACCTACGTGAAACTTTCCTCCATAAAAAGCAACATATGGCTCTGGCCACCCTG
Felis_catus|16327                   GAAATTGACGTACGTGAAATTTTCCTCCATAAAAAGCAACATGTGGCTTGGGCCACCCTG
Equus_caballus|9313                 GAAATTGAGCCATCTGGAACTTTCTTCCATAAAAAGCAACACATAGCTCTGGCCACTTTG
Tarsius_syrichta|2954               ------------------------------------------------------------
Callithrix_jacchus|11240            GAAATTGACCTATCTGGTGTTTTTCTCCATAAGAAGCAACATGTAGCTCTGGCCACACTG
Rhesus_macaque|23840                GAAATTGACTTAACTGGTATTTTTCCCCATAAGAAGCAACATGTAGCTCTGGCCACGCTG
Pongo_abelii|19964                  GAAATTGACCTACCTGGTATTTTTCTCCATAAGAAGCAACATATAGCTCTGGCCACACTG
Pan_troglodytes|25778               GAAATTGACCTAACTGGTATTTTTCTCCATAAGAAGCAACATGTAGCTCTGGCCACGCTG
Gorilla_gorilla|11587               GAAATTGACCTAACTGGTATTTTTCTCCATAAGAAGCAACATGTAGCTCTGGCCACGCTG
Homo_sapiens|61131                  GAAATTGACCTAACTGGTATTTTTCTCCATAAGAAGCAACATGTAGCTCTGGCCACGCTG
                                                                                                

Nematostella_vectensis|8224         AAGTTTGCA------CACGGTTACAAGCCTGCAAGCACGAATGCACTGATCAAGAGAAGA
Branchiostoma_floridae|6242         GGATATCAA------GGGGACGCCGACCCAAATAGCCTGGAAGAGCTGATCGAGAGGAGA
Nematostella_vectensis|23553        ---TTTAGGTACACAATGGACAATAAACCAAACACCGTAAAACAGCTTGTGACGAGGCGC
Xenopus_tropicalis|11325            GGCTATAAA------CCTTCCCAGATACCAAGAAGCATTAGAAATCTCTCCTCCAAAAGA
Gallus_gallus|8502                  GGCTATGAT---AGCTCACAAACAAGGCTG---GATAATGAAACACTTTTAGCTCAGAGA
Monodelphis_domestica|32120         GGCTACACCTGGGTAGCTGGGGAAAAACCA---GAGAGACACAAGGTTCTAACAAAGAGG
Macropus_eugenii|6140               GGCTACAAGATGACAGCTAGAGAAAAACCA---GAAAGAAACAAGCTTATAGAACAGAGG
Dasypus_novemcinctus|15278          GGTTTTAGC---TTGAGTGGAAAGATACCA---CAGCAATCAATGATGATTGTCCAGAGA
Ornithorhynchus_anatinus|18147      GGTTTTCAGTGGTCCAAGGGAAGGAGACCA---GACAGAAAAACCCTCACCCTTCAGAGA
Erinaceus_europaeus|17421           GGCGTCCAGTGGGATGGCATTAAGCGACTA---GGGTCCTCAGAGATAATTCTTCAAAGA
Sorex_araneus|2780                  GGTTTTGAATGGACAGACAGAAATAACCTA---GAACCCTCGGTGATTGCTGATCATAGA
Mus_musculus|17846                  GGTTTCCAGTGGATGGGAGGGAGGCAACCA---AAGCCCAAACTGGTCAGTCTTCATAGA
Rattus_norvegicus|35105             GGTTTCGAGTGGATGGGAGGGAGGAAACCA---AAGCCCAAAATGGTCAGTTTTCACAGA
Cavia_porcellus|486                 GGGCTCCGATGGCTGGACAGGACGAAGCAA---CCCTCCACTAAGACTGTCGTTCAGAGA
Ochotona_princeps|11539             GGTTTCCAGTGGCTGGGTGGAAAGATGCCG---CGGTTCTTCGCGATTGCTAGTCACAGA
Bos_taurus|1081                     GGCTTGCAGTGGACGGGAGGGAAGAAACCA---GGGCTCTCAGCGATCATAGGCCAGAGA
Myotis_lucifugus|11869              GGTCTTGAATGGAAGAGGGGAATGAAACCA---ACACACTCAGCGATTTCTAGTAAGAGA
Procavia_capensis|10079             GGTTTTGACTGGATGGGTGAAAAGAAACCA---CTGCGGTCAGAGATTGTTGCTCAGAGA
Loxodonta_africana|16871            GGTTTTCACTGGATGGGTGAGAAGATACCA---CTGCGATCAGAGATTGTTGCTCAGAGG
Spermophilus_tridecemlineatus|12389 GATTTCCCATGGATGGGTGGTAGGAAACCC---CCATTTTCAGTCCTGGATGCTCAGAGA
Tupaia_belangeri|9125               GGCTTTCACTGGTTGGGCGGAAGGAAACCC---TTGCCCTCCGCGACTGCTATGCAGAGG
Vicugna_pacos|1326                  ------------------------------------------------------------
Pteropus_vampyrus|14421             GGTTTTCAATGGATAGGTGGAAATAAACCA---GGACACTCAGTGATTGCTATTCAGAGA
Canis_familiaris|13176              GAGTTTCAATGGATGGGTGAAAAGAAACCA---GCGCTCCCAGTAATTACCATTCAGAGA
Felis_catus|16327                   GGGTTTCAGTTGATGGGTGGAAAGAAACCA---GGGCCCTCAGTGATTGCCATTCAGAGA
Equus_caballus|9313                 GGTTTTCACTGGATGGGTAGAAAGAAACCA---GGGCCTTCAGTAATTGCTATTCAGAGA
Tarsius_syrichta|2954               ---------------------AAGAAGCCG---CAGTCCTCAGTGATCATTCTTCAGAGA
Callithrix_jacchus|11240            GGTTTCCAATGGATGGGTGGAAAGAAACCA---CAGCCCTCAGTGATTGCTGTTCAGAGA
Rhesus_macaque|23840                GGTTTCCAGTGGATGGGTGGAAAGAAACCA---CAGCCCTCAGTGATTGCTGTTCAGAGA
Pongo_abelii|19964                  GGTTTCCAATGGATGGGTAGAAAGAAACCA---CAGCCCTCAGTGATTGCTGTTCAGAGA
Pan_troglodytes|25778               GGTTTCCAACGGATGGGTAGAAAGAAACCA---CAGCCCTCAGTGATTGCTGTTCAGAGA
Gorilla_gorilla|11587               GGTTTCCAATGGATGGGTAGAAAGAAACCA---CAGCCCTCAGTGATTGCTGTTCAGAGA
Homo_sapiens|61131                  GGTTTCCAATGGATGGGTAGAAAGAAACCA---CAGCCCTCAGTGATTGCTGTTCAGAGA
                                                                                                

Nematostella_vectensis|8224         AAACTGATTATACAACGTATGCAAGAATCTAGTGCTCAAAGAGGAGACAAGGGTTTTAGC
Branchiostoma_floridae|6242         AAGAGGCTCCTAAAGCGGCTGACATCTGAGGCTACC------------------CCGGAG
Nematostella_vectensis|23553        AGATCTCTTATGAGAAAACTTAACGAGAATGCAAAT------------------TTTGAA
Xenopus_tropicalis|11325            AGGGAAGTGATATCATATATAAAAGACCATTGTGGT------------------TATAAG
Gallus_gallus|8502                  CAGAAGCTAATTTCAAAAGTGACCAAGCTTCCTAAG------------------AATTCT
Monodelphis_domestica|32120         CAATTCCTAATCTCGACCTTCATCGAAGCCCATCTG------------------TACAAT
Macropus_eugenii|6140               ACTTCTCTAATCTCTACATTAATTGAAGCCTATTTG------------------TATGAT
Dasypus_novemcinctus|15278          CAGATTTTAATTTCTCAACTCTTGTCAGCTTCTCTA------------------TTCAAT
Ornithorhynchus_anatinus|18147      CAGTGTTTACTTTCCAAGTTAATGGAGGCCTCTTTG------------------TTCAAC
Erinaceus_europaeus|17421           AAGCTGATCATCGCTAAACTGCTGTCGTCATCTACA------------------CTCACT
Sorex_araneus|2780                  CAGGATTTAATTACTAAACTACTAGCAGTTGAGAAA------------------CTCAAT
Mus_musculus|17846                  GAGTGTATAATCTCTAACCTTTTGAGATCTTCTACA------------------TACAAT
Rattus_norvegicus|35105             GAGTGTATAATTTCTAACCTTTTGAGATCTTCTACA------------------TACAGT
Cavia_porcellus|486                 CAGGTTTTAATTGCTAACCTGTTATCCTCTTTTATG------------------TTCAAT
Ochotona_princeps|11539             CAGTTTATAATTTCTAAAGTGATGTCCTCTTTCATA------------------TTCAGT
Bos_taurus|1081                     CAGTCTGTCATTACTAAGCTGCTGTCATCTTTTGCG------------------TTCAAC
Myotis_lucifugus|11869              AAGTTTACCATTACTAAACTACTGACATCTTCTACA------------------TATTCT
Procavia_capensis|10079             CGGTCGCTAATTACTAATCTATTGTCATCTTTTACA------------------TTCAGT
Loxodonta_africana|16871            CAGCTTTTAATTACTAAACTATTGTCATCTCGTATC------------------TTCAGT
Spermophilus_tridecemlineatus|12389 CAATTTATAATTTCCCAACTATTGTCATCTTTTGAG------------------TTCAAT
Tupaia_belangeri|9125               CAGTTAATCATTTCCAAACTGTTGTCATCTTTTACA------------------TTGACG
Vicugna_pacos|1326                  ------------------------------------------------------------
Pteropus_vampyrus|14421             CAGTTCATAATTACTAAACTATTGTCATCTTTCACA------------------TTCACT
Canis_familiaris|13176              CAGTTTATAATCACTAAACTATTGTCATCTTCTTTA------------------TTCACT
Felis_catus|16327                   CAGCTCATAATCGCCAAACTATTGTCATCTTCTAGA------------------TTCACC
Equus_caballus|9313                 CAGTTTGTAATTACTAAAGTATTGTCATTTTCCTTA------------------TTCAGT
Tarsius_syrichta|2954               CAGTTCGTCATTTCTAAGCTGCTGTCGTCCGCTTCG------------------CTCACT
Callithrix_jacchus|11240            CAGTTCATGATTTCTAAACTATTGTCATCTTTTATG------------------CTCACT
Rhesus_macaque|23840                CAGTTCATGATTTCTAAACTATTGTCATCTTTTATG------------------TTCACT
Pongo_abelii|19964                  CAGTTCATGATTTCTAAACTATTGTCATCTTTTATG------------------TTGACT
Pan_troglodytes|25778               CAGTTCATGATTTCTAAACTATTGTCATCTTTTACG------------------TTCACT
Gorilla_gorilla|11587               CAGTTCATGATTTCTAAACTATTGTCATCTTTTATG------------------TTCACT
Homo_sapiens|61131                  CAGTTCATGATTTCTAAACTATTGTCATCTTTTATG------------------TTCACT
                                                                                                

Nematostella_vectensis|8224         GAT------------CGACAACTTCAAAAAATAAATACAGCGTTTGAAATTCTTAAAACT
Branchiostoma_floridae|6242         AAACCTATCTCACAGGACAAGTTACGTAAAATCAACGATGCGTACGAACTGCTGAAATCG
Nematostella_vectensis|23553        AATCCTGTCAGTATACGAAAACTGCAAAAGTTAAACGCAGCTTATGAGCTGTTAAAGTCA
Xenopus_tropicalis|11325            CAA------------GCACTGATCCATAATGTAGACAGATCATATGATATTTTAAAGAGA
Gallus_gallus|8502                  GAA------------AGACATCGTCAGAAGATCAATGATTCATTTGAATTTCTTATGGAT
Monodelphis_domestica|32120         GAA------------AAAACCAAACGAAGCCTCGACAGTGCTTGTGAGTTCCTCTGTAAG
Macropus_eugenii|6140               GAA------------AAAACCAGACAAAACATTGACAATGCTTGTGAGCTCCTTTGTAAG
Dasypus_novemcinctus|15278          GAA------------AAAACCCTACAGAGTATCAATCATGCTTTTGAGCTACTTTGGAAG
Ornithorhynchus_anatinus|18147      CAA------------AAAATCCGACAAAGCATCGATAGTTCATATGAGCTTCTCAAGAAA
Erinaceus_europaeus|17421           GAA------------AAGCACCTACACAGCATTAATAGCGCTTTTGAGCTTCTCTGGAAA
Sorex_araneus|2780                  GAA------------AAAAACCTCAAGAACATCAATAATGCTTTTGAGCTACTTTGGGAG
Mus_musculus|17846                  GAA------------AAAGTCCTTCACAATGTGAACTACGCATTTGAGTTTCTTTGGAAG
Rattus_norvegicus|35105             GAA------------AAAGTCCTTCAGAGTATGAATTATGCATTTGAGCTTCTTAGGAAG
Cavia_porcellus|486                 GAA------------AAAGTCCTACAGAGCATTAATAATGCTTTCGAGCTACTTTGGAAG
Ochotona_princeps|11539             GAG------------AAAATCCTACAGATAATCAACGATGCTTTTGAGCTACTCAGGAAG
Bos_taurus|1081                     GAG------------AAAACCTTGCAGAGCATTAATAATGCTTTTGAGCTACTGTGGAAG
Myotis_lucifugus|11869              GAA------------AAAGGCCTAGACAGCATGAATAATGCTTTAGAACTACTTTGGAAG
Procavia_capensis|10079             GAA------------AAAGCCCTACAGATCATTAATAATGCTTTTGAGCTAGTTTGGAAG
Loxodonta_africana|16871            GAA---------------AAACTACAGACCGTTAATAATGCTTTTGAACTAATTTGGAAG
Spermophilus_tridecemlineatus|12389 GAA------------AAAATCCTGCAAAACATTAATAATGCTTTTGAACTACTTGAGAAA
Tupaia_belangeri|9125               GAA------------AAAATCCTACAGAGCATCAATTATGCTTTTGAGCTACTTTGGAAG
Vicugna_pacos|1326                  ------------------------------------------------------------
Pteropus_vampyrus|14421             GAA------------CAAATCCTACAGAGCATTGATCATGCTTTTGAGTTACTTTGGAAG
Canis_familiaris|13176              GAA------------AAAATCCTAGAGAGCATTAATTATGCTTTTGAGCTACTTTGGCAG
Felis_catus|16327                   GAA------------AAAATCCTACAGAGCATTAACAATGCTTTTGAGCTACTTTGGAAG
Equus_caballus|9313                 GAA------------AGAGTCCTACAGAGCATTAATAATGCTTTTGAGCTACTTTGGAAC
Tarsius_syrichta|2954               GAG------------AAATCCCTGCAGAGCATCAACCGTGCTTTTGAGCTGCTTTGGAAA
Callithrix_jacchus|11240            GAA------------AAAAACCTACAGAGCATTAATAATGCTTTTGAGCTGCTTTGGAAA
Rhesus_macaque|23840                GAA------------AAAACCCTACAGAGCATTAATAATGCTTTTGAGCTGCTTTGGAAA
Pongo_abelii|19964                  GAA------------AAAACCCTACAGAGCATTAATAATGCTTTTGAGCTGCTTTGGAAA
Pan_troglodytes|25778               GAA------------AAAACCCTACAGAGCATTAATAATGCTTTTGAGCTGCTTTGGAAA
Gorilla_gorilla|11587               GAA------------AAAACCCTACAGAGCATTAATAATGCTTTTGAGCTGCTTTGGAAA
Homo_sapiens|61131                  GAA------------AAAACCCTACAGAGCATTAATAATGCTTTTGAGCTGCTTTGGAAA
                                                                                                

Nematostella_vectensis|8224         AGTTTAGGGGGGCGAATG---GATTCCTTCAGACTCCTGTCGAACTCCCTAGAC---GTG
Branchiostoma_floridae|6242         GACTTGGAGGGCACGTTT---GAAGTCTTCCGCCAAATCCGTGAAGATATCCAGGTAGAC
Nematostella_vectensis|23553        AACTTAGTAGATCGGTGG---GGGACGTTGCGGGAAGTCGCGCTTGTTGATCCGAAAGAA
Xenopus_tropicalis|11325            ATTCAGATTACTCCTATA---AAAGATATAAGAAGGATAAGCCCTCAGGACTTTGAAAAG
Gallus_gallus|8502                  GGT---------CATGCT---TCTACATTATATTGTGATCTTGACAATACA------AAC
Monodelphis_domestica|32120         CAT---------CCAGTA---CCTTCCTATTACAAGATTTTCAGCACTTCTTTC---AAT
Macropus_eugenii|6140               CAG---------CACATA---CCTTCCTATTACAAGATTCTTAGTAATTCTTTC---AAT
Dasypus_novemcinctus|15278          AAA---------CAGGTA---CCTGCCTACTATAAGATTATCGATAGCATTGAC---AAC
Ornithorhynchus_anatinus|18147      AGA---------AAGGAA---AGCGAGTCCTTTAACATCCTTCCAAGTGTAGTT---GAA
Erinaceus_europaeus|17421           AAA---------GAACTG---CCAGAATATTACAAGATTTGTGAAAGCAGTCCC---GGG
Sorex_araneus|2780                  AAA---------CAATTA---AGAAGCAACTGCATGATTACTGATTATATTCAG---AGG
Mus_musculus|17846                  AAA---------CAAGTT---CCATCATACTTCAAACTTTGTGATAAGGTTGGC---GAG
Rattus_norvegicus|35105             AAA---------CAAATT---CCGTCGTACTTCAAACTTTGTGACAAGGTCGGA---GAG
Cavia_porcellus|486                 AAA---------CAAATG---CCAGCAGCCAGCAAGGTTTCTGATAGCATAAGT---AGG
Ochotona_princeps|11539             AAA---------CAAATC---CCAGGATACTATAAGATTTTGGATAGCACAGAC---AGG
Bos_taurus|1081                     AGA---------CAGATA---CCAGCATACTATAAGATTATGCAGAACATTTGC---GAG
Myotis_lucifugus|11869              AAA---------CAAATA---CCAGCGTACTATAAGATTATGGACAACATTCCC---AAC
Procavia_capensis|10079             AAA---------CAAGTA---CCAGAATACTATAAGATTATTGACAACATTGCC---GGG
Loxodonta_africana|16871            AAA---------CAAGTA---CCAGCGTATTATAAGATTATTGAAAACATTGAC---AAT
Spermophilus_tridecemlineatus|12389 AAA---------CAAATC---CCATTATACTATAAGATTATTGATTACATTGAT---GGG
Tupaia_belangeri|9125               AAA---------AAAATA---CCAGCATACTATAAAATTTTTGACAACCTTGAC---GGG
Vicugna_pacos|1326                  ---------------------------------------------------------AAG
Pteropus_vampyrus|14421             AAA---------CAAATA---CCAGCATACTATAAGATTATTGATAACATTAAC---TCC
Canis_familiaris|13176              AAA---------CAAATA---CCAGCATACTATAAGATGATTGATAACGTTCAC---AGG
Felis_catus|16327                   AAA---------CAAATA---CCAGCATACTTTAAGATTGTTGACAGCATTCAT---AGG
Equus_caballus|9313                 AAA---------GAAATA---CCACAATACTATAAGATTGTTGATAACATTCAT---ATG
Tarsius_syrichta|2954               AAG---------CAGATA---CCGGCATACTATAAGATCTTTGAGGACGTCCACGGGAGG
Callithrix_jacchus|11240            AAA---------CAAATACCACCAGCATACTATAAGATTTTTGATAACATTGAC---AGG
Rhesus_macaque|23840                AAA---------AAAATA---CCAGCATACTATAAGATTTTTGATAACATTGAC---AGG
Pongo_abelii|19964                  AAA---------CAAATA---CCAGCATACTACAAGATTTTTGATAACATTGAC---AGG
Pan_troglodytes|25778               AAA---------CAAATA---CCAGCATACTATAAGATTTTTGATAACATTGAC---AGG
Gorilla_gorilla|11587               AAA---------CAAATA---CCAGCATACTATAAGATTTTTGATAACATTGAC---AGG
Homo_sapiens|61131                  AAA---------CAAATA---CCAGCATACTATAAGATTTTTGATAACATTGAC---AGG
                                                                                                

Nematostella_vectensis|8224         CATGTGAGCGAGGGACGTGGGGACAGGCTGAGCTGCACAAAAGCAGTGGGTGTCTGTGAA
Branchiostoma_floridae|6242         ATAGAGGGCATCGCACTCAACTGTAGCGCCCTGTGTGCAAGGGCTGTTGGGATATGTGCG
Nematostella_vectensis|23553        TACCATGTCATGGGTCAAAGCACACTTTTAAATTGCGCTTTGGCATTCGGCATTTGCGAA
Xenopus_tropicalis|11325            ACTCTGGTCTGCAAGACTGATAAAATTAATGCCCTAATACCATCGATAGCAGTGTGTTGT
Gallus_gallus|8502                  AGTGTTAACACTCTCAAGAATGTAAAAAATTCTTCAATAAAGGCATTATCAATTTGCCAA
Monodelphis_domestica|32120         AGCTCTGTGCACTTCATGAAGACAAATAATCCTCTAGTAAAGTCTGTTGCCATCTGTGAA
Macropus_eugenii|6140               AGTTCTGTGCACCTCAGGAAAACAGATAATCCACTAGTTAATGCTGTTGCCATCTGTGAA
Dasypus_novemcinctus|15278          AGCTCCATATATTCTCAAAAAATAAGCCTCGCGTTAATTAAAGGAGTGGCCGTGTGTGAA
Ornithorhynchus_anatinus|18147      AGCTCCGTCCATCTAAGGGAAATCAACAATCCCCTCATTCATGCAGTAGCCATTTGTGAA
Erinaceus_europaeus|17421           AATTCCAGCTATACTGAAAACATTTCCACCCTATTGATTAAAGGAGTCGCCATTTGTGCA
Sorex_araneus|2780                  AGTGCTGTGCAATTAAAAAATGTGTGCCATCTACTGGTTAAAGGAGTGGCCGTTTGTAAT
Mus_musculus|17846                  ACTTCTACGTATTCTCCAAACAGCAACCATCTGATGATTAAAGGTATAGCCATCTGTAGC
Rattus_norvegicus|35105             ACTTCTATATATTCTCCAACCAGCTACCACCTTCTGATTAAAGGTATAGCCATCTGTAGC
Cavia_porcellus|486                 AGCTACGCATACTCTCAAAAAACCCATCATTTGTTAATTAAAGGAGTAGCCACTTGTGAA
Ochotona_princeps|11539             AGCTCCACAACCTCTCACAAAGTCTGCCATCTGTTAATTAAAGGAGTAGCTATCTGTGAA
Bos_taurus|1081                     AGCTCCATACATCCTCAAAAAATCGGTCACCTGTTAATTAAAGGAGCAGCTGTTTGCAAA
Myotis_lucifugus|11869              AGTTCCATCTATTCACAAAAAATCCGCCATCTATTAATTAAAGGAGCAGCCATTTGCAAT
Procavia_capensis|10079             AGCTCTGTATATCCTCAACAAGTTAACCATCTATTGATTAAAGGAGTAGCCATTTGTGAA
Loxodonta_africana|16871            AGTTCCGTATATTCTCAGAAAGTTTGCCATTTATTGATTAAAGGAGTAGCCATTTGTGAA
Spermophilus_tridecemlineatus|12389 AGTTCCGTGTCTTCTCAACATATACCTCACCTATTAATTAAAGGTGTAGCCATCTGCAGA
Tupaia_belangeri|9125               AGTTCCACATATTCCCCCCAAATCTGCCATGTCTTAATTAAAGGACTAGCCATTTGTGAA
Vicugna_pacos|1326                  AGTTCCACATAC---CAGAAAATCTGCCACCTATTA---AAAGGAGCAGCCATCTGTGAA
Pteropus_vampyrus|14421             AGTTCCACATATTTTCAGAAAATCTGCCATCTATTAATTAAAGGAGTAGCTGTTTGTGAA
Canis_familiaris|13176              AGTTCCATATATTCTCAAACAATCTCTCATGTATTGATTAAAGGTGTAGCCATTTGTGAA
Felis_catus|16327                   AGTTCCACACATCCTCAAACTATCTGTCATCTATTGATTAAAGGTGTCGCCATTTGTGAA
Equus_caballus|9313                 AGTTCCACATATTCTCAAAAAGTCTGCCATCTGTTAATTAAAGGAGTAGCCATTTGTGAA
Tarsius_syrichta|2954               AGTTCTACATACCCTCAAAAAACCTGTCACCTGTTAATTAAAGGAGTCGCCATTTCTAAA
Callithrix_jacchus|11240            AGTGTTGTATATTCTCAAAAAATATGTCATCTATTAATTAAAGGTGTGGGCATTTGTGAA
Rhesus_macaque|23840                AGTGTCATATATTCTCAAAAAATACGTCATCTATTAATTAAAGGAGTGGGCATTTGTGAA
Pongo_abelii|19964                  AGTGTCATACATTCTCAAAAAATATGTCATCTATTAATTAAAGGAGTGGGCATTTGTGAA
Pan_troglodytes|25778               AGTGTCATATATTCTCAAAAAATATGTCATCTGTTAATTAAAGGAGTGGGCATTTGTGAA
Gorilla_gorilla|11587               AGTGTCATATATTCTCAAAAAATATGTCATCTGTTAATTAAAGGAGTGGGCATTTGTGAA
Homo_sapiens|61131                  AGTGTCATATATTCTCAAAAAATATGTCATCTGTTAATTAAAGGAGTGGGCATTTGTGAA
                                          .                                            .  *     

Nematostella_vectensis|8224         GAGGTAAACGCGCGGTGGAAG---AACATGGAGGATGCACATCACTTACAAGACGACTTC
Branchiostoma_floridae|6242         GACGCAAATCCCAGATGGCGCACATCGATGGAAGACTTTGGCGTGTTTCAGAACCACTTT
Nematostella_vectensis|23553        GACAAGAACTCTCGATGGAAAACGACGATGGAAGATAGACACACGTTTTGTGATTATTTT
Xenopus_tropicalis|11325            GACAAGAATCCATCTTGGCAAAGAGACATGGAAGATTCTTTTGTCATTCTTGACAAATAT
Gallus_gallus|8502                  GATAAAAATTCCATGTGGCAGAGAGACATGGAAGACAGATTTTTTGTAGTGGACAACTAT
Monodelphis_domestica|32120         GACCAGAACAAAACATGGCGGCCGGTAATGGAAGACCGATATATCTTCCGGGGCAAATTC
Macropus_eugenii|6140               GACCAGAACAAGTCATGGAGACCAGTAATGGAAGACAGATATATCTTCCGGAACAGATTT
Dasypus_novemcinctus|15278          GACAGGAATGCTACATGGAGAGCAGACATGGATGACAAATTCACTGTTGTGAATAATTTT
Ornithorhynchus_anatinus|18147      GATAGAAATTCTCCATGGAGAGTTGATATGGAAGATACATTCATAATATTGGATAATTAC
Erinaceus_europaeus|17421           GACAGGAATTCTACATGGAAGGCTGACATGAATGATAAAGTCACCGTAGTGAACAATTTC
Sorex_araneus|2780                  GACAGGAATACTATATGGAAAGCTAGCATGAATGACAGATTCACCATAGTGAATGAATTT
Mus_musculus|17846                  AATAATAATTCAGCCTGGAAAGCGGAGCCGAACTGTAAATTCACGGTCGTGAACGATTTT
Rattus_norvegicus|35105             AATAGTAATTCAACCTGGAAAGCTGAGCCCAACTGTAAATTCACGGTCGTGAACGACTTT
Cavia_porcellus|486                 TTCAGGAACCCTACAAAGAAGGCTGACACGAATAGTAAATTCACAATAATAAATAATTTT
Ochotona_princeps|11539             GACATGAATTCTACATGGAGGCATGACATGAATGACAAATTCACTGTACTGAATCATTTT
Bos_taurus|1081                     GACAGGAATTCTACATGGAGAGTTGACATGAATAATAAATTCATTGTCGTGAATAATTTT
Myotis_lucifugus|11869              GACAAGAATTCTACGTGGAAAGTGCACATGAATGATAGATTTACTGTCGTGAATCATTTT
Procavia_capensis|10079             GACAGGAATTCTGCCTGGAGAACCACCATGGAAGATAAATTCACTGTAGTGAATAGTTTT
Loxodonta_africana|16871            GACAGGAATTCTACATGGAGAGCTACCATGGAAGATAAATTCGCCATAGTGAATAATTTT
Spermophilus_tridecemlineatus|12389 GACAGAAATGCTGCATGGAAAGTAGACATGAATGATAAATTCACTGTCATGAATAATTTT
Tupaia_belangeri|9125               GACAGGAATTCTACGTGGAAAGCCGATATGAATGATATGTTCACAATAGTGAATAATTTT
Vicugna_pacos|1326                  GACAGGAATTCTACGTGGAGGGTTGACATGAACGATAAGTTCACGATAGTGAATAATTTT
Pteropus_vampyrus|14421             AACAGGAATTCTACATGGAGAGTTGCCATGAATGATAGATTCACTGTAGTGAATAATTTT
Canis_familiaris|13176              GATGGAAATTCTGCATGGAAAGCTGACATGAATGATAAATTCACTGTGGTGGATAATTTT
Felis_catus|16327                   GATAGAAATTCTACATGGAGAGCTGACATGAATGATAAATTCACTGTAGTGAACAATTTT
Equus_caballus|9313                 GACAGGAATTCTACATGGAAAGCTAACATGAACGATAAATTCACTGTAGTGAATCGTTTT
Tarsius_syrichta|2954               AACAGGAACTCCACATGGAAAGCCAACATGAATGATACCTTCACAGTAGTGGATCATTTT
Callithrix_jacchus|11240            GACAGGAATTCTACATGGAAAGCTAACATGAATGATAAATTCACTGTAGTGAGTAATTTT
Rhesus_macaque|23840                GACAGGAATTCTACATGGAAAGCTGACATGAATGATAAATTCACTGTAGTGAGTAATTTT
Pongo_abelii|19964                  GACAGGAATTCTACATGGAAAGCTGACATGAATGATAAATTCACTGTAGTGAGTAATTTT
Pan_troglodytes|25778               GACAGGAATTCTACATGGAAAGCTGACATGAATGATAAATTCACTGTAGTGAGTAATTTT
Gorilla_gorilla|11587               GACAGGAATTCTACATGGAAAGCTGACATGAATGATAAATTCACTGTAGTGAGTAATTTT
Homo_sapiens|61131                  GACAGGAATTCTACATGGAAAGCTGACATGAATGATAAATTCACTGTAGTGAGTAATTTT
                                     :    **  .    :.*..       .  .*  .           *    ..  . *: 

Nematostella_vectensis|8224         CTCCCGCAGACCCCTTCATGCTTTATAGGTATCTATGACGGCTACTGCGGCGGCACCACC
Branchiostoma_floridae|6242         GGTGAAGATCCGAACAAGACATTTTTTGCTCTGTACGACGGACATCATGGACCATTTGCA
Nematostella_vectensis|23553        TGTAACGATCCCCAAAGCGGGTTCTTTGCTGTTTTTGACGGCTACAATGGAGCAACCGCG
Xenopus_tropicalis|11325            GGTGGTAGATCAGACACCTGTTTAGTTGGCATATTTGACGGATGTCGTGGCAAATCTGCT
Gallus_gallus|8502                  GGAAGTAGGTCAGATACATGTTTTCTGGGATTAATTGATGGGCACCATGGCACGACAGCT
Monodelphis_domestica|32120         GGGCAGAAATTCAATACGTGTTACTTTGGCCTGTTCGATGGACACCATGGCTCGGTGGCA
Macropus_eugenii|6140               GGGAAGAAATCCAACGCATGTTTTTTTGGCTTGTTTGATGGACACCATGGCTCCGTGGCA
Dasypus_novemcinctus|15278          GGCAATAAACCCAACGTGAGTCTTTTGGGTTTGTTTGATNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|18147      GGTAACAGATCAAATGTGTGCTTTTTTGGTTTGTTCGATGGACATCATGGGGCGGTTGCT
Erinaceus_europaeus|17421           GGCAGTAAGCCAAACGTGTGCTTTTTTAGCTTGTTTGCTGGGCATAAAGGTGCCTCTGCG
Sorex_araneus|2780                  GGCCATAAGCCAGATGTGTGTTTTTTGGGTTTGTTTGATGGACATCACGGTGCTACAGCA
Mus_musculus|17846                  GGTGATAAGGCCAATGTGTGCTTTTTCGGTTTATTTGATAGCCATTACGGTTATGCAGCA
Rattus_norvegicus|35105             GGCGATAAAGCCAATGTGTGCTTTTTCGGTTTATTTGATAGTCATCATGGTTACGCAGCA
Cavia_porcellus|486                 GGCAGCAAGCCCAATGTGTGTTTTTTCGGTTTGTTTGATGGACATCGAGGTTTCCCAGCA
Ochotona_princeps|11539             GGCAATAAGCCCAATGTGTGCTTTTTTGGGTTGTTTGATGGATGTCATGGTGCTGCAGCA
Bos_taurus|1081                     GGCAGTAAACCCAACGTGTGTTTTTTTGGTTTGTTTGATGGACATCACGGAGACTCAGCA
Myotis_lucifugus|11869              GGCAGTAAACCGAATGTGTGTTTCTTCGGTTTGTTTGATGGGCATCATGGTCCATCAGCA
Procavia_capensis|10079             GGCAATAAATCCAATGTGTGTTTTTTGGGTTTGTTTGATGGGCATTGTGGTGTCTCAGCA
Loxodonta_africana|16871            GGCAATAAATCCAACGTGTGCTTTTTTGGTTTGTTTGATGGGCATCATGGTGTCTCAGCA
Spermophilus_tridecemlineatus|12389 GGCAATAAACCCAATGTGTGTTTTTTTGGTTTGTTTGACGGACACCACGGTGCCGCAGCA
Tupaia_belangeri|9125               GGCAATAAACCCAACGTGTGTTTTCTGGGGATGTTTGATGGACATCATGGCTCCTCATCG
Vicugna_pacos|1326                  GGCAACAAGCCCAACGTGTGTTTTTTTGGTTTGTTTGATGGCCATCACGGGGCCTCGGCG
Pteropus_vampyrus|14421             GGCAATAAACCCAATGTGTGTTTTTTTGGTTTGTTTGATGGGCATCATGGTGCCCCAGCG
Canis_familiaris|13176              GGCAAAAAACCTGATGTGTGTTTTTTTGGTTTATTTGATGGACATCATGGTGCCTCAGCA
Felis_catus|16327                   GGCAATAAACACAATGTGTGTTTCTTTGGTTTGTTTGATGGACATCATGGTGTCTCAGCA
Equus_caballus|9313                 GGCAATAAACCCAATGTGTGTTTTTTTGGTTTGTTTGATGGGCATCATGGTGCTTCAGCG
Tarsius_syrichta|2954               GGCAACAGGCCCAATGTGTGTTTTTTCGGACTGTTTGACGGGCACCACGGGGTCTCCGCG
Callithrix_jacchus|11240            GGTAATAAACCTAACGTGTGTTTTTTCGGCTTGTTCGATGGACATCATGGTGCCTCAGCG
Rhesus_macaque|23840                GGTAATAAACCTAATGTGTGTTTTTTCGGTTTGTTCGATGGACATCATGGTGCCTCAGCG
Pongo_abelii|19964                  GGGAATAAACCTAATGTGTGTTTTTTTGGTTTGTTCGATGGACATCATGGTGCCTCAGCG
Pan_troglodytes|25778               GGTAATAAACCTAATGTGTGTTTTTTTGGTTTGTTTGATGGACATCACGGTGCCTCAGCG
Gorilla_gorilla|11587               GGTAATAAACCTAATGTGTGTTTTTTTGGTTTGTTTGATGGACATCACGGTGCCTCAGCG
Homo_sapiens|61131                  GGTAACAAACCTAATGTGTGTTTTTTTGGTTTGTTTGATGGACATCACGGTGCCTCAGCG
                                           .     .        :  * .   * :: *.  .       ..          

Nematostella_vectensis|8224         GCGAGAAAGTGCGCGTCGCAGCTACACCAGCTCGTCAGTGAACAACTCGCCTCGCAC---
Branchiostoma_floridae|6242         GCAGAAGTTGCCTCCGACGAACTGCACCGATATCTCATAGAGGAGGTAGCCAAGTTTGAT
Nematostella_vectensis|23553        GCAGGCACTTCTGCGAAAACGTTTCCCGAGGTTTTAGCAAGGAAAGTG---------GAA
Xenopus_tropicalis|11325            GCCTGCACAATGGCTAGGGAATTTCCTACTCTATTTCTAGGCCAGCTTTTGAATTTGGAT
Gallus_gallus|8502                  GCAGAAACAGTTGCAGCAGAGCTTCCACTTTTATTTCTTGACCAGCTTGCTCAAACAGAT
Monodelphis_domestica|32120         GCTGAAACCAGTGCAGCAGAACTCCATAAGTTTCTTCTGGAACAACTCTCTCAATATGAT
Macropus_eugenii|6140               GCTGAAACCACTGCTGTAGAACTCCCTAAATTTTTTCTGGACCAACTTGCTCAATATGAT
Dasypus_novemcinctus|15278          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|18147      GCAAACACTGCCCGAAAAGAACTCCCCATTTTACTTCTCGACCAACTTTCCAAGTTTGAT
Erinaceus_europaeus|17421           GCCGACTTGGCATCAACGGAACTCCCAGTTTTACTTCTCCATCAGCTTTCCAGGATTGAT
Sorex_araneus|2780                  GCAGATTTGACAGCAATGGAACTCCACATTTTACTTCTTCATCAACTTGCCCAATTTGAT
Mus_musculus|17846                  GCAGACCTGGCATCAAAGGAGTTTCAGGTTTTACTTCTCCATCAATTGTCTATACAGGAT
Rattus_norvegicus|35105             GCAGACCTGGCATCAAAGGAGTTTCAGGTTTTACTTCTCCATCAACTGTCTGTACAGGAT
Cavia_porcellus|486                 GCGGACTTGGTGTCTACAGAACTCCCAGTTTTGCTTCTCCACCAACTATCTAAGTTTGAT
Ochotona_princeps|11539             GCAGGCTTGGCAGCAACAGAGCTCCCAGTTTTGTTTCTCCATCAGCTGTCCAACTTTGAT
Bos_taurus|1081                     GCCGACTTGACCTCAATGGAACTCCCAGTTTTACTACTCCATCAACTTTCCAGACTTGAT
Myotis_lucifugus|11869              GCAGACTTCACATCCAAGGAACTCCCAGTTTTACTTCTCCATCAGCTTTCCGGATTTGAT
Procavia_capensis|10079             GCAGACTTGGCATCCATGGAACTCCCGGTTTTACTTCTCCATCAAATTTCCAGATTTGAT
Loxodonta_africana|16871            GCAGAGTTGGCATCAATGGAACTCCCAGTTTTACTTCTCCATCAAATTTCCAGATTTGAT
Spermophilus_tridecemlineatus|12389 GCAGACTTGGCATCAGCAGAGCTACCGATTTTACTTCTCCATCAACTTTCCAAATTTGAT
Tupaia_belangeri|9125               GCGGACTTAGCATCCATGGAACTTCCCATTTTACTTCTTCACCAACTTTCCAAATTGGAT
Vicugna_pacos|1326                  GCAGACCTGACATCCGTGGAATTCCCAGTTTTACTTCTCCATCAGCTCTCCACACTTGAT
Pteropus_vampyrus|14421             GCAGACTTGGCGTCAATAGAACTGCCAGTTTTACTTCTGCATCAACTTTCCAGATTTGAT
Canis_familiaris|13176              GCAAACCTGACATCAGTGGAACTCCCAATTTTATTTCTCCATCAGCTTTCCAGATTTGAT
Felis_catus|16327                   GCAGAGCTGACATCAGTTGAACTCCCAGTTTTACTTCTCCATCAACTTTCCAGATTCGAT
Equus_caballus|9313                 GCAGACTTGTCTTCAGTGGAACTCCCAGTTTTACTTCTCCATCAACTTTCCAGACTTGAT
Tarsius_syrichta|2954               GCAGAGTTGACGTCGAGGGAGCTCCCGGTGTTAATTCTCCATCAGCTTTCCCAGATTGAC
Callithrix_jacchus|11240            GCAGAACTTACATCAGTGGAACTCCCAGTTTTACTACTCCATCAGCTTTCCAAATTTGAT
Rhesus_macaque|23840                GCAGAGTTGACATCCATGGAACTCCCAGTTTTACTCCTCCATCAGCTTTCCAAATTTGAT
Pongo_abelii|19964                  GCAGAGCTGACATCAATGGAACTCCCAGTTTTACTTCTCCATCAGCTTTCCAAATTTGAT
Pan_troglodytes|25778               GCAGAGTTGACATCAATGGAACTCCCAGTTTTACTTCTCCATCAGCTTTCCAAATTTGAT
Gorilla_gorilla|11587               GCAGAGTTGACATCAATGGAACTCCCAGTTTTACTTCTCCATCAGCTTTCCAAATTTGAT
Homo_sapiens|61131                  GCAGAGTTGACATCAATGGAACTCCCAGTTTTACTTCTCCATCAGCTTTCCAAATTTGAT
                                    .                     .           .           .             

Nematostella_vectensis|8224         ------------ACAGACCTTACTAAGACCGAC------------------TTTAAGACG
Branchiostoma_floridae|6242         CCGGATGTCGTCTACGATCGCCCAGATGACCTGCAACACCCCGAAGACTACTTAAACTTG
Nematostella_vectensis|23553        TCTGTT------TATCGCCCAGGACTGGCCTCTGAGGGAGTGGATGCTAAAATAACGACG
Xenopus_tropicalis|11325            CCATCC------TATACAATTACTGACAAAGAAAAACGCTTTCTTGATTCATTGGATACA
Gallus_gallus|8502                  CCCTCC------TGTAGAATGACCAAGGAGGAACAGCAAATTCTAGACTCTTTTGCCACA
Monodelphis_domestica|32120         CCTTCT------TATAAGATGACCAGCAAACAACAAAAATTTGTCCATTCTTTCAATACG
Macropus_eugenii|6140               TCTTCC------TATAGGATGACCAAGAGAGAAAAAAGATTTGTCCATTCTTTTGACACA
Dasypus_novemcinctus|15278          NNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|18147      TCTTCC------TACCAAATGACCAAAGAGGATCAACAAATGATAGATTCATTTGACACA
Erinaceus_europaeus|17421           CCTTCC------TACCAAATGACCCTTGAAGAGCAAAATCTAATCAATTCCTTTGGCACA
Sorex_araneus|2780                  CCTTCT------TACCAAATGACCCTCCAAGAACAAGAGGTGATCAATTCCTTTTGCACG
Mus_musculus|17846                  CCTTCC------TACCAAATGACAGCTGAGCAGAAGCAACTCATCAATTCCTTTGACACG
Rattus_norvegicus|35105             CCTTCC------TACCAGATGACAGCCGAGCAACAGGATCTCATCAATTCCTTTCACACG
Cavia_porcellus|486                 CCGTCT------TACCAAATGACCCCAGAACAGCAGCAAGTAATTGATTCCTTTCATAGC
Ochotona_princeps|11539             CCATCC------TACCAGATGACGCAAGAGCAACAAAAAATGATCCATTCCTTTCATACT
Bos_taurus|1081                     CCTTCC------TACCAGATGACTTCAGAAGAGCAAAAAGTAATCAATTCTTTCAACACA
Myotis_lucifugus|11869              CCATCC------TACCAAATGACCCCCGAAGAGCAAAAATTAATCAATTCCTTCCACACG
Procavia_capensis|10079             CCCTCC------TACCAAATGACCCCTGAACAGCAAAAGGTAATCGATTCTTTCCACACA
Loxodonta_africana|16871            CCCTCC------TACCAAATGACCCCTGAACAGCAAAAACTAATCGATACTTTTCACACG
Spermophilus_tridecemlineatus|12389 CCTTCC------TACCAAATGACGACTGAACAGCAAGAAATCATCAATTCCTTCCACACT
Tupaia_belangeri|9125               CCTTCC------TACCAAATGACACCGGAAGAGCAACAGGTCATCAATTCCTTCCACACG
Vicugna_pacos|1326                  CCTTCC------TACCAAATGACCTCTGACGAGCAAAGCACAATCGATTCCTTCCACACG
Pteropus_vampyrus|14421             CCTTCC------TACCAAATGACCCCTCAGGAGGAAAAACTAATCAGTTCTTTTCATACA
Canis_familiaris|13176              CCTTCC------TACCATATGACTTCTGAAGAGCAAAATGTAATCAATTCCTTTCTCACA
Felis_catus|16327                   CCTTCC------TACCAAATGACCCCTGAAGAGCAAAACATAATCGAATCCTTTCACACC
Equus_caballus|9313                 CCTTCC------TACCAAATGACCCCTAAAGAGCAAAAAGTAATCGATTCCTTTCACACA
Tarsius_syrichta|2954               CCTTCC------TACCAAATGACACCTGCAGAGTGGCAAATCGTCGATTCTTTTCACACC
Callithrix_jacchus|11240            CCTTCT------TACCAAATGACAGCTGATGAGCAACAAATAATCAATTCCTTTTGCACT
Rhesus_macaque|23840                CCTTCT------TACCAAATGACAACTGATGAGCAACAAATAATCAATTCCTTTTACACT
Pongo_abelii|19964                  CCTTCT------TACCAAATGACAACTGATGAGCAACAAATAATCAATTCCTTTTACACT
Pan_troglodytes|25778               CCTTCT------TACCAAATGACAACTGATGAGCAACAAATAATCAATTCCTTTTACACT
Gorilla_gorilla|11587               CCTTCT------TACCAAATGACAACTGATGAGCAACAAATAATCAATTCCTTTTACACT
Homo_sapiens|61131                  CCTTCT------TACCAAATGACAACTGATGAGCAACAAATAATCAATTCCTTTTACACT
                                                                                        .       

Nematostella_vectensis|8224         GCATTTAGGCGATCC------------TACGCGCGTTTC------------CAAGAACTA
Branchiostoma_floridae|6242         ACGGACAAAGATGAGACAGCAGTGACATATCGTAGCGTCAACCAAGATGGCGAAACAGCT
Nematostella_vectensis|23553        GCGCTAAGAGAAACT------------TACGAAGACGTG---------------------
Xenopus_tropicalis|11325            GTTTTTAAAGATCAC------------TACAAGGACGCA------------GAAAAACAT
Gallus_gallus|8502                  GTAATCACAGAAGAC------------TACAGGAAAAAG------------GAGAGAATT
Monodelphis_domestica|32120         GTCTTTAGGCGGGAC------------TACAGGACGCAA------------GAATACCAC
Macropus_eugenii|6140               GTGTTTAAGGAGGCT------------TACAGGAGACAA------------GAATACTTG
Dasypus_novemcinctus|15278          NNNNNNNNNNNNNNN------------NNNNNNNNNNNN------------NNNNNNNNN
Ornithorhynchus_anatinus|18147      GTCATTACTGCTGAA------------TTCAGGAAACTG------------GAAGACATT
Erinaceus_europaeus|17421           GTCTTTAAGGAACAC------------TACACAGCCACC------------GAAGATTTC
Sorex_araneus|2780                  GTGTTTAAAAAAGAA------------TACACGTGCATA------------GAAGAACTC
Mus_musculus|17846                  GTGTTCAGGGAGGAA------------TACAGAGCCAGA------------GAAGAGGCC
Rattus_norvegicus|35105             GTGTTCAGGGAAGAA------------TACAGAGCCAGA------------GAAGAGGCC
Cavia_porcellus|486                 ATCTTTAGAGAGGAC------------TATACAGCAACA------------GAAGCCCTC
Ochotona_princeps|11539             GTGTTCAGGAAAGAA------------TACACAGCCCTT------------GAAGATCTC
Bos_taurus|1081                     GTGTTTAGTGAAGAC------------TACAGAGCTATA------------GAAGAGTCT
Myotis_lucifugus|11869              GTGTTTAGGGAAGAG------------TACATCGCTCTA------------GAAAGCCTC
Procavia_capensis|10079             GTATTTAAGGAAGAA------------TACATCAGAATA------------GAAGACCGC
Loxodonta_africana|16871            GTGTTTAAGGAAGAA------------TACAGGAAAATA------------GAAGACCGC
Spermophilus_tridecemlineatus|12389 GTGTTTAGAGAAGAA------------TACACGGCAATA------------GAAGATCTC
Tupaia_belangeri|9125               GTGTTTAGAGAAGAG------------TACACAGCAATA------------GAAGACTTT
Vicugna_pacos|1326                  GTGTTCAGGGCAGAC------------TACACGGCTGTA------------GAAGACCTC
Pteropus_vampyrus|14421             GTATTTAGGGAAGAA------------TACAGAGCTATA------------GAAAACTTC
Canis_familiaris|13176              GTATTTAGGGAAGAA------------TACATAGCCAAA------------GAAGAACTT
Felis_catus|16327                   GTGTTTAGAGAAGAA------------TACATAGCTATA------------GAAGAACTT
Equus_caballus|9313                 GTGTTTAGGGAAGAA------------TACACAGCTATA------------GAAGACTTT
Tarsius_syrichta|2954               GTGTTCAGAGAAGAC------------TACACAGTGGCC------------GAAGACCTC
Callithrix_jacchus|11240            GTGTTTAGAGAAGAA------------TACACAGCAATA------------GAAGACCTC
Rhesus_macaque|23840                GTGTTTAGAGAAGAA------------TACACGGCAATA------------GAAGATCTC
Pongo_abelii|19964                  GTGTTTAGAGAAGAA------------TACACAGCAATA------------GAAGACCTC
Pan_troglodytes|25778               GTGTTTAGAGAAGAA------------TACACAGCAATA------------GAAGACCTC
Gorilla_gorilla|11587               GTGTTTAGAGAAGAA------------TACACAGCAATA------------GAAGACCTC
Homo_sapiens|61131                  GTGTTTAGAGAAGAA------------TACGCAGCAATA------------GAAGACCTC
                                                               .                                

Nematostella_vectensis|8224         CTACGAACC---------------------------------------------------
Branchiostoma_floridae|6242         CGGTCTACAAAAACAGGTGAGCAGGCCACGGTACCCAGTGATCCGTACACGGAGGACGTA
Nematostella_vectensis|23553        ------------------------------------------------------------
Xenopus_tropicalis|11325            TTTTCATCC---GCTTTGTATGAAAAAGCATCAAGTGAAATGGATATA---AAAGCAATC
Gallus_gallus|8502                  TTCTCTGAC---AGACAGGAGAACAAGACCCATAAGACAAATACTTAT---GAATGGATT
Monodelphis_domestica|32120         TTTTCTTCC---------------CAGAGGAAAAGTAACTGTTCCTAT---GAGCTGGTC
Macropus_eugenii|6140               TTTTCTTCC------------AAAAGAGAAATATTAACATGTGATTAT---GAGTGGATA
Dasypus_novemcinctus|15278          NNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNN
Ornithorhynchus_anatinus|18147      TTCTCTTCAGAAGTGGGAAGGAGGGAATCACTGAAGAAGAGTGGTTAC---GAATGGCTC
Erinaceus_europaeus|17421           TTTACAAAG------AAAGTGATCAAAGCACCACCAGCAGGTGAGTAC---GAGAGCATA
Sorex_araneus|2780                  TTCTCGACA---------AAGGAAAGGACAGAAAAGAGGTGTGGGTAC---ACGAAGATA
Mus_musculus|17846                  TTCTCTTCC---ACATACAAAACCTTCAGAACTAGTAGACGGGAGTAT---GAGGATACA
Rattus_norvegicus|35105             TTCTCTTCC---ACATATAAAACCTTCAGAACCAATAAACGGGAGTAT---GAGGATGTA
Cavia_porcellus|486                 TTCTCTTCT---CCAAAGACAACCACAAGCGCAAACAGTTGTAATTAC---GAGCATATA
Ochotona_princeps|11539             TTCTCTTCC---ACTCACAAAAGGACGAGAGGGCTGAAGAACGACTAT---GAGAACATA
Bos_taurus|1081                     TTCTCCTCC---AAAAAGAAAAGGACAAAAGGAATGAAAAGCGTGTAT---GAGAACATA
Myotis_lucifugus|11869              TTCTCTGTA------AGCAAACAAACAACAGAATCATGGTGTGAGCAT---GAGAGCATA
Procavia_capensis|10079             TTCACTTTC---AGTTCTAGAAAGACAAAAGCACTTCACGGTGAGTTT---GAGGCCATA
Loxodonta_africana|16871            TTCTCTTTC---ATTCCCCAAAAGACAAAAGCATTGCACGGTGAGTTT---GAGGCCATA
Spermophilus_tridecemlineatus|12389 TTCTCCTCC---ATATACAAAAAGCCAAGAGCATTGAAGTATGAGTAC---GAGGACACA
Tupaia_belangeri|9125               TTCTCTTCC---ATGCACAAAAGGACAAGAATGCCGAGCTGTGAGTAT---GAGGGCATA
Vicugna_pacos|1326                  TTCTCCAGA------AAGAGAAAGACAAGAGAGTTGAAAGGGGAGTAT---GAGAAGATA
Pteropus_vampyrus|14421             TTCTCTGAG------AAGAAAAGGACAAAAGAGTTGATGTGTGAGTAT---GAGAACATA
Canis_familiaris|13176              TTTTCCTCC---ATAAAGAAAAGGAGAAAAACAGGGAAATGTGAGTAT---GAGAACATA
Felis_catus|16327                   TTCTCCTCC---ATAACGAAAAAGACAAAAACACTGAAATGTGAGTAT---GAGAACATA
Equus_caballus|9313                 TTCTCTGCC---ATAAAGAAAAGAGCAAAAGTGTTGACGTGTGAGCAT---GAGAACATA
Tarsius_syrichta|2954               TTTTCTTCC---------GTAAACAAAAGGGCAAGAGCAAGCGAGTAT---GAGGACACA
Callithrix_jacchus|11240            TTTTCTGCC------ATAAACAAAACAGATGCAGTGAGATGTGAGTTT---GAGGACATA
Rhesus_macaque|23840                TTTTCTGCC------ATAAACAAAACAGAAGCAGTGAGGCGTGAGTAT---GAGGACATA
Pongo_abelii|19964                  TTTTCTGCC------ATAAACAAAACAGAAGCAGTGAGGTGTGAGTAT---GAGGACATA
Pan_troglodytes|25778               TTTTCTGCC------ATAAACAAAACAGAAGCAGTGAGGTGTGAGTAT---GAGGACACA
Gorilla_gorilla|11587               TTTTCTGCC------ATAAACAAAACAGAAGCAGTGAGGTGTGAGTAT---GAGGACACA
Homo_sapiens|61131                  TTTTCTGCC------ATAAACAAAACAGAAGCAGTGAGGTGTGAGTAT---GAGGACACA
                                                                                                

Nematostella_vectensis|8224         ---------------------------------------------AGGACAGAAGACGAG
Branchiostoma_floridae|6242         GCGACAGCGTTCAGGCGGGCACACCAGCAGACGGACTGGGTCCTGACTCGCGGGAGGGAC
Nematostella_vectensis|23553        ---------------------------------GATCGAATCTTACTTTATGGAGTGGAT
Xenopus_tropicalis|11325            CATATAGCATACGCAAAAGCCTTCTGGCGAATGGACAGAATTTTACAACTAGGAAGGAAA
Gallus_gallus|8502                  CACAAAGCATATGCCAAGGCCTTCTGGAGAATGGACAGACTTTTACAGCTAGGAAGGAAT
Monodelphis_domestica|32120         CATAAGGCCTTTGCCAAAGCTTTCTGGAGGATGGATAGAGTTCTGAAACTTGGGAGGCAG
Macropus_eugenii|6140               CATAGGGCTTTTGCTAAAGCTTTCTGGAGGATGGATAGAGTTTTGAAACTTGGGAGGCAG
Dasypus_novemcinctus|15278          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|18147      CATAAAGCCTTTGCTAAATCCTTCTGGAGAATGGACAGACTTTTACGACTAGGAAGGAAG
Erinaceus_europaeus|17421           CACAAAGCCTTTGCCAAAGCATTTTGGAGGATGGACAGACTTTTACGTCTAGGAAGAAAA
Sorex_araneus|2780                  CACAGTGCCTTTGCAAAAGCATTTTTGAGGATGGATAGGCTTTTACGTCTTGGAAGGAAA
Mus_musculus|17846                  CACAAAGCCTTTGCAAAGGCATTTTGGAGAATGGATAGGCTTCTACGGCTTGGAAGGAAT
Rattus_norvegicus|35105             CACAAAGCGTTTGCCAAGGCATTCTGGAGAATGGATAGGCTTCTACGGCTGGGAAGGAAC
Cavia_porcellus|486                 CAGAAGGCCTTTGCAAAAGCGTTTTGGAGGATGGATAGACTCTTACGTCTTGGAAGGAAA
Ochotona_princeps|11539             CACAAAGCCTTTGCAAAAGCATTTTGGAGAATGGATAGACTGTTACGTCTCGGCAGGAAT
Bos_taurus|1081                     CACAAAGCCTTTGCCAAAGCGTTCTGGAGAATGGACAGGCTTTTACGTCTTGGAAGGAGG
Myotis_lucifugus|11869              CACAAAGCCTTTGCCAAAGCATTTTGGAGAATGGATAGGCTTTTACGTCTTGGAAGGCAA
Procavia_capensis|10079             CATAAAGCCTTTGCAAAAGCGTTCTGGAGAATGGATAGGCTGTTACGTCTTGGAAGAAAT
Loxodonta_africana|16871            CATAAAGGCTTTGCAAAAGCTTTCTGGAGAATGGATAGGCTTTTACGTCTTGGAAGGAAA
Spermophilus_tridecemlineatus|12389 CACAAAGCATTTGCAAAAGCGTTTTGGAGAATGGATAGGCTTTTACGTCTTGGAAGGAAT
Tupaia_belangeri|9125               CACAAAGCCTTTGCAAAAGCGTTTTGGAGAATGGATAGGCTTTTACGTCTTGGAAGAAAA
Vicugna_pacos|1326                  CACACAGCCTTTGCAAAAGCGTTTTGGAGGATGGACAGGCTGTTACGTCTCGGGAGGAAA
Pteropus_vampyrus|14421             CACAAAGCCTTTGCAAAAGCATTTTGGAGAATGGATAGGCTTTTACGTCTTGGAAGGAAA
Canis_familiaris|13176              CACAAAGCCTTTGCAAAAGCATTTTGGAGAATGGACAGGCTTTTACTTCTTGGAAGAAAT
Felis_catus|16327                   CACAAAGCCTTTGCAAAAGCATTTTGGAGAATGGACAGGCTTTTACGTCTTGGAAGGAAA
Equus_caballus|9313                 CACAGAGCCTTTGCAAAAGCATTTTGGAGAATGGATAGGCTTTTACGTCTCGGAAGGAAA
Tarsius_syrichta|2954               CACAAAGCTTTCGCAAAAGCGTTTTGGAGAATGGACAGGCTCCTACGTCTCGGAAGAAAC
Callithrix_jacchus|11240            CACAAAGCCTTTGCAAAAGCATTTTGGAGAATGGATAGGCTTTTACGTCTTGGAAGAAAA
Rhesus_macaque|23840                CACAAAGCCTTTGCAAAAGCATTTTGGAGAATGGATAGGCTTTTACGTCTTGGAAGAAAA
Pongo_abelii|19964                  CACAAAGCCTTTGCAAAAGCATTTTGGAGAATGGATAGGCTTTTAGGTCTTGGAAGAAAA
Pan_troglodytes|25778               CACAAAGCCTTTGCAAAAGCATTTTGGAGAATGGATAGGCTTTTAGGTCTTGGAAGAAAA
Gorilla_gorilla|11587               CACAAAGCCTTTGCAAAAGCATTTTGGAGAATGGATAGGCTTTTAGGTCTTGGAAGAAAA
Homo_sapiens|61131                  CACAAAGCCTTTGCAAAAGCATTTTGGAGAATGGATAGGCTTTTAGGTCTTGGAAGAAAA
                                                                                       .        

Nematostella_vectensis|8224         GAGCGGTCGCGCAATAGGTGGAGCGGCTGCTCGGCGCTGACGTGTGTTGTGACTCCGAGC
Branchiostoma_floridae|6242         GAGCAGTCGCGCGTACGGTGGAGCGGGTGTTCAACGCTCACGTGCCTCGTACAGAGCACC
Nematostella_vectensis|23553        GAGGACTCGCGGAATCGGTGGAGTGGGTGTTCTGCTGTGACATGCCTGCTTAGAGGAAAC
Xenopus_tropicalis|11325            GAATCATCAAGAGCAATATGGAGTGGTTGTTCCTCGGTTTCTTGTTTATTTGATGGATTT
Gallus_gallus|8502                  GAGGTTTCTAGAGTTCGATGGAGTGGCTGTTCAGTTGTAACCTGTTTGATGGAAAGACTC
Monodelphis_domestica|32120         GAAATGTCCTCTTTCTACTGGAGTGGCTGTTCAGCGGTCACCTGTTTGCTGGAATGTGAT
Macropus_eugenii|6140               GAAGTATCCAATTTCTACTGGAGCGGCTGTTCAGCAGTTGCCTGTTTACTGGAATGCGAT
Dasypus_novemcinctus|15278          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|18147      GAAGTCTCCAGGGTCCGCTGGAGCGGTTGTTCGTGTGTCATCTGCTTATTAGAATCTAAC
Erinaceus_europaeus|17421           GAAGTCTCCAGGGTTCAGTGGAGTGGCTGCTCTGCAGTTACTTGCATTCTGGAAGACAAG
Sorex_araneus|2780                  GAAGAATCCAAGTTCCGGTGGAGTGGCTGTTCAGCTCTTGCCTGTGTACTAGAAGGAAAT
Mus_musculus|17846                  GAGACTTCCCGGGTTCGCTGGAGCGGCTGCTCGGCACTCACTTGTATATTAGAGGGTGGG
Rattus_norvegicus|35105             GAGGTCTCCCGGGTTCGGTGGAGCGGCTGTTCAGCACTCACGTGTATATTAGAGGGTGGG
Cavia_porcellus|486                 GAAACCTCCAGGGTTCTGTGGAGTGGCTGCTCTGTACTTACTTGTATGCTGGAAGGCAAA
Ochotona_princeps|11539             GAGGTGTCCAGGGTTCGATGGAGCGGCTGTTCTGCCGTGACCTGTATACTGGAGGGCAGC
Bos_taurus|1081                     GAAGCGTCCAGGGTCCGATGGAGTGGCTGTTCCGCAGTCACTTGCATACTGGAAAGCAGT
Myotis_lucifugus|11869              GAAGTATCCAGGGTTCGATGGAGTGGCTGTTCTGCAGTTGCCTGTATATTGGAAGGCAAA
Procavia_capensis|10079             GAGGCATCCAACATTAAATGGAGCGGCTGTTCTGCTCTTATCTGTATATTGGAAAGCAGT
Loxodonta_africana|16871            GAAGTGTCCAGAGTTCAATGGAGTGGCTGTTCTGCAGTTACTTGTATATTGGAAGGCAAC
Spermophilus_tridecemlineatus|12389 GAAGTTTCCAGGGTCCGATGGAGTGGCTGTTCTGCAGTTACTTGTATATTGGAAGGCAGC
Tupaia_belangeri|9125               GAAGCGTCCAGGGTTCTATGGAGTGGTTGCTCTGCAGTTACTTGTATACTGGAAGGCAAA
Vicugna_pacos|1326                  GAAGCCTCCAGGGTTCGATGGAGTGGCTGTTCTGCGGTGACCTGTCTGTTGGAAGGCAAC
Pteropus_vampyrus|14421             GAAGTATCCAGGGTTCGATGGAGTGGCTGCTCTGCGGTTACTTGTATATTGGAAGGCAGC
Canis_familiaris|13176              GAAGTGTCCAGGGTTCGATGGAGTGGCTGTTCTGCAGTTACTTGTATATTGGAAGGCAAT
Felis_catus|16327                   GAAGTATCCAGGGTTCGATGGAGTGGCTGTTCTGCAGTTACTTGTATACTGGAAGGCAAC
Equus_caballus|9313                 GAAGTATCCAGGGTTCGATGGAGTGGCTGTTCTGCAGTTACTTGTATATTGGAAGGCAAC
Tarsius_syrichta|2954               GAAGTTTCCAGGGTTCGATGGAGTGGCTGCTCCGCTGTGACGTGCATCTTAGAAGGTAAC
Callithrix_jacchus|11240            GAAGTGTCCAGGGTTCAATGGAGTGGCTGCTCTGCAGTTACCTGTATATTGGAAGGCGAA
Rhesus_macaque|23840                GAAGTGTCTAGGGTTCAATGGAGTGGCTGCTCTGCAGTTACTTGTATATTGGAAGGCAAA
Pongo_abelii|19964                  GAAGTGTCCAGGGTTCAATGGAGTGGCTGCTCTGCAGTTACTTGTATATTGGAAGGCAAA
Pan_troglodytes|25778               GAAGTGTCCAGGGTTCAATGGAGTGGCTGCTCTGCAGTTACTTGTATATTGGAAGGCAAA
Gorilla_gorilla|11587               GAAGTGTCCAGGGTTCAATGGAGTGGCTGCTCTGCAGTTACTTGTATATTGGAAGGCAAA
Homo_sapiens|61131                  GAAGTGTCCAGGGTTCAATGGAGTGGCTGCTCTGCAGTTACTTGTATATTGGAAGGCAAA
                                    .     .           ... . .. .. .      .    ..  .  .          

Nematostella_vectensis|8224         ------------------------------------------------------------
Branchiostoma_floridae|6242         AACATGGAGGAGGTGTCAGATGATGAA---------------------ACGGATGAGGTG
Nematostella_vectensis|23553        ------------------------------------------------------------
Xenopus_tropicalis|11325            ------------------------------------------------GCAGATGCTAAA
Gallus_gallus|8502                  ------------CCCAGTGAAAATATGGATGAC---------------ACAGAAGAAAGA
Monodelphis_domestica|32120         ---GCACACAGTTCTTCTTCCTCTTTGGAAAGT---------------ACCAGTAGTAAT
Macropus_eugenii|6140               ------GAACATTTTGCTAGTAGTACCTCTTGG------------------------CAT
Dasypus_novemcinctus|15278          ---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------------NNNNNNNNN
Ornithorhynchus_anatinus|18147      AGGGTTAAGGATGATACTGCTGCTGTAAGTATCTCATCTAAGGTGGAAGAAAAATCAACC
Erinaceus_europaeus|17421           ---ACTAAAAATCCCACTGTGAAGAGGAGTTGG---------------AAAAAATCCATT
Sorex_araneus|2780                  ---ATTAAACACCCCAGTGTTACCATGAATTTG------------------------AGA
Mus_musculus|17846                  ---ATTAAGAACCCACATGCTAATAAAGACTGG---------------GAAAAAACCTAT
Rattus_norvegicus|35105             ---ATCAAGAACCCACAGGCTACTAAGGACTGG---------------GAAAAAACCTAT
Cavia_porcellus|486                 ---ATTAAATATCCTTATGTCAATATGAATTGG---------------AGAAAAATCAAC
Ochotona_princeps|11539             ---ATTAAGAATCCTCACGTGCAAAGGAGTTGG---------------AAAGGAAGCAGT
Bos_taurus|1081                     ---GTTGAGAGTCCCGAAGCCAGGAGGTCTTGG---------------GGAAGAATCAGT
Myotis_lucifugus|11869              ---ATCACAAGTTCCCATGACAAGAAGAAT------------------CAGAGACCCACT
Procavia_capensis|10079             ---GTTAAAAGTCTTCATCTTAATAACTACTGG---------------AGAAAACAACAT
Loxodonta_africana|16871            ---ATTAAAAGTCTCCATGCTCATAACCATTGG---------------AGAAGAAAACAT
Spermophilus_tridecemlineatus|12389 ---ATTAAAAATCCTCATGTTAATAAGAATTGG---------------AAAGGAACCAAT
Tupaia_belangeri|9125               ---AGTAGAGGTCTTTACGCTACCAGGAACTGG------------------AGAACCAGT
Vicugna_pacos|1326                  ---GTTAAAAATCCCTATGCTGAGAGGAGTTGG---------------AGAAGGATGGGC
Pteropus_vampyrus|14421             ---ATTAAATATCCCTATGCCAAGAAA---TGG---------------AGAAAAACCAAT
Canis_familiaris|13176              ---ATTAAAACACCCTATACTAAGAAGAATTGG------------------AGAATCAGT
Felis_catus|16327                   ---ATTAAAAATCCCTATGCTGAGAAG------------------------AGAATCCAT
Equus_caballus|9313                 ---ACTGAAAATCCCCTTGCC---AAGAACTGG---------------AGAAGAACCAAT
Tarsius_syrichta|2954               ---ATTAAATGTCCTTATGCTCCCAAGAAC------------------CAGAGGACAAGC
Callithrix_jacchus|11240            ---CCTAAAAGTCCTTAT------AAGAACTGG---------------AGAAGAACAAAT
Rhesus_macaque|23840                ---CCTAAAAGTCCTTATGCTCATAAGAATTGG---------------AAAAGAAAAACC
Pongo_abelii|19964                  ---CCTAAAAGTCCTTATGCTCATAAGAATTGC---------------AAAAGAAAAAAT
Pan_troglodytes|25778               ---CCTAAAAGTCCTTACGCTCATAAGAATTGG---------------AAAAGAAAAAAT
Gorilla_gorilla|11587               ---CCTAAAAGTCCTTATGCTCATAAGAATTGG---------------AAAAGAAAAAAT
Homo_sapiens|61131                  ---CCTAAAAGTCCTTATGCTCATAAGAATTGG---------------AAAAGAAAAAAT
                                                                                                

Nematostella_vectensis|8224         ------------------------------------------------------------
Branchiostoma_floridae|6242         AAGACAACAAGAACAAATCCTTCCACTGTGGAAAAGGACCTGCCACAGGAG---AAAGGG
Nematostella_vectensis|23553        ------------------------------------------------------------
Xenopus_tropicalis|11325            AGTAGTCAAAAAGAAGCGCAGTTACTGGGATCGACACAAGAACACAAACGTAGGCTTGGA
Gallus_gallus|8502                  AAACACTTGGAAAACAGCAGTCAAAGTTCATTAACGAGGACAACTGAGGATGTTGCTGGG
Monodelphis_domestica|32120         TCAGAAGAAGGTTTAGATGAA---------------------------------ACTGGA
Macropus_eugenii|6140               CAGAAATGGAAATGGAAGAAAGAAGAGTTTTCAATTTTCCAAACATTGAAAGCAACTGGA
Dasypus_novemcinctus|15278          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|18147      GATTTTTATGAAGACTTGATCTGTTCCCAGTCAGAGCAAGAATGCAAAAGTATTAACGGA
Erinaceus_europaeus|17421           GACAACCGTGGTCTT---------------TTCAAAAGGACATCACAAATACTTTCCGGA
Sorex_araneus|2780                  GGAAATGACACACATGCAGAGAACTTTGCTTCTGGGAAGATGCCTCAAGTAATTTCTGGA
Mus_musculus|17846                  CAGCAGGGT------TCCACCAGTCTTCCCTTCCAGAAGACTCCACAGATCATATCTGGA
Rattus_norvegicus|35105             CAGCATGGT------GTTAACAGCTCTCCCTTCCAGAAGATTCCCCAGATCATCTCTGGA
Cavia_porcellus|486                 AGC---GATAAACTGGCAGAGAACTTCCCCTCCCAGATGGTGCCACAAGTAATTGCTGGA
Ochotona_princeps|11539             AACCATGATGAGCCGGCTGACAGCTCCTCTTCTCCGACGATGCCACAGCTAGTTTCTGGA
Bos_taurus|1081                     GACCTTGCTGCTTTGGCAGATAGGCACCTTTTCCCGGGGATGCCCCAAATCACCACTGGG
Myotis_lucifugus|11869              GACCATGATGGTTTGCCAGAGAAGTTACCTTCTCAGAACTTGCCACAAATAATTTCTGGA
Procavia_capensis|10079             GTCCATGAGAGTTGGAGACAGAGTGCCCCTTTTAGAAAGAGGCCAGAAATAATTTCTGGA
Loxodonta_africana|16871            GGCCATGGGCATTTGTTGGAGAGTGCCCATTCTGGAAAGATGCCACAGATAATTTCTGGA
Spermophilus_tridecemlineatus|12389 AACTGGGATGGATTATCTAAGAACAACCCTTCCCAGATGATGCCACAAATAATTTCAGGA
Tupaia_belangeri|9125               AACTACGATACGCTGTCAGACAGCTCCTCTTCCCAGCTGATGGAACAAATGATTTCTGGA
Vicugna_pacos|1326                  GGCCGTGACGGTTTGGCAGACAGGTTCCCTTTCCAGGAGATGCCACAAGTCATTTCTGGA
Pteropus_vampyrus|14421             GATCATGATGGTTGGGCAGAGAGATTCCCTTCCCAGAAGATGCCACAAATAATTTCTGGA
Canis_familiaris|13176              AATGATGATGGCTTGCCAAAGAATTCCCCTTCCCAGGTGATGCCACAGATAATTTCTGGA
Felis_catus|16327                   AAGCGTGTTAGTGTGGCCGAGAGTTCC---TCCCAGNNNNNNNNNNNNNNNNNNNNNNNN
Equus_caballus|9313                 GACTACGGTGGTTTGGCAGAGAAGTTCTCTTCCCCAATAATGCCACAAATAATTTCTGGA
Tarsius_syrichta|2954               GACTGGGATGGATCGGCAGAGAGTTCCCCTTCCCAGAAGATGCCACAGATAATTTCTGGA
Callithrix_jacchus|11240            AACCATGATGGGTTGGCAGAGAGCTCCTCTTCCCAGGAGCTGCCAAAAATAATTTCTGGA
Rhesus_macaque|23840                AACCATGATGGATTGGCAGAGAGCTCCACTTCCCAGGAGATGCCACAAATATTTCCTGGA
Pongo_abelii|19964                  AACCATGATGGGTTGGCAGAGAGCTCCCCTTCCCAGGAGATGCCAAAAATAATTTCTGGA
Pan_troglodytes|25778               ACCCATGATGGGTTGGCAGAGAGCTCCCCTTCCCAAGAGATGCCAAAAATAATTTCTGGA
Gorilla_gorilla|11587               ACCCATGATGGGTTGGCAGAGAGCTCCCCTTCCCAGGCGATGCCAAAAATAATTTCTGGA
Homo_sapiens|61131                  ACCCATGATGGGTTGGCAGAGAGCTCCCCTTCCCAGGAGATGCCAAAAATAATTTCTGGA
                                                                                                

Nematostella_vectensis|8224         ACGTGCTATCTGTCGCACGTGGGGGACGTGGGCGCAATCCTTATACGCGAGGATGGCGTG
Branchiostoma_floridae|6242         GTCCTCTATGTTGCTAATGCAGGAAACACCCACGCTGTGTTGTGCCGC---GATGGAAAA
Nematostella_vectensis|23553        AAGCTTTATATTGCCAATGCGGGGAATGTGCGCGCAGTTTTGTGTAAGGGGGATGGCTCT
Xenopus_tropicalis|11325            GTGCTACATATAGCCAGTGTTGGT------------------------------------
Gallus_gallus|8502                  CTCCTGCACATTGCTAACATAGGTAACACACATGCAGTTTTATGTAAA---AATGGCAAG
Monodelphis_domestica|32120         ATATTACATGTTGCTAACGTGGGTAATGTACACGTAGTGTTATGCAAA---AATGGGAAA
Macropus_eugenii|6140               GTATTACATATTGCGAATGTT---------------------------------------
Dasypus_novemcinctus|15278          NNNNNNNNNNNNNNNNNNNNNNGAAATGTACAGGCAGTCTTATGCAGA---AATGGGATG
Ornithorhynchus_anatinus|18147      GTACTACACATTGCTAATACGGGTAATGTGCACGCAGTCTTATGCAGA---AACGGAAGA
Erinaceus_europaeus|17421           GTGCTGCATATCGCAAACACTGGTAACGTGGAAGCAGTCTTATGCAGA---AATGGGAAA
Sorex_araneus|2780                  GTGCTACATGTTGCAAACACTGGTAACGTTGAAGCAGTCTTATGTAGA---AATGGGAAA
Mus_musculus|17846                  GTACTACACCTGGCAAATGCTGGAAACGTGCAAGCAGTCTTATGCAGA---AATGGAAAA
Rattus_norvegicus|35105             GTACTACACATTGCAAATGCTGGAAATGTACAAGCAGTCTTATGCAGA---AATGGAAAA
Cavia_porcellus|486                 ATATTGCATATTGCAAACACTGGAAATGTGCAAGCAGTCTTATGCAGG---AATGGAAAA
Ochotona_princeps|11539             GTGTTACACATTGCCAACACTGGCAATGTGCAAGCAGTCTTGTGCAGA---AATGGAAAA
Bos_taurus|1081                     GTGCTACACATCGCAAATGCTGGTAATGTGCAAGCAGTCTTATGCAGA---AATGGGAAA
Myotis_lucifugus|11869              GAACTACATATTGCATACACT---------------------------------------
Procavia_capensis|10079             GTACTGCATGTTGCAAACGCCGGTAATGTGCAAGCAGTCTTATGCAGA---AATGGCAAA
Loxodonta_africana|16871            GTATTACATGTTGCAAACGTGGGTAACGTGCATGCAGTCTTATGCAGA---AATGGTAAA
Spermophilus_tridecemlineatus|12389 GTATTACACATTGCAAATGCTGGTAATGTACAAGCAGTCTTATGCAGA---AATGGGAAA
Tupaia_belangeri|9125               GTGTTACACATTGCAAACGCTGGTAACGTGCAAGCGGTCTTATGCAGA---AATGGGAAA
Vicugna_pacos|1326                  GTACTACACATTGCAAACACGGGTAACGTGCAAGCAATCTTATGCAGA---AATGGAAAA
Pteropus_vampyrus|14421             GTACTACATATTGCAAACACTGGTACTGTGGAAGCAGTCTTATGCAGA---AATGGAAAA
Canis_familiaris|13176              GTACTTCATGTTGCAAACACTGGTAATGTACAAGCAGTCTTATGCAGA---AATGGAAAA
Felis_catus|16327                   NNNNNNNNNNNNNNNNNNACTGGTAATGTACAAGCAGTCTTATGCAGA---AATGGAAAA
Equus_caballus|9313                 GTACTACATATTGCAAACACTGGTATTGTGCAAGCGGTCTTATGCAGA---AATGGGAAA
Tarsius_syrichta|2954               GTATTACACATTGCCAACACTGGTAATGTGCAAGCAGTCTTATGCAGA---AACGGGACA
Callithrix_jacchus|11240            ACATTACATGTTGCAAACACCGGTAATGTGCAAGCAGTCTTATGCAGA---AATGGGAAA
Rhesus_macaque|23840                ATATTACATGTTGCAAACACTGAT------------------------------------
Pongo_abelii|19964                  ATATTACATGTTGCAAACACTGGT------------------------------------
Pan_troglodytes|25778               ATATTACATGTTGCAAACACTGGTAATGTGCAAGCAGTCTTATGCAGA---AATGGGAAA
Gorilla_gorilla|11587               ATATTACATGTTGCAAACACTGGTAATGTGCAAGCAGTCTTATGCAGA---AATGGGAAA
Homo_sapiens|61131                  ATATTACATGTTGCAAACACTGGTAATGTGCAAGCAGTCTTATGCAGA---AATGGGAAA
                                              .                                                 

Nematostella_vectensis|8224         ACTAAGATCCTCACCAGAAAGCACGACTTGTATAATAAAAAGGAGCGCGATAGGGTGCGT
Branchiostoma_floridae|6242         ACTTATCGCATCACCAGGGACCACACCACATCCAACCCTCACGAGCGCAGCCGCGTCATA
Nematostella_vectensis|23553        ATGATTCGTCTCACTCAGGAACACACACCACGGAACAAAAGAGAGAGACACCGTGTGTCC
Xenopus_tropicalis|11325            ------------------------------------------------------------
Gallus_gallus|8502                  AGTTATCACCTCTCAGAAGAGCACAGCACTTCTAATGTAAGGGAGAAAAAACGCATACTT
Monodelphis_domestica|32120         GCCCATCTTCTTACAAAAGACCATACAACTCAAAGTGTAAGTGAAAGAGACCGTGTATTA
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          GATTTTTGCCTAACCAAAGAACATACTACACACAACTTAATGGAAAGAAGAAGGGTACTT
Ornithorhynchus_anatinus|18147      AGCTACTGCCTCACCAAAGAACACAGCACTCGAAGCCTAAGTGAAAGGAGACGGATCCTG
Erinaceus_europaeus|17421           GGTTTTTGCCTAACCAAAGATCACACCACACGAAACACAAGTGAACGGAGAAGAGTACTT
Sorex_araneus|2780                  GGCTTTTGCCTAACCAAAGAACATACTACACGAAACATCCATGAACGCAAAAGAGTTCTT
Mus_musculus|17846                  GGGTTTTGCCTGACCAAGGAACACAGTACACGAAACACCAAAGAAAGAAGAAGAGTCCTT
Rattus_norvegicus|35105             GGATTTTGCCTGACCAAGGAGCACACTACACGAAACACTAAAGAAAGAAGAAGAGTACTT
Cavia_porcellus|486                 GGATTTTGTCTCACCAAAGAACACACTACAGCAAACATCAGTGAAAGAAGAAGAGTACTT
Ochotona_princeps|11539             GGTTTTTGTCTGACCAAAGAACACACTACACGAAACACAAATGAAAGAAATAGAGTTCTT
Bos_taurus|1081                     GGCTTCTGCTTAACCAAAGAGCACAGCACGCGGAACCTGGACGAGAGGAGGCGGGTGCTC
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             GGTTTCTGCCTAACCAAAGAACATACTATGCAAAATAAAATGGAAAGAAGAAGAGTACTT
Loxodonta_africana|16871            GGTTTTTGCCTAACCAAAGAACACACTATCCAAAATGCAATGGAAAGGAGGCGAGTACTT
Spermophilus_tridecemlineatus|12389 AGTTTTTGCCTAACCAAAGAACATACTACTCGAAACATCAAAGAAAGAAGAAGAGTACTT
Tupaia_belangeri|9125               GGTTTCTGCCTAACCAAAGAACATACGACGCGAAACATAAATGAGAGGAGGAGAGTACTG
Vicugna_pacos|1326                  GGCTTTTGCCTAACCAAAGAACACACCATGCAAAACATAAATGAAAGAAGAAGAGTACTT
Pteropus_vampyrus|14421             GGCTTTTGCCTAACCAAAAAACATAACATGCAAAACGTCAATGAAAGAAGAAGAGTACTT
Canis_familiaris|13176              GGCTTTTGCATAACCAAAGAACACACTACGAGAAACATAACTGAAAGAAGAAGATTACTT
Felis_catus|16327                   GGCTTTTGCATAACCAAAGAACACACCACGCGAAACATAACCGAAAGAAGAAGGTTACTT
Equus_caballus|9313                 AGCTTTTGCCTAACCAAAGAACACACTACGCGAAACATAAGTGAAAGAAGAAGAGTACTT
Tarsius_syrichta|2954               GGATTTTGCCTAACCAAAGAGCATACCACACGAAACACGCAAGAAAGACGACGAGTACTT
Callithrix_jacchus|11240            TGTTTTTGCCTCACCAAAGAACATACTACACGAAACACAAATGAAAGAAGAAGAATACTT
Rhesus_macaque|23840                ------------------------------------------------------------
Pongo_abelii|19964                  ------------------------------------------------------------
Pan_troglodytes|25778               GGTTTTTGCCTAACCAAAGAACATACTACACGAAACACAAATGAAAGAAGAAGAATACTT
Gorilla_gorilla|11587               GGTTTTTGCCTAACCAAAGAACATACTACACGAAACACAAATGAAAGAAGAAGAATACTT
Homo_sapiens|61131                  GGTTTTTGCCTAACCAAAGAACATACTACACGAAACACAAATGAAAGAAGAAGAATACTT
                                                                                                

Nematostella_vectensis|8224         AAGTCCAGCGGCGTGATCGTTAAGACTGAAAAATGCGCGCTT---GTTAATGGGGCACTT
Branchiostoma_floridae|6242         CGCACCGGGGGCACCATTACCGGCAGCAAGAAACATGGCCGC---ATCTTCGGCACCATG
Nematostella_vectensis|23553        AAGTATGGGGAGGTTTACAAAAGT---GAAAAGACAGCTCTA---GTGAATGGGCTTACA
Xenopus_tropicalis|11325            ------------------------------------------------------------
Gallus_gallus|8502                  CAGAATGATGGAAACATCAGCACTAATGAACCAGATGGATTA---GTAGAGGGTCACCTT
Monodelphis_domestica|32120         AGTAGAGGAGGAAAAATCAGCACCAATGAACCAACTGGATTC---ACTGAAGAGACTGTG
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          AAGGATGGTGCAATGATTAGTTCAAATGAACCAGGTAGGATCTCTCTAGAAGGGCAAATG
Ornithorhynchus_anatinus|18147      GGAGCTGGAGGATCAATCAGTCCAAACGAACCAACGGGACTA---ACGGAAGGGATCATC
Erinaceus_europaeus|17421           CAGAGTGGAGCCACAATCAGTTCAAATGAACCACACGGGCTC---CTAGAAGGGCAAATA
Sorex_araneus|2780                  GAGAAGGGAGCTGTAATTAGCTCAAATGAACCATATGGACTC---ATAGAAGGACAAGAA
Mus_musculus|17846                  TACAGCGAAGCAGTGATCAGTTCAGATGACCCCTATGGCCTC---CTGGATGGGCACATC
Rattus_norvegicus|35105             TACAGCGAAGTAGGGATCAGTTCAGATGACCCCTATGGTCTC---CTGGATGGGCACATA
Cavia_porcellus|486                 CAGAATGGAGCACTAATTACTTCAAGTGAACCATATGGTCTC---TTGGAAGGGTACATA
Ochotona_princeps|11539             CAGAATGGAGCAGTAATTACTTCAAATGAACCATACGGGCTC---CTAGAAGGAGAAATA
Bos_taurus|1081                     CGGCAGGGTGCGGTCATCAGCGCCAACGCACCGCACGGCCTC---CTCCAGGGGCAGACG
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             CAGAATGGAGCAACTGTGACTTCAGGTGAATCAGATGAGCTC---CTAGAAGGGCAAATG
Loxodonta_africana|16871            CATAATGGAGCAATAATTAATTCAAATGAACCAAATGGGTTC---CTCGAAGTGCAAACA
Spermophilus_tridecemlineatus|12389 CAGACTGGAGCAGTAATCAGTTCAAACGAACCGTATGGGCTC---CTAGAAGGGCAAATA
Tupaia_belangeri|9125               CAGAACGGCGCAATGATTAGTTCGAATGAACCCTACGGGCTC---CTCGAAGGACAAGTG
Vicugna_pacos|1326                  CAGAACGGAGCAGTAAGTAGCTCAAATGAACCGTATGGGCTT---GTAGAAGAGCAAATA
Pteropus_vampyrus|14421             AAGAAAGGAGCAATAATTAGTTCAAATGAATCAGATGGGCTC---CTAGAAGGGCAAATA
Canis_familiaris|13176              AAGAATGGAGCAATAATTAGTTCAAATGAACCATATGGGCTC---CTAGAAGGGCAAATA
Felis_catus|16327                   CAGAATGGAGCGATGATTAGTTCAAATGAACCACATGGGCTC---CTAGAAGGGCAAATA
Equus_caballus|9313                 CAGAGGGGAGCAATGATTAGTTCAAGG---------------------------CAAACA
Tarsius_syrichta|2954               CAGAACGGAGCAGTGATTAGTTCAAGTGAACCTCATGGGCTC---CTGGAGGGGCAAGTG
Callithrix_jacchus|11240            CAGAATGGAGCAGTCATTAGTGCAAATGAACCATATGGGCTG---GTAGAAGGGCAAGTA
Rhesus_macaque|23840                ------------------------------------------------------------
Pongo_abelii|19964                  ------------------------------------------------------------
Pan_troglodytes|25778               CAGAATGGAGCAGTCATTAGTTCAAATGAACCATACGGGCTT---GTAGAGGGCCAAGTA
Gorilla_gorilla|11587               CAGAATGGAGCAGTCATTAGTTCAAACGAACCATACGGGCTT---GTAGAGGGGCAAGTA
Homo_sapiens|61131                  CAGAATGGAGCAGTCATTAGTTCAAATGAACCATACGGGCTT---GTAGAGGGGCAAGTA
                                                                                                

Nematostella_vectensis|8224         GGAGTGACACGGGGACTTGGGAATATCGGGGATGGGGAACTGAACCAGTCTGTGATCATC
Branchiostoma_floridae|6242         GCAACAACCAGGGGCCTCGGTAACCATGGCGATATAAACATCAAGAAATGTGTGCTGAAC
Nematostella_vectensis|23553        ACAAACACTAGAGGACTTGGTAACCATGGTGACCCACATTTGAAGTCTTCTGTTATCTGT
Xenopus_tropicalis|11325            ------------------------------------------------------------
Gallus_gallus|8502                  AGAACTACAAGAGGTCTTGGATATCACGGAGATCCCGTACTAAAAAGATCTGTTATACCT
Monodelphis_domestica|32120         AAAATAACTCGTGGGCTTGGGTTTCATGGAAATGCAAAGCTGAAACGGTCTGTTATTCCA
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          AAAATCACACGAGGACTTGGATTTCATGGAAATCTCAAAATGAAAAAACTCGTTATTCCA
Ornithorhynchus_anatinus|18147      AAAACTACACGGGGGCTTGGACATCATGGAAATCCAAAGTTCAAGAAGTCTTTCATTCCT
Erinaceus_europaeus|17421           AAAACGACACGAGGACTCGGATTTCATGGAAATCCCAGACTGAAAAGATTCATTATTCCA
Sorex_araneus|2780                  AAATTAACACGGGGACTTGGATTTCATGGACATCCTAAACTGAAAAATGTCATTATTCCA
Mus_musculus|17846                  AAAACCACCCGGGGTCTTGGATTCCATGGAAACCTCAGACTAAAAAAGTCCATTATTCCA
Rattus_norvegicus|35105             AAAACCACCAGGGGTCTTGGATTCCATGGAAACCTCAGACTAAAAAAGGCCATTATTCCA
Cavia_porcellus|486                 AAAACGACAAGAGGACTTGGATTTCATGGAAATCTCAAACTAAAAAAATTTATTATTCCA
Ochotona_princeps|11539             GAAATCACTCGAGGACTTGGATTTCACGGAAATCTCAGACTGAAAAAATTTTTTATCCCA
Bos_taurus|1081                     ACCACCACACGAGGGCTTGGCTTCCACGGGAATCTCAAGCTGAAAAGATTCATCATCCCA
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             AAAACCACCCGAGGACTTGGATTTCACGGAAATCCCAAACTGAAAAAATTCTTTATTCCA
Loxodonta_africana|16871            AAAACCACACGAGGACTTGGATTTCATGGAAATCTCAAACTGAAAAAATTCATTATTCCA
Spermophilus_tridecemlineatus|12389 AAAACCACAAGAGGACTTGGATTTCATGGAAATCTCAAACTGAAAAAATCCATTATCCCA
Tupaia_belangeri|9125               CAAACCACACGAGGACTTGGGTTTCATGGAAATCTCAAACTGAAAAAATCCATCATCCCA
Vicugna_pacos|1326                  AAAACCACACGAGGACTTGGGTTTCATGGAAATCCCAAACTGAAAAAATTCATTATCCCA
Pteropus_vampyrus|14421             AAAACTACAAGAGGACTTGGATTTCATGGAAATCCTAAATTGAAAAATTTCATTATTCCA
Canis_familiaris|13176              AAAACCACACGAGGACTTGGATTTCATGGAAATCTCAAACTGAAAAAATCCATTATCCCA
Felis_catus|16327                   AAAACCACACGAGGACTTGGGTTTCATGGAAATCTCAAACTGAAAAAATCCATTATTCCA
Equus_caballus|9313                 AGAGTCACACGAGGACTTGGATTTCATGGGAGTCTCAAACTGAAAAAATTCATTATTCCA
Tarsius_syrichta|2954               AAAACCACACGAGGACTTGGATTTCACGGAAATCTCAAACTGAAAAAGGTCATCATTCCA
Callithrix_jacchus|11240            AAAACTACACGAGGACTTGGATTTCATGGAAATCTCAAACTGAAAAAATCCATTATCCCA
Rhesus_macaque|23840                ------------------------------------------------------------
Pongo_abelii|19964                  ------------------------------------------------------------
Pan_troglodytes|25778               AAAACTACACGAGGACTTGGATTTCATGGAAATCTCAAGCTGAAAAAATCCATTATCCCA
Gorilla_gorilla|11587               AAAACTACACGAGGACTTGGATTTCATGGAAATCTCAAGCTGAAAAAATCCATTATCCCA
Homo_sapiens|61131                  AAAACTACACGAGGACTTGGATTTCATGGAAATCTCAAGCTGAAAAAATCCATTATCCCA
                                                                                                

Nematostella_vectensis|8224         GCGCCCAAGTTTCGCTGCACTTGTCTGACAAATAGAGACCAAGTACTTGTGTTTGCGTCC
Branchiostoma_floridae|6242         GAGCCATTCACGACATGCGTCTCTATAGACCAGTACGCGCAGTTCCTGATTCTTGCGTCT
Nematostella_vectensis|23553        CAACCTTCTGTGAACTGTGTGACATTGGATGAGGCTGATCAGTTTGTCATTTTGGCAACA
Xenopus_tropicalis|11325            ------------------------------------------------------------
Gallus_gallus|8502                  GTACCTCATAGCATCTCTGTCCCAATTGATGATTCTTGTCAATTTCTCATTTTAGCTTCT
Monodelphis_domestica|32120         GCGCCTCAAACAATCTCTGTCCATATAGATAATTCTTGTCAATTCCTTATTGTTGCTACA
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          GCACCTCAAACTATCTCTGTCCCTATAGATGACTTATGCCAATTCCTAATCTTAGCTACT
Ornithorhynchus_anatinus|18147      GTTCCTCAAACCATCTCCGTCCCTATAGATAACTTATGCCAGGTCCTTATATTAGCTACC
Erinaceus_europaeus|17421           GCACCTCAAACTATCTCTGTACCAATAGACATCTTATGCCAATTCCTTATTTTAGCCACT
Sorex_araneus|2780                  GCACCTCAAACAATCTCTGTCCCAATAGATGACTTATGTCAATTCCTTATTTTAGCTACT
Mus_musculus|17846                  GCACCGCAAACAATCTCTGTCCCTATAGATGATCTATGTCAGTTTCTCATCTTAGCCACT
Rattus_norvegicus|35105             GTACCACAAACAATTTCTGTCCCTATAGATGATTTATGTCAGTTTCTCATCTTAGCCACC
Cavia_porcellus|486                 GCACCTGAAACTATTTCTGTCCCTATAGATGATTTATGTCAATTCCTTATCTTAGCTACT
Ochotona_princeps|11539             GCACCTCAAACTATTTCTGTCCCTGTGGATGATTTGTGTCAATTCCTTATCTTAGCTACT
Bos_taurus|1081                     GCGCCTCAGACGGTTTCTGTGCCCATAGATGACTTGTGTCAGTTCCTTATCCTGGGCACC
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             GCACCTCAAACCATCTCAGTCCCAATAGATGACTTATGTCAATTTCTTGTCCTGGCTACT
Loxodonta_africana|16871            GCACCTCAAACTATCTCGGTCCCTATAGATGACTTATGTCAATTCCTCGTCCTAGCTACT
Spermophilus_tridecemlineatus|12389 GCACCTCAAACTATTTCTATTCCTATGGATGACTTATGTCAATTCCTTATCTTAGCTACT
Tupaia_belangeri|9125               GCACCTCAAACTATTTCTATCCCAATAGATGACTTATGTCAGTTCCTCATCTTAGCTACT
Vicugna_pacos|1326                  GCACCTCAAACTATTTCTGTCCCTATCGATGACTTATGTCAATTCCTTATCTTAGCTACC
Pteropus_vampyrus|14421             GCACCTCAAACTATTTCTGTCCCTATAGATGACTTATGTCAATTCCTTATCTTAGCTACT
Canis_familiaris|13176              GCACCTCAAACTATCTCTGTCCCTATCGATGACTTATGCCAATTCCTTATCTTAGCTACT
Felis_catus|16327                   GCACCTCATACTATCTCTGTCCCTATAGATGACTTATGCCAATTCCTTATTTTAGCTACT
Equus_caballus|9313                 GCACCTCAAACTCTATCTGTCCCTATAGATGACTTATGTCAATTCCTTATCTTGGCTACT
Tarsius_syrichta|2954               GCACCTCAAACGCTTTCTGTACCGATAGATGACTTATGTCAGTTCCTTATTTTAGCTACC
Callithrix_jacchus|11240            GCACCTCAAACTATTTCTGTCCTTATAGATGACTTATGTCAATTCGTTATCTTAGCTACT
Rhesus_macaque|23840                ------------------------------------------------------------
Pongo_abelii|19964                  ------------------------------------------------------------
Pan_troglodytes|25778               GCACCTCAAACTATTTCTGTCCCTATAGATGACCTATGTCAATTCCTTATTTTAGCTACT
Gorilla_gorilla|11587               GCACCTCAAACTATTTCTGTCCCTATAGATGACCTATGTCAATTCCTTATTTTAGCTACT
Homo_sapiens|61131                  GCACCTCAAACTATTTCTGTCCCTATAGATGACCTATGTCAATTCCTTATTGTAGCTACT
                                                                                                

Nematostella_vectensis|8224         AGCGGACTATGGAAGGTGTTTTCGGCAGAGGAGGTGGCCAACCTTGTATTAGGATTCTTC
Branchiostoma_floridae|6242         AACGGTGTTTGGGAAGTTCTCTCTGACAAGGAGGCGGTTTCCCTTCTCCTCCAAATGGTG
Nematostella_vectensis|23553        AATGGGGTATGGGAGGTGTTTAGTGAGGAGGAGGTGATACTGCTACTTGAAGATTTAATG
Xenopus_tropicalis|11325            ------------------------------------------------------------
Gallus_gallus|8502                  AACGGGCTTTGGGAGGTTTTGGATTACAAGCAAGTATGTGCATTAACACTAACCACATTC
Monodelphis_domestica|32120         ACTGGACTTTGGGGGGTTTTAGATAAAAATGAAGCTACAGCTATAGCAATGTCACTGTTT
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          AATGGACTATGGGAAGTTCTGGATAAAAAGGAAGTCATTTCTCTGGCAATGGCAACGTTC
Ornithorhynchus_anatinus|18147      AATGGCCTTTGGGAAGTTCTAGATAAAAATGAGGTTATGGCACTGGCATTGACAATGCTC
Erinaceus_europaeus|17421           AGTGGACTTTGGGAAGTTATGGATACAAAGGAAGTCACTGCTCTGGCAATGACAACATTT
Sorex_araneus|2780                  AATGGACTTTGGGAAGTTCTAGATAAAAAGGAGGTTACTGCATTGGCAATAACAATATTT
Mus_musculus|17846                  AATGGACTTTGGCAAGTTTTGGACAAGAAGGAAGTCACTGCACTGGTAATCACCTTGTTT
Rattus_norvegicus|35105             AATGGACTTTGGCAAGTTTTGGACAAGAAGGAAGTCACTGCACTGGTAATCACTTTGTTT
Cavia_porcellus|486                 AATGGACTTTGGGAAGTTCTGGATAAAGAGGAAGTCATAGCACTGGCAATAACACTGTTT
Ochotona_princeps|11539             AATGGACTTTGGGAAGTTTTGGATAAGAAGGAAGTCATTGCACTGACAATAACAGAATTC
Bos_taurus|1081                     GACGGGCTCTGGGGAGTCCTGGACACAAAGGAGGTCACTGCGCTCGCCATGTCGGCTTTC
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             AATGGACTTTGGGAGGTTCTGGATAAAAATGAAGTCATCCCATTGGCAATATCAATGTTT
Loxodonta_africana|16871            AATGGACTTTGGGAAGTTCTAGATAAAAATGAAGTCATCGCATTGGCAATGACCATGTTT
Spermophilus_tridecemlineatus|12389 AATGGACTCTGGGAAGTTTTGGATAAAAAGGAAGTCACTGCAATGGTAATAACAATGTTT
Tupaia_belangeri|9125               AACGGACTCTGGGAAGTTCTGGACAAAAAGGAAGTCACTGCGCTGGCGATGACAATGTTC
Vicugna_pacos|1326                  AATGGGCTCTGGGAAGTTCTGGATATAAAGGAAGCCACTGCACTGACAATGACAGCATTT
Pteropus_vampyrus|14421             AATGGACTCTGGGAAGTTCTGGATAAAAAGGAAGTCACTGCACTGGCAATGACAATGTTT
Canis_familiaris|13176              AACGGACTCTGGGAAGTTTTGGATACAAAGGAAGTCACTGCACTGGCAATGACAATGTTT
Felis_catus|16327                   CATGGACTCTGGGAAGTTCTGGATACAAAGGAAGTCACTGCACTGGCAATGACCATGTTT
Equus_caballus|9313                 AATGGACTCTGGGAAGTTCTGGATAAAAAGGAAGTCACTGCACTGGCAATTACAATGTTT
Tarsius_syrichta|2954               AATGGACTCTGGGAAGTTCTGGATCAAGAGGAAGTCACTGCACTGGCAATGATGATGTTT
Callithrix_jacchus|11240            AATGGACTTTGGGAAGTTTTGGATAAAGAAGAAGTCACTGCCTTGGCAATGACAACATTT
Rhesus_macaque|23840                ------------------------------------------------------------
Pongo_abelii|19964                  ------------------------------------------------------------
Pan_troglodytes|25778               AATGGACTTTGGGAAGTTTTGGATAAAGAGGAAGTTACTGCCCTGGCAATGACAACATTT
Gorilla_gorilla|11587               AATGGACTTTGGGAAGTTTTGGATAAAGAGGAAGTTACTGCCCTGGCAATGACAACATTT
Homo_sapiens|61131                  AATGGACTTTGGGAAGTTTTGGATAAAGAGGAAGTTACTGCCCTGGCAATGACAACATTT
                                                                                                

Nematostella_vectensis|8224         AGACAGATCAAGGAAAGCGTGCGCAAAGGGATCATTTGGGGGTCGAGAGTACCATGTGTG
Branchiostoma_floridae|6242         CCTGGCCAGGAGATCCCGCCCCCGAGCGACCAGCCTCCCATCTCCATACATGGGGGCAGT
Nematostella_vectensis|23553        CCA---------------------------------------------------------
Xenopus_tropicalis|11325            ------------------------------------------------------------
Gallus_gallus|8502                  ACT---------------------------------------------------------
Monodelphis_domestica|32120         AGC---------------------------------------------------------
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          CAC---------------------------------------------------------
Ornithorhynchus_anatinus|18147      GGG---------------------------------------------------------
Erinaceus_europaeus|17421           GAA---------------------------------------------------------
Sorex_araneus|2780                  CAA---------------------------------------------------------
Mus_musculus|17846                  CAT---------------------------------------------------------
Rattus_norvegicus|35105             CAC---------------------------------------------------------
Cavia_porcellus|486                 CAA---------------------------------------------------------
Ochotona_princeps|11539             CAG---------------------------------------------------------
Bos_taurus|1081                     CAA---------------------------------------------------------
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             CAT---------------------------------------------------------
Loxodonta_africana|16871            CAC---------------------------------------------------------
Spermophilus_tridecemlineatus|12389 CAT---------------------------------------------------------
Tupaia_belangeri|9125               CAC---------------------------------------------------------
Vicugna_pacos|1326                  CAC---------------------------------------------------------
Pteropus_vampyrus|14421             CAC---------------------------------------------------------
Canis_familiaris|13176              CAA---------------------------------------------------------
Felis_catus|16327                   CAA---------------------------------------------------------
Equus_caballus|9313                 CAA---------------------------------------------------------
Tarsius_syrichta|2954               CAC---------------------------------------------------------
Callithrix_jacchus|11240            CAC---------------------------------------------------------
Rhesus_macaque|23840                ------------------------------------------------------------
Pongo_abelii|19964                  ------------------------------------------------------------
Pan_troglodytes|25778               CAC---------------------------------------------------------
Gorilla_gorilla|11587               CAC---------------------------------------------------------
Homo_sapiens|61131                  CAC---------------------------------------------------------
                                                                                                

Nematostella_vectensis|8224         TGTGCCAATGGGCATATGGAATTCGAGGGTAAAAAGTTTGCTGCCAGATACGCT---AAC
Branchiostoma_floridae|6242         CGCTGGAACGGGCAGAGTTCCTTTGCTGGTAGCAACAGGCCGATGATAGGAGAC---AAC
Nematostella_vectensis|23553        ------------------------------------------------------------
Xenopus_tropicalis|11325            ------------------------------------------------------------
Gallus_gallus|8502                  ------------------CATTAT------------------------------------
Monodelphis_domestica|32120         ------------------ATATACACGGATGCATATAAAAGTAGGCGAGACACGTATAAG
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          ------------------TTATATAAAGAAACATACTATTCTATCATACAGAAC---AAA
Ornithorhynchus_anatinus|18147      ------------------ACTTATGAGGAAACG------------------------ACT
Erinaceus_europaeus|17421           ------------------GTATATAAAAGTTCCTATTATTCTATCATAGAAAGT---AAG
Sorex_araneus|2780                  ------------------ACATATGAAAAAACCTAT------------------------
Mus_musculus|17846                  ------------------GCATATAAAGAAACCCATGTTCCTCGCCCTAAAAGC---AAA
Rattus_norvegicus|35105             ------------------GCATATAAAGAAACATGTGTTTCTGGCCCTAGAAAT---AAA
Cavia_porcellus|486                 ------------------ATATATAAGGACACATGTGCTTCTACCATGCAAAAC---AAA
Ochotona_princeps|11539             ------------------ATGTATAAGGACACACACGATTCCACCATGCAAAAC---AAA
Bos_taurus|1081                     ------------------GCACACAGAGAAACACGGGGTCCTGCCACGGGGAAC---CAA
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             ------------------GCATATAAAGAAAAATACTATCCCAGA------------AAA
Loxodonta_africana|16871            ------------------ACATATAAAGAAAAA---TGCTTCATGGCAGAAAAC---GAA
Spermophilus_tridecemlineatus|12389 ------------------ATGTATAAAGAAACATACACCTCAATCACACTT------AGA
Tupaia_belangeri|9125               ------------------GTGTATAAAGAAACATACTACTCTACGACACAAAAC---GCA
Vicugna_pacos|1326                  ------------------GTGTATACAGAAACACGT---TCTACCACAGGAAAC---AAA
Pteropus_vampyrus|14421             ------------------ATGTATAAAGAAACATACTGTTCTAGCTTCCAAAAC---AAA
Canis_familiaris|13176              ------------------GTATATAAAGACACCTACTATTGTATCACACAAAAT---CAA
Felis_catus|16327                   ------------------GTGTATAAAGAAACCTACTGTTTTGTCAAGCAAAAC---AAA
Equus_caballus|9313                 ------------------GCGTATCAAGAAACATACTGTTCTAGCTCACAAAAC---ACA
Tarsius_syrichta|2954               ------------------ATGTATAAAGAAACATACTGCTCCATCACA---AAC---AAA
Callithrix_jacchus|11240            ------------------GTGTATAAAGAAACATACTGTTCTATCACACATAAC---AAA
Rhesus_macaque|23840                ------------------------------------------------------------
Pongo_abelii|19964                  ------------------------------------------------------------
Pan_troglodytes|25778               ------------------ATGTATAAAGAAACATACTGTCCTATCATACCTAAC---AAA
Gorilla_gorilla|11587               ------------------ATGTATAAAGAAACATACTGTCCTATCATACCTAAC---AAA
Homo_sapiens|61131                  ------------------ATGTATAAAGAAACATACTGTCCTATCATACCTAAC---AAA
                                                                                                

Nematostella_vectensis|8224         TGCGGCGCTTACTACCGCAAGTTCTTGCGGCCGGAACCCAAACGAGAAATAGGGCGACCC
Branchiostoma_floridae|6242         CATGCTCTGAACAGGGGAGGGGGGAAGACCGATCGCTCACAGAAAGGCAAAGCGAGGGCA
Nematostella_vectensis|23553        ---------------GAGTTAGATGTCAAGGAAATTGTCCGCCGTATGAATAATGCTTCA
Xenopus_tropicalis|11325            ------------------------------------------------------------
Gallus_gallus|8502                  ---------------------TATTTGATACCCCTTTCTGAAGAAGAGTTAAGAGACTCA
Monodelphis_domestica|32120         TCATTTCAACAAAGAATGTCTTTTTTACCTAGTATATCAGCTTCAAGTATTAGTACACAA
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          CCTTCACCCTCCACAGGGCCTCCAATTATCTCACTCAGTGAAGAAACAAATAATACTAAG
Ornithorhynchus_anatinus|18147      GCATTTCCTCACAAACGACCGGCAACAAGCTCGGTGTCCTCCAGAGATTCAAAAATTCGG
Erinaceus_europaeus|17421           TATCTACCATCAGAAAATTTTCTGCTTTCTCCAGCTAATAAGCCAAACATTATTGAGCCT
Sorex_araneus|2780                  TCTAAACCAGCCAAAGGATCTCTGTTTTCCCCAAACAGT---------AACCTTAAATCA
Mus_musculus|17846                  CCCTGGCCACCTATAGGCCTTCTTTCCCCACCAGACAGT---------------------
Rattus_norvegicus|35105             CCCTGGCCATCTAAAAGCCTGCTTTTCCCACCAGACAGT---------------------
Cavia_porcellus|486                 ---TTACCATACATGAAGCCTCTGTATCTTTCAATCAGTGACACAAGCACTACTGAATCA
Ochotona_princeps|11539             TGTCAACCACCCATAAAGTCTCTGCTTTTCCCAGTCAGCGCACCCAGCACCACCACTTCG
Bos_taurus|1081                     CCGTCACCACCCAGAGGGTCTCTGCTTTGCCCCATCAGTGAACAAACCACATCCAAATCA
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             TGTATCTCACCACCCAAACCC---------------AGTGAACCAAGTGTTACACAAGAA
Loxodonta_africana|16871            TCTTCGTCGTCCAAA------------------CTTAGTGAACCAAGTGTTAGGAAACCG
Spermophilus_tridecemlineatus|12389 AGCTCACCATCTACAGGGCCTCCGCTTCTTCCAAACAGTGACAAAAGTAATAATGAATTC
Tupaia_belangeri|9125               TCTTTA---TCCTATGAGCCTCTACTGTATACAACCGGTGACCCCAACATCACGGAGCCA
Vicugna_pacos|1326                  CTGTCAACATCCACGGGGCCCCTGCTTTCCCCAATCAACGAACGAAACGCATCTAAATCA
Pteropus_vampyrus|14421             TCTTCATCATCCAAAGAGCTTCAGTTTTTCCCAACCAATGAATCAAGCATTACTAAATCA
Canis_familiaris|13176              TCTTTACCATCCAAAGAGCCTTTCCTA------ATCAATGAACTAAGCAATACTAAATCA
Felis_catus|16327                   TCTTTACCATCCAAAGAGCCTCTGCTTTTCCCAATCAACGAACCAANNNNNNNNNNNNNN
Equus_caballus|9313                 CCTTCACCATCCCCAGGG------------------------CCTTCTGTTTCTAAGTCA
Tarsius_syrichta|2954               TCTTCCCCATCCAAAGGGCCTCTGCCGCTTTCAGTGAGTGAACCAAGAATCCCTAAATCA
Callithrix_jacchus|11240            TCTTCACCATCCAAAGGGCCTCTGCTTTTTTTAAACAGTGAACCAAATTTTATGAAAACA
Rhesus_macaque|23840                ------------------------------------------------------------
Pongo_abelii|19964                  ------------------------------------------------------------
Pan_troglodytes|25778               ---TCACCATCCAAAGGGCCTCTGCTTTTTTCAACCAGTGAACCAAACCTTACTAAATCA
Gorilla_gorilla|11587               ---TCACCATCCAAAGGGCCTCTGCTTTTTTCAACCAGTGAACCAAACCTTACTAAATCA
Homo_sapiens|61131                  ---TCACCATCCAAAGGGCCTCTGCTTTTTTCAACCAGTGAACCAAACCTTACTAAATCA
                                                                                                

Nematostella_vectensis|8224         GCTACAAGCCACATGTTCAATTTCATGAGCTACAATGAACTTGACAACATCACAGAGGAA
Branchiostoma_floridae|6242         CAGACT---GCTCTGTCAGTCAAATTACACACACCACGGGATGTCGAGAAGACAGCAGAG
Nematostella_vectensis|23553        GAAAAG---AAAAGCAAAGTTGCAAAACAATGCAATACTAAAAGAGAAAGTGCAAAGACT
Xenopus_tropicalis|11325            ------------------------------------------------------------
Gallus_gallus|8502                  AAGGCTACGAATTATCAGCAAGTTGGAACAGAGATGCTGGACTCCAATACGGAGATTTTT
Monodelphis_domestica|32120         GATAGT---AAAATCAAATTACTGTACCGTAATTCAGCAGCATTTCGGAGAGTAGGATAC
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          TCAGAAACTAATATCCACATACTGTTTCAGTATAAACCA---TCTCAAGAATGTCTACCA
Ornithorhynchus_anatinus|18147      CAGCCT------------------------------GGTGAAGACGATCAGCATTTTCAA
Erinaceus_europaeus|17421           GAAAAT---AACATCCACTTACTGTTTCAGTCTAAATCTGAATCTAAAGAAAGTCTAACA
Sorex_araneus|2780                  AAAAGT---AATAGCAACATACCGAGTGAGTTTAAATCTGACTCTGAAAGGATAGTATCA
Mus_musculus|17846                  ---------AACATCCGAGTGCTGTTCCAGTACCAGCCTGAAAATGAAGACATTATGTCA
Rattus_norvegicus|35105             ---------AACATCCGCGTGCTGTTCCAATACCAGCCTGAAAATGAAGACATTACGTCA
Cavia_porcellus|486                 GAAAGT---AACATTCATGTATTGTTTCAATATAATCCTGAATCTAAAGAACATGTGTCA
Ochotona_princeps|11539             GAAGGC---CACATCCATGTGTTGTTTGAGTGTAAGCTGGAAACTAACGAACGTGTGTCA
Bos_taurus|1081                     GAGACT---AACATCCACATAGTGTTCCAGCGCAAA------TCTGGAGAACGGGCGTCA
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             GAATGTACGAACATCCACGTGTGGTACCAGTGTACGCCTTTAGCTACAGAATATGGGTCA
Loxodonta_africana|16871            GAAAGTAATGATATCCACATATTGTATCAGTGTAAACCTTTATCGAAAGAACATCTGTCA
Spermophilus_tridecemlineatus|12389 GAAAGT---GATATCCACATATTGTTTCAGTGTGAATCTGAATCTGAAGAATATGTGTCA
Tupaia_belangeri|9125               GAAACT---GACATCCACGTACTGTTTCAGTATGAA------------------------
Vicugna_pacos|1326                  GAAACC---AATATCCACATAGTATTTCAGAGCAAATCTGAATTTGAAGAATGTGTGTCA
Pteropus_vampyrus|14421             GAAAGT---ACGATCCGTATATTGTTTCAGAGTAAATCAGAATCTAAAGGATATATGTCA
Canis_familiaris|13176              GAAAGT---AATATCCATATATTGTTTCAGTATAAATCTGAATCTACAGAATGTGTGCCA
Felis_catus|16327                   NNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Equus_caballus|9313                 GAAAGT---AATATTCACATACTGTTTCAGTACAAACCTGAATCTGAAGAATGTATGTCA
Tarsius_syrichta|2954               GAAAGT---GATATCCATGTGTTGTTTCACTATAAATCTGAATCTAAAGAATGTGTGCCA
Callithrix_jacchus|11240            CAAAGT---AATATCCACTTATTGTTTCAGTATAAATCTGAATCTAAAGAATGTGTGTCA
Rhesus_macaque|23840                ------------------------------------------------------------
Pongo_abelii|19964                  ------------------------------------------------------------
Pan_troglodytes|25778               CAGAGT---AATATCCACGTATTGTTTCAGTATAAATCTGTATCTGAAGTACGTGTGTCA
Gorilla_gorilla|11587               CAGAGT---AATATCCACGTATTGTTTCAGTATAAATCTGTATCTGAAGTATGTGTGTCA
Homo_sapiens|61131                  CAGAGT---AATATCCACGTATTGTTTCAGTATAAATCTGTATCTGAAGTACGTGTGTCA
                                                                                                

Nematostella_vectensis|8224         ACGCCTACAACACGGGCAGGGCTGAGC------GTGCCGGTCTGGTTTAAGAGGGTTGGC
Branchiostoma_floridae|6242         AGAGAAAACGAGGGAAAGAAAGATGAGAAAAAGGATGAAAAGAAGGAGAGCGCAAAACTA
Nematostella_vectensis|23553        ACAGGAAGCTCACAACAG---------------GAAAGCAAAAGCACTAGTGCCTCTTCA
Xenopus_tropicalis|11325            ------------------------------------------------------------
Gallus_gallus|8502                  CTCCCTGACTCAAAAAGCAGCCTTACACATGGAAAGCCAAAATGTTCTAGGACGAGCTAC
Monodelphis_domestica|32120         CCACAGGATATCACACAAAATTTAGAT------AAATCTAATGGTTCAAAATCTAGGTTA
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          AGTATAAATTCAAAAGAAAATTTATCT------GATTCAAAC---TCCGAATATTCCATT
Ornithorhynchus_anatinus|18147      AGTCTAGACCCAGCCCAACATGTGAGT------GAGGGCCTCCGGAAGTCTACGGTCGCA
Erinaceus_europaeus|17421           ACTCTGTATTCAAAAGAA---CTACCC------GATACAAAATATTCTAAGCATTTCATA
Sorex_araneus|2780                  ACTATAAATCCTGGAGTTACTCTATCT------GATTCAAATTTAGCTCAAAATATAATC
Mus_musculus|17846                  ACTGCAGATGGGACGAAAGGGCTATCT------GACTCAATATATGCTGAAGCTTACACT
Rattus_norvegicus|35105             ACTACAGATGTAATGAAAAGGTTATCT------GACTCACCATTTGCTGACACCAACATT
Cavia_porcellus|486                 ACTACAAATTTAAAGAAAGAACTATCT------GATTCAAAATGTTCTGAACATTGTGCT
Ochotona_princeps|11539             ACCACAGATTCAAATGAT---TTGTCC------GGTTTCAAACATTCAGAATATCCCAAT
Bos_taurus|1081                     ACTGGAAGTTCAGAAGAAAACCTGTCA------GTTTCAAAACATTCT---------ATT
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             GTTACAAATTCTCAGGAAAATTTATGT------GATTCAGAAGGCTCTCAACATTCTGCT
Loxodonta_africana|16871            GCTATAAATTCAAAAGAAAACTTATAT------GATTCAAAATATTCTGATCATTCCATT
Spermophilus_tridecemlineatus|12389 ACCACAAATTCAAAAAACTCGTCTGAC------------------------TATAGTTTT
Tupaia_belangeri|9125               ---CCTCATTCAAAGGAAAATGTGCTT------GATTCAAAGTATTCTGAATATTGTCCT
Vicugna_pacos|1326                  GCTACAAATTCAAAAGAAAGGTCG---------GACTCAAAAGATTCTGAACACTTCACT
Pteropus_vampyrus|14421             CGTACATATTCAAAAGAAAATTTGTCT------GATTCAAAATATTTC---------ACT
Canis_familiaris|13176              ACTATAAATACAAAAGAAAATTTGTTT------GATTCAAAATATTCT------------
Felis_catus|16327                   NNNNNNNNNNNNNAAGAAAATGTTTCT------GATTCAAAATGTTCT------------
Equus_caballus|9313                 AATATAAATTCAAAAGAAAATCTGACT------GATTCAAAATATTCTAAATATTGCACT
Tarsius_syrichta|2954               ACTCCAAATTCCAAGGAAATGTTCTCT------GATTCAAACTATTCTAAATGTTGCATT
Callithrix_jacchus|11240            ACTACAAATTCCAAAGAAAATTTGTCT------GATTCAAACTATTCTAAATATTCCAAT
Rhesus_macaque|23840                ---ACCAGGAGAAATGAACATTTGCCT------GAA------------------------
Pongo_abelii|19964                  ---ACCAGGAGAAATGAACATCTGCCT------GAA------------------------
Pan_troglodytes|25778               ACTACAAATTCCAAAGAAAATTTATCC------GATTCAAACTATTCTAAATACTGTATT
Gorilla_gorilla|11587               ACTACAAATTCCAAAGAAAATTTATCC------GATTCAAACTATTCTAAATACTGTATT
Homo_sapiens|61131                  ACTACAAATTCCAAAGAAAATTTATCC------GATTCAAACTATTCTAAATACTGTATT
                                                                                                

Nematostella_vectensis|8224         AGGCGACTCAGCGACACGTGTATTGTTTAT------------AGAGACCCAGATGCCATC
Branchiostoma_floridae|6242         GAGGAGAAACTGGATATTGTGAGTAAATCTCTCGAGCAAGGACAGGATCAGGAAAAATTT
Nematostella_vectensis|23553        AAATCCTCT---------------------------------GACACTATCTCAATAAGG
Xenopus_tropicalis|11325            ------------------------------------------------------------
Gallus_gallus|8502                  TTGCAAAGT---------------------------------TATACTGGCCAGCAACTG
Monodelphis_domestica|32120         AACAGTAAA---------------------------------ACAGAAATTTCAAGTGCA
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          TCTAACTCT---------------------------------GAGAGTGTAGAAAAATTC
Ornithorhynchus_anatinus|18147      AAACCCAGC---------------------------------TCATCTCATACCGTGGAA
Erinaceus_europaeus|17421           GATAATCCT---------------------------------GGAAAAACAGAAACATTC
Sorex_araneus|2780                  AGTAACCCT---------------------------------GAAAATAAGGACACTCTT
Mus_musculus|17846                  CATCAGGGT---------------------------------------------ACATTT
Rattus_norvegicus|35105             CATCAAGAT---------------------------------ACATCTGCAGAAACATTT
Cavia_porcellus|486                 TTTAACTCT---------------------------------AACAATGTAGAAACAGCT
Ochotona_princeps|11539             CATAATTAC---------------------------------GAAAATGGGGAAACGTTT
Bos_taurus|1081                     TGTGACCCT---------------------------------GAAAGTTCAGGACTGTCT
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             AATGACCCT---------------------------------AAAAATTTAGAATCATGC
Loxodonta_africana|16871            GGTGACCTT---------------------------------GAAAATTCAGAAACATTC
Spermophilus_tridecemlineatus|12389 GATGACCCG---------------------------------AAAAATGAAGAATTATCT
Tupaia_belangeri|9125               TATAACCTT---------------------------------GAAAATGTAGAAAAGCCT
Vicugna_pacos|1326                  TGTAACCCT---------------------------------------------------
Pteropus_vampyrus|14421             CGTGATTCT---------------------------------AAAAATGGACAAACATTT
Canis_familiaris|13176              ---AACCCT---------------------------------AAAAATGCAGAAACATTT
Felis_catus|16327                   ---AATTCT---------------------------------AAAAATGCACAAACATTT
Equus_caballus|9313                 TTTAACCCT---------------------------------AAAAATGAACAAACATTT
Tarsius_syrichta|2954               TATAGCCCT---------------------------------GAAAACATAGAAACATTT
Callithrix_jacchus|11240            TATGACCCT---------------------------------GAGAATGTAGAAACATTT
Rhesus_macaque|23840                ------------------------------------------------------------
Pongo_abelii|19964                  ------------------------------------------------------------
Pan_troglodytes|25778               TATAACCCT---------------------------------GAGAATGTAGAAACATTT
Gorilla_gorilla|11587               TATAACCCT---------------------------------GAGAATGTAGAAACATTT
Homo_sapiens|61131                  TATAACCCT---------------------------------GAGAATGTAGAAACATTT
                                                                                                

Nematostella_vectensis|8224         CAAGACGAACAACTCAATACTTCTCAC---------------------------------
Branchiostoma_floridae|6242         GATGACGAAGAAGTAGAAGTCGGTAGTGTCATATCTGAAAACATTAAGATTCTCGAAGCT
Nematostella_vectensis|23553        CTACCTGAGATT------GTTAGCAAT---------------------------------
Xenopus_tropicalis|11325            ------------------------------------------------------------
Gallus_gallus|8502                  CTGAAGACTACACTGCCAGTGGATTGT---------------------------------
Monodelphis_domestica|32120         AGACCTTTC---------------------------------------------------
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          TCACCAGAAGTC------AGTAATCAA---------------------------------
Ornithorhynchus_anatinus|18147      CCCCCAGAAATG------CGGCATCTG---------------------------------
Erinaceus_europaeus|17421           CAACCAGAAACA------ACCAACTAT---------------------------------
Sorex_araneus|2780                  CTATCAGAAGTG------ACTGATTTT---------------------------------
Mus_musculus|17846                  TCTCCAAAAGTG------ACCCCTTAT---------------------------------
Rattus_norvegicus|35105             CTACCAAAAGCG------ACCTCTTAT---------------------------------
Cavia_porcellus|486                 CCACCACAAATG------ACTAATCAT---------------------------------
Ochotona_princeps|11539             CCACCAGAAAAG------ACT---------------------------------------
Bos_taurus|1081                     CCACCAAAAAAG------ACTACTCGT---------------------------------
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             CCACCAAAACTG------ACTCTTCAT---------------------------------
Loxodonta_africana|16871            CCACCGAGACCG------ACTATTCGC---------------------------------
Spermophilus_tridecemlineatus|12389 TCACCAACA---------ACTAGTCAT---------------------------------
Tupaia_belangeri|9125               GCAGCAAAAAGG------ATTAACCAA---------------------------------
Vicugna_pacos|1326                  ------------------------------------------------------------
Pteropus_vampyrus|14421             CTACCAGAAATA------ACTAATCGT---------------------------------
Canis_familiaris|13176              CCATCAGAAATG------ACTAATCAT---------------------------------
Felis_catus|16327                   CCACCAGAAAAG------ACGAATCAC---------------------------------
Equus_caballus|9313                 CCACCAGAAATG------ACTAACCAT---------------------------------
Tarsius_syrichta|2954               CTATCAGAAATG------ACTCACCGT---------------------------------
Callithrix_jacchus|11240            CCAGCAGAAACG------ATTCATCAT---------------------------------
Rhesus_macaque|23840                ------------------------------------------------------------
Pongo_abelii|19964                  ------------------------------------------------------------
Pan_troglodytes|25778               CCAGCAGAAACG------ACTCATCGT---------------------------------
Gorilla_gorilla|11587               CCAGCAGAAACG------ACTCATCGT---------------------------------
Homo_sapiens|61131                  CCAGCAGAAACG------ACTCATCGT---------------------------------
                                                                                                

Nematostella_vectensis|8224         ---------GAGAGGTTTACAAATCGCCGGCACTCGCTGCCTCATAGGGCTGGTATGACC
Branchiostoma_floridae|6242         GATTTTGGTGACCAGAAGTCAGAAGTGGACTCCCAGAAACCTGTCCAACACAACTACCCA
Nematostella_vectensis|23553        ---------AAGGGTAAAGCTGCGACAGCATCAGATAGCCTGATAAGGATGGAA---GAG
Xenopus_tropicalis|11325            ------------------------------------------------------------
Gallus_gallus|8502                  ---------AAGCCACCTACACATTTTGAAGAGGACACAAAAACATACCTGTCC---GGT
Monodelphis_domestica|32120         ---------TATTTGTATGGCATTGAGGAAAGTGATGAAACAAGTAGTTTATCTGAATCA
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          ---------GATCCTCGCAGAAGGAAAGAAACTGATGGACCATTCCTTGCAGAT---GGT
Ornithorhynchus_anatinus|18147      ---------GAGAGAGACAGCAGGCAAGAAACGGATGAGGAACTCAGCCTGCCT---AGT
Erinaceus_europaeus|17421           ---------GCTCTTTACACTGGGAAAGAAGCTGANNNNNNNNNNNNNNNNNNN---NNN
Sorex_araneus|2780                  ---------------------------------GAAAATAAAACATACCAACAT---TCT
Mus_musculus|17846                  ---------GACCCTTGTAGCACAAAAGAAAATAGCAGCTTACCCACTATAGAC---AGT
Rattus_norvegicus|35105             ---------GACCCTTATAGCACAAAAGAGAGTAATAGCTTACCCACTACGAAC---AGT
Cavia_porcellus|486                 ---------GAACCTAGCAGTGAAAAAGAAACTGATAGGCCAACCAGTGCAGAT---GAT
Ochotona_princeps|11539             ---------AATCCTGAAGCTGACAGAGAGGGAGAAGCGGAAAGCTGTACAGAT---GGT
Bos_taurus|1081                     ---------GATCCCTGCAGTGAGGAAGGAACCGGCGGACTGACCAGTGTGGAC---AGA
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             ---------CAGGGTTACAGTAGGGAGAAAATCGATGGACAAGTTGGTGCAGAC---AGC
Loxodonta_africana|16871            ---------CAACATCACGGCAGGAAACCAACTGACGGACAGGTCAGCGCAGAC---GAT
Spermophilus_tridecemlineatus|12389 ---------GAGAATGAAATTGAAAGTGCAGATGATGAGCAAACAAGTATA---------
Tupaia_belangeri|9125               ---------GAACCTTGTAAC---------------------------------------
Vicugna_pacos|1326                  ---------GGTCCCTGCAGTAAGAAAGAAACTGATGAACCAACCAGCATGGAC---AGT
Pteropus_vampyrus|14421             ---------AATCCTAGCACCGAGAGAGAAGCTAACATACCAACCAAGGCAGAT---GGT
Canis_familiaris|13176              ---------CATCTATACAGTGAGAAAGAAAGAAATGGACCAACCAGTGTAGATGTGTCA
Felis_catus|16327                   ---------GATCTTTGCAGTGAGAAAGAAACCAAAGGACCAACCAGTGTAAGT---GAT
Equus_caballus|9313                 ---------GATCCTTGCAGTGAGAAAGAAAGTGATGGACCAACCAGTGTAGAT---GAG
Tarsius_syrichta|2954               ---------GAACCTTCCAGTGAGAAAGAAACCAACAGACCAACCAGTGTAGAC---AGT
Callithrix_jacchus|11240            ---------GAACGTTGCAGTGAAAAAGTAACTGACAGACCAACCAGTGTAAAT---GGT
Rhesus_macaque|23840                ------------------------------------------------------------
Pongo_abelii|19964                  ------------------------------------------------------------
Pan_troglodytes|25778               ---------AAACCTTGCAGTGAAAAAGTAACTGACAGACCAACTAGTGTAAAT---GAT
Gorilla_gorilla|11587               ---------AAACCTTGCAGTGAAAAAGTAACTGACAGACCAACTAGTGTAAAT---GAT
Homo_sapiens|61131                  ---------AAACCTTGCAGTGAAAAAGTAACTGACAGACCAACTAGTGTAAAT---GAT
                                                                                                

Nematostella_vectensis|8224         AAGCTGTATGGCCCTCTAGGGTTCAGACCAGACCTCTCCCCTCAAGATAAGATCGAACTT
Branchiostoma_floridae|6242         GCCATCTACACCCAGTCAGAGCTGACCAGTATGCCCACTAAGAGAGAGTTGTACTGTAAC
Nematostella_vectensis|23553        AAGGCACAAGAA------------------------------------------------
Xenopus_tropicalis|11325            ------------------------------------------------------------
Gallus_gallus|8502                  TGTGAATCACAAATTGCAGGA---AAAGGTGGGGTCACTTCCAAGGCACTCTATGACAAT
Monodelphis_domestica|32120         TCAAAATCAGAT------------CTAGATAGTGAAATACAAAAAAATTTCTATGATTAT
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          GTGCCAACAGAACCAAGTGAGAAAGAAAAAGAATCATGCAGTAAGAATTTCTATGAAGGT
Ornithorhynchus_anatinus|18147      AATATGACCCATTCAAGTACAGGGCAGAAGGAAACAGAGCTCAAGAGTTTCTATGATGAA
Erinaceus_europaeus|17421           NNNNNNNNNNNN------------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Sorex_araneus|2780                  ACACCAGAAGATTCAAGTGGAAAACAGAAAGAATCACGCCCTCAGAATTTCTACAAAAGT
Mus_musculus|17846                  AAGCAGGAAAAT------------GAGAAAGAACTATGTATTAAGAATTTCTACAAAGGT
Rattus_norvegicus|35105             AAGCAGGAAAGT------------GAGAAAGAAATATGTATTAAGAACTTCTATAAAGGT
Cavia_porcellus|486                 GCACCAACAAGT------------GAAGAATCACCACACAGTAAGAACTTCTTTGAAGGC
Ochotona_princeps|11539             GTGAGT------------------GACAAGCAACCAGGCACCGGGAGCTTCTACGACAGC
Bos_taurus|1081                     GAGCCGAAAGACTCAAGAGAAAGACAGGGAGGACCAGGCAGTCAGAGTTTCTACGAGGGC
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             GTGCCCACCGATTTGAGTGAGGAAGAAAAAGAACCACAGACTTGGAGCTTCTATGAACGC
Loxodonta_africana|16871            GTGCCAACAGATCCAAACGAGAAAGCGAAGGAGCCGTCAGCTAAGAGCTTTTACGAAGGC
Spermophilus_tridecemlineatus|12389 ---------------------------AAAAAATTAGGCACTAAAAATTTCTATGAAGGT
Tupaia_belangeri|9125               ------------------------AGGAAAGAATCGTGCGCTAAGAGTTTCTACGAAGGT
Vicugna_pacos|1326                  GTGCCAAAAGATGCAAGTGACAAAGAAAAAAAATCTTACCTTAAGAGTTTCTATGAAGGA
Pteropus_vampyrus|14421             GAGCCAAAAGATTCAAGTAAA---AATGAAAAAACACGCACTAAGAGTTTCTATGAAGGT
Canis_familiaris|13176              AAAAATTCAAGT------------GAAAAAGAATCATGCATTAAAAATTTCTATGAAGGT
Felis_catus|16327                   GTGCCAAAAGATTCAAGTGAAAAAGAAAAAGAATCACGCACGAAAAATTTCTATGAAGGT
Equus_caballus|9313                 TCAAGTGAAAAA------------GAAAAAGAGACATGTGCCAAGAGTTTCTATGAAAGT
Tarsius_syrichta|2954               GTGCCAACAAACCAA---------GACAGAGAACCCAGCGCCAAGAGTTTCTATGAAGGT
Callithrix_jacchus|11240            GTGGCAACAAAT------------GAAAAAGAATTAGGCACTAAGAGTTTCTATGAAGGT
Rhesus_macaque|23840                ---------------------------------------------------TACTATGGC
Pongo_abelii|19964                  ---------------------------------------------------TACTATGGC
Pan_troglodytes|25778               GTGGCAACAAAT------------GAAAAAGAATCAGACACTAAGAGTTTCTATGAAGGC
Gorilla_gorilla|11587               GTGGCAACAAAC------------GAAAAAGAATCAGACACTAAGAGTTTCTATGAAGGC
Homo_sapiens|61131                  GTGGCAACAAAT------------GAAAAAGAATCAGACACTAAGAGTTTCTATGAAGGC
                                                                                                

Nematostella_vectensis|8224         GTGGCAAAGTCACTGGCAGAGAGAATTGTCAAGAGTGCACTGCTGGCAGGCTCAATAGAC
Branchiostoma_floridae|6242         CTGGCTAAACTCATGGCTGAGAGACTGGTGCAGAGCGCCCTACTGGCAGGGTCTAGGGAC
Nematostella_vectensis|23553        CTAGCAAAGGCTCTCAGTGAACGACTTGTACAAAGTGCTCTTATGGCTGGCTCAAAGGAT
Xenopus_tropicalis|11325            ------------------------------------------------------------
Gallus_gallus|8502                  GCAGCAAGCTACATCAGTGAACAATTGGTAAAGGCTGCACTAGATGCAGGTTCAAGAGAT
Monodelphis_domestica|32120         GCAGCAGAATATGTAAGTCACGGACTTGTAAAAGCTGCAATGACAGCAGGATCCAGGGAG
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          GCAGCTGAATATATTAGCCAAGAACTTGTAAATGCTGCTTTAGCGGCTGGCTCCAGAGAC
Ornithorhynchus_anatinus|18147      GCAGCAGAATACATTAGCAAACAGCTGGTAAAGGTCGCTTTAACGGCAGGTTCTCGGGAT
Erinaceus_europaeus|17421           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Sorex_araneus|2780                  GCAGCTGAATATCTCAGTCATGAACTAGTGAATGCAGCTTTAGCAGCTGGGTCAAAAGAC
Mus_musculus|17846                  GCAGCTGAGTACATTGGCTGTGAACTTGTAAGTGCTGCAATAGAAGGGGGTTCCAGAGAC
Rattus_norvegicus|35105             GCAGCTGAGTACATTGGCTGTCAACTGGTAAGTGCTGCAATAGAAGGTGGTTCCAGAGAC
Cavia_porcellus|486                 GCAGCTGAGTATGTTAGCCGCGAACTTGTAAATGCTGCTTTAGAGGCTGGTTCCAGAGAC
Ochotona_princeps|11539             GCAGCTGAGCACGTCAGCCGAAAGCTTGTCCGCGCCGCTCTAAGCGCTGGCTCCAGGGAC
Bos_taurus|1081                     GCTGCCGCGTACGTCAGCCATGAGCTCGTCAACGCTGCTCTAGTGGCTGGCTCCAGAGAC
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             GCCGCTCAGTACGTAAGCCAGGAACTTGTAAACGCAGCGCTAACAGCCGGTTCCAGAGAC
Loxodonta_africana|16871            GCGGCTGCGTACGTTAGCCGGCAACTGGTAAAGGCCGCCTTAACGGCTGGCTCCAGGGAC
Spermophilus_tridecemlineatus|12389 GCAGCTGAGTATATTAGCCATAAACTTGTAAATGCTGCTTTAGAGGCTGGATCCAGAGAC
Tupaia_belangeri|9125               GCTGCTGAATACGTCAGCCATGAACTTGTCAATGCTGCTTTAGAGGCCGGCTCCAGAGAC
Vicugna_pacos|1326                  GCTGCTGAGTACATTAGCCATGAACTTGTGAACGCTGCTTTAGCGGCTGGCTCCAGAGAC
Pteropus_vampyrus|14421             GCAGCTGAGTATATCAGCCATGAACTTGTAAATGCTGCTTTAATGGCTGGCTCCAGAGAC
Canis_familiaris|13176              GCAGCCAAGTATATTAGCCATGAACTTGTAAGTGCGGCTTTAGTGGCTGGATCCAGAGAC
Felis_catus|16327                   GCAGCCAAGTATATTAGCCACGAACTTGTGAATGCTGCTTTAGTGGCTGGCTCCAGAGAC
Equus_caballus|9313                 GCAGCTGAGTATATTAGCCATGAACTTGTAAATGCTGCTTTAGCTGCTGGCTCCAGAGAC
Tarsius_syrichta|2954               GCAGCTGAGTACGTGAGTCATGAACTCGTGAACGCTGCTCTACAAGCTGGCTCCAGAGAC
Callithrix_jacchus|11240            GCAGCTGAGTATGTTAGCCATGAACTTGTAAATGCTGCTTTACTGGCTGGCTCCAGAGAC
Rhesus_macaque|23840                ------------------------------------------------------------
Pongo_abelii|19964                  ------------------------------------------------------------
Pan_troglodytes|25778               GCAGCTGAGTATGTTAGCCATGAACTTGTAAATGCTGCTTTACTGGCTGGCTCCAGAGAC
Gorilla_gorilla|11587               GCAGCTGAGTATGTTAGCCATGAACTTGTAAATGCTGCTTTACTGGCTGGCTCCAGAGAC
Homo_sapiens|61131                  GCAGCTGAGTATGTTAGCCATGAACTTGTAAATGCTGCTTTACTGGCTGGCTCCAGAGAC
                                                                                                

Nematostella_vectensis|8224         AATCTGACAGTTTGTTCTGTGCTTCTGCCTGGATTTTCGCTAGTCAACGTCTGCACCATT
Branchiostoma_floridae|6242         AATATCACTGTCATGGTTGTGCTACTGCCTGGCTGCAAG---------------ATT---
Nematostella_vectensis|23553        AACACAACAGTAGCCGTAATATTGTTGAAAGGCTGTCCTCTGCAAATGTTCCTTTTGCCA
Xenopus_tropicalis|11325            ---------------------------------------------AAGTTGCTTCTC---
Gallus_gallus|8502                  AATATCACTGTTTTGGTTGTACTTCTAAACGGATGTGAT---------AAGTTACCA---
Monodelphis_domestica|32120         AACATTACGGTGCTGGTGGTAGTTCTCGAAGGATGTGAC---AGTCAGTTACAAGGA---
Macropus_eugenii|6140               ------------------------------------------------------------
Dasypus_novemcinctus|15278          AACATTACAGTTATGGTAATACTTCTTAAAGGAAGTGAA---TATCAATTTTTGACA---
Ornithorhynchus_anatinus|18147      AACATCACTGTTTTGGTGGCACTTCTCAGGGGCTGTGAAAACTATTCAAATCTGAGC---
Erinaceus_europaeus|17421           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAAAGTGAG---TATCAACTTCTGACA---
Sorex_araneus|2780                  AACATTACAATTATGGTAATACTTCTCAGTGGACTGGAG---TATCAAATTAATCTA---
Mus_musculus|17846                  AGCATCACTGTTATGGTAATGTTTCTCAATGGGAGCGAG---TATCACAGGCTGACA---
Rattus_norvegicus|35105             AGCATCACTGTTATGGTAATGTTTCTCAATGGAAGTGAG---TATCACAGGCGGACA---
Cavia_porcellus|486                 AATATTACAGTTATGGTAATATTTCTCAATGGAAGTGAG---TATCAGTTGCTGATA---
Ochotona_princeps|11539             AACATCACCGTTATGGTAGTATTTCTCAATGGA------------CGACTTCCTACA---
Bos_taurus|1081                     AGCATCACAGTCATGGTGATACTGCTCAGCGGAGCCGAG---CATCAGCTGCTGCCA---
Myotis_lucifugus|11869              ------------------------------------------------------------
Procavia_capensis|10079             AACATTACAGTGGTGGTCATACTTTTCAGTGGAAGTGAG---TATCAGTTTCGGATA---
Loxodonta_africana|16871            AACATTACAGTTGCGGTGATACTGCTCAGCGGATGTGAG---TATCAGTTTCTGATA---
Spermophilus_tridecemlineatus|12389 AACATTACAGTTATGGTAATATTTCTCAGTGGAAGTGAA---TATCACTTGCTGCCA---
Tupaia_belangeri|9125               AATGTTACAGTTATGGTGATATTTCTCAATGGAAGTGAG---TACCAGTTTTTAACA---
Vicugna_pacos|1326                  AACATTACAGTTATGGTAATACTGCTCAGCGGAAGTGAG---TATCAGTTTCAAATG---
Pteropus_vampyrus|14421             AACATTACAGTTATGGTAATACTTCTCAATGGAAGTGAA---TATCAGTTTCTGATA---
Canis_familiaris|13176              AACATTACAGTCATGGTAATACTTCTCAAGGGAAGTGAG---TATCAGTTTCTGACA---
Felis_catus|16327                   AACATTACAGTCATGGTAATACTTCTCAATGGAAGCGAG---TATCAGTTTTTGATG---
Equus_caballus|9313                 AACATTACAGTTATGGTAATTCTCCTCAGTGGAAGTGAA---TAT---------------
Tarsius_syrichta|2954               AACATCACGGTTATGGTCATACTTCTCAATGGAAGTGAG---TATCAGTTTCTGGCA---
Callithrix_jacchus|11240            AACATTACAGTTATGGTAATATTTCTCAATGTTACACAA---TATCATTTATATACG---
Rhesus_macaque|23840                ------------------------------------------------------------
Pongo_abelii|19964                  ------------------------------------------------------------
Pan_troglodytes|25778               AACATTACAGTTATGGTAATATTTCTCAATGGAAGTGAA---TATCAGCTTCTGACA---
Gorilla_gorilla|11587               AACATTACAGTTATGGTAATATTTCTCAATGGAAGTGAG---TATCAGCTTCTGACA---
Homo_sapiens|61131                  AACATTACAGTTATGGTAATATTTCTCAATGGAAGTGAA---TATCAGCTTCTGACA---
                                                                                                

Nematostella_vectensis|8224         ACCCCTGAACTGATACAAAAACTTGATAGACCAGTAACTGGTGATTGGTAA
Branchiostoma_floridae|6242         ------------------------------------------------TGA
Nematostella_vectensis|23553        TCCTTGCGACAG------------------------------------TAA
Xenopus_tropicalis|11325            ---------------------------------------------------
Gallus_gallus|8502                  ---------------------------------------------------
Monodelphis_domestica|32120         ---------------------------------------------------
Macropus_eugenii|6140               ---------------------------------------------------
Dasypus_novemcinctus|15278          ------------------------------------------------TAA
Ornithorhynchus_anatinus|18147      ---------------------------------------------------
Erinaceus_europaeus|17421           ---------------------------------------------------
Sorex_araneus|2780                  ---------------------------------------------------
Mus_musculus|17846                  ------------------------------------------------TAA
Rattus_norvegicus|35105             ------------------------------------------------TGA
Cavia_porcellus|486                 ------------------------------------------------TAA
Ochotona_princeps|11539             ------------------------------------------------TAA
Bos_taurus|1081                     ------------------------------------------------TGA
Myotis_lucifugus|11869              ---------------------------------------------------
Procavia_capensis|10079             ---------------------------------------------------
Loxodonta_africana|16871            ------------------------------------------------TAA
Spermophilus_tridecemlineatus|12389 ---------------------------------------------------
Tupaia_belangeri|9125               ---------------------------------------------------
Vicugna_pacos|1326                  ---------------------------------------------------
Pteropus_vampyrus|14421             ---------------------------------------------------
Canis_familiaris|13176              ------------------------------------------------TAA
Felis_catus|16327                   ------------------------------------------------TAA
Equus_caballus|9313                 ---------------------------------------------------
Tarsius_syrichta|2954               ------------------------------------------------TAA
Callithrix_jacchus|11240            ---------------------------------------------------
Rhesus_macaque|23840                ------------------------------------------------TAA
Pongo_abelii|19964                  ------------------------------------------------TAA
Pan_troglodytes|25778               ---------------------------------------------------
Gorilla_gorilla|11587               ---------------------------------------------------
Homo_sapiens|61131                  ------------------------------------------------TAA
                                                                                       

multiple sequence alignment in CLUSTALW format


Nematostella_vectensis|24168        MLHSEKIQLEPVAIEKCDDEDEGHSLLDQSRPKSERLDDYVLVKMNQIRKTSGFAYGFLK
Branchiostoma_floridae|7042         -------------------------------------------------------MIKPQ
Nematostella_vectensis|15853        ------------------------------------------------------MHAVTV
Xenopus_tropicalis|8052             -------------------------------------------------------RKNRN
Gallus_gallus|14005                 ------------------------------------------------------------
Monodelphis_domestica|18464         ------------------------------------------------------------
Macropus_eugenii|5598               -------------------------------------------------------NISPP
Dasypus_novemcinctus|13505          -------------------------------------------------------NIFHP
Ornithorhynchus_anatinus|13337      ------------------------------------------------------------
Erinaceus_europaeus|14318           -------------------------------------------------------DIFHP
Sorex_araneus|2466                  -------------------------------------------------------NNFCL
Mus_musculus|20976                  ----------------------------------------------------MNWELYSS
Rattus_norvegicus|20976             -----------------------------------------------------MDFEIYS
Cavia_porcellus|331                 -------------------------------------------------------MNVSS
Ochotona_princeps|10069             -------------------------------------------------------FFFYP
Bos_taurus|22700                    --------------------------------------------------KNWLVRQSQP
Myotis_lucifugus|10667              -------------------------------------------------------NIFPP
Procavia_capensis|9436              -------------------------------------------------------TIFHP
Loxodonta_africana|5101             -----------------------------------------------------HVNIFHP
Spermophilus_tridecemlineatus|11101 ------------------------------------------------------------
Tupaia_belangeri|7919               -------------------------------------------------------NIFLP
Vicugna_pacos|1237                  ------------------------------------------------------------
Pteropus_vampyrus|13583             -------------------------------------------------------NTFHP
Canis_familiaris|16285              ----------------------------------------------------WHVNIVYP
Felis_catus|14904                   -------------------------------------------------------NIFYP
Equus_caballus|16255                ------------------------------------------------------------
Tarsius_syrichta|2709               ------------------------------------------------------------
Callithrix_jacchus|4062             -------------------------------------------------------MSISN
Rhesus_macaque|10521                -------------------------------------------------------MSANN
Pongo_abelii|3859                   -------------------------------------------------------MSTNN
Pan_troglodytes|12648               -------------------------------------------------------NIFHP
Gorilla_gorilla|9628                -------------------------------------------------------ISTNN
Homo_sapiens|47250                  -------------------------------------------------------MSTNN
                                                                                                

Nematostella_vectensis|24168        SHGDFARSKTSARHTTASRTVNPVEDKSKMAKQDTVSDKFASVTVNLISEVASERKDVEE
Branchiostoma_floridae|7042         LVH--------SDSEQSSNS----------------------------------------
Nematostella_vectensis|15853        ALREQSSSSGLEETSSSANN----------------------------------------
Xenopus_tropicalis|8052             ILRNFWNGY---------------------------------------------------
Gallus_gallus|14005                 ------------------------------------------------------------
Monodelphis_domestica|18464         ------------------------------------------------------------
Macropus_eugenii|5598               VCRMLWRSKVSNMKMTTSEN----------------------------------------
Dasypus_novemcinctus|13505          VCRVFWKSRNWHASKS--NA----------------------------------------
Ornithorhynchus_anatinus|13337      ------------------------------------------------------------
Erinaceus_europaeus|14318           VCRVYMRARTL-------------------------------------------------
Sorex_araneus|2466                  IFRVL-NARQWFKNSRQFES----------------------------------------
Mus_musculus|20976                  PLRVFWRSKVWDEKTSTFTS----------------------------------------
Rattus_norvegicus|20976             PVRVFLKSKQWDEKTSKFTS----------------------------------------
Cavia_porcellus|331                 ALRVFGKSREWDRKKSTFDS----------------------------------------
Ochotona_princeps|10069             LCRVFWKQRKWNLRKSIFDS----------------------------------------
Bos_taurus|22700                    VHRVFWKARQLYTRKPTADS----------------------------------------
Myotis_lucifugus|10667              ACRIFWRVMKWNMKK--YDS----------------------------------------
Procavia_capensis|9436              LCRVFWKSREWRRKASTYEF----------------------------------------
Loxodonta_africana|5101             LCRVFWKSREWKMRISTFDS----------------------------------------
Spermophilus_tridecemlineatus|11101 ------------------------------------------------------------
Tupaia_belangeri|7919               IGRVFWKSKKWNMRTSTLNS----------------------------------------
Vicugna_pacos|1237                  ------------------------------------------------------------
Pteropus_vampyrus|13583             VCRVFWKSRDWNERKSTFDS----------------------------------------
Canis_familiaris|16285              VCRVFWKSREWNVRKSTHDS----------------------------------------
Felis_catus|14904                   VCRVFWKSREWNVRKSTFNS----------------------------------------
Equus_caballus|16255                ------------------------------------------------------------
Tarsius_syrichta|2709               ------------------------------------------------------------
Callithrix_jacchus|4062             ALRVFWKSREWNTRTSTFDT----------------------------------------
Rhesus_macaque|10521                ALRVFWKSREWNMKTSTFDS----------------------------------------
Pongo_abelii|3859                   ALRVFWKSREWNMKTSAFDS----------------------------------------
Pan_troglodytes|12648               VCRVFWKSREWNMKTSTFDP----------------------------------------
Gorilla_gorilla|9628                ALRVFWKSREWNMKTSTFDS----------------------------------------
Homo_sapiens|47250                  ALRVFWKSREWNMKTSTFDS----------------------------------------
                                                                                                

Nematostella_vectensis|24168        DERKAHGRLDLGLIDETADSLSRRESSARENQSTEKGGEDSDGESSEQHEFTSVYSENSS
Branchiostoma_floridae|7042         --------------DQEELQGPSTTGRRTTRYTGTRKGREDGAKSPETLITDYPIK----
Nematostella_vectensis|15853        --------------SPEKSLSPRTSYLSDLHLP-PIDQKSGDEIIEPIKEVT--------
Xenopus_tropicalis|8052             --------------EKGATIFRKIAKYRSLRKKRNRPVRGKKSLRSDDDDVN--------
Gallus_gallus|14005                 ------------------------------------------------------------
Monodelphis_domestica|18464         ------------------------------------------------------------
Macropus_eugenii|5598               --------------SDEENLDFPTTKLSKKQ---KEELRIPPLQKLQVHAYR--------
Dasypus_novemcinctus|13505          --------------ARGIPSLGKKKHSRKKR----KPSTHSEDCGELQD-FE--------
Ornithorhynchus_anatinus|13337      ------------------------------------------------------------
Erinaceus_europaeus|14318           --------------EEEIPTPVGRKPFRKKR------ARSLESEVTQQDYYT--------
Sorex_araneus|2466                  --------------DDETLLPKGSKHSKRKS------LRNTEQQHH----GD--------
Mus_musculus|20976                  --------------DENLKIGKMVGKRRRPR---PKRSIDLEDSTEQLISGD--------
Rattus_norvegicus|20976             --------------DEALPTVRTNVRRRSRLPRMNDPEESTDQLTSVDMG----------
Cavia_porcellus|331                 --------------DEDISPVLKKESFPKKQ---SSPSEHSADYNEPQD-FQ--------
Ochotona_princeps|10069             ----------------DVNLSLRKRSSKKKK---AKFSKKNKDAKEQSA-SD--------
Bos_taurus|22700                    --------------EYEVPLTWKRKHFKRKK---KRPSKEVSEKHSLVQDYN--------
Myotis_lucifugus|10667              --------------EEEFLVLWRRKHFRRKE---ERPSCYAADQQEQQL-RD--------
Procavia_capensis|9436              --------------DEAILTSLKKKYLRKRRRRRKRLLKNIDRHEDEELTSE--------
Loxodonta_africana|5101             --------------DEEISTSYKRKKKRKKR-----PLENIDDHKEQES-SE--------
Spermophilus_tridecemlineatus|11101 ---------------------------------------------------K--------
Tupaia_belangeri|7919               --------------NEGIPRSLRRRRGKRKK---SKPSEDIELDDERQI-YD--------
Vicugna_pacos|1237                  ------------------------------------------------------------
Pteropus_vampyrus|13583             --------------GEEIPPPCRKKPVRKKKKE-ERPKRDSEDYQDQVITCD--------
Canis_familiaris|16285              --------------DQETPLSLRRRYFRRKKTRLSRYSKYSEDHEKPQS-CD--------
Felis_catus|14904                   --------------DQEIPLSLRRRYFKRKKK--GRPSRDSEEYDKQQV-GD--------
Equus_caballus|16255                ------------------------------------------------------------
Tarsius_syrichta|2709               ------------------------------------------------------------
Callithrix_jacchus|4062             --------------DE-FLLLPKRRRFRKKR---SRALRDTKSHEEEQV-YE--------
Rhesus_macaque|10521                --------------YVDISLLPKRKRFRKKK---PRPVRHTKRHEEEQV-YE--------
Pongo_abelii|3859                   --------------DEDILLLPKRKRFRKKK---SRPVRHTKRHEEEQV-YE--------
Pan_troglodytes|12648               --------------DEDILLLPKRKRFRKKK---SRPVRHTKRHEEEQV-YE--------
Gorilla_gorilla|9628                --------------DEDILLLPKRKRFRKKK---SRPARHTKRHEEEQV-CE--------
Homo_sapiens|47250                  --------------DEDILLLPKRKRFRKKK---SRPVRHTKRHEEEQV-YE--------
                                                                                                

Nematostella_vectensis|24168        EGETRLALPNIVLPCSKCGESINICRLQSHRDLHNALQVLKFA--HGYKPASTNALIKRR
Branchiostoma_floridae|7042         --------PDITIQCEQCRNFMDIRDFSEHRTFHKALKMYGYQ--GDADPNSLEELIERR
Nematostella_vectensis|15853        --------EGIKLLCMTCEEEIRVQDLKIHREFHRALQI--FRYTMDNKPNTVKQLVTRR
Xenopus_tropicalis|8052             ---------EVWIPCSICKLPINPHCHCHHKQQHKAETQLGYK--PSQIPRSIRNLSSKR
Gallus_gallus|14005                 ----------ISILCSVCQQAIYPHHLFNHKKTHKALTLLGYD-SSQTRL-DNETLLAQR
Monodelphis_domestica|18464         ----------LTIPCSLCNEELRPSEFFIHKKKHKAMGVLGYTWVAGEKP-ERHKVLTKR
Macropus_eugenii|5598               ----------LTIPCSLCNQELHPSQFFAHKKQHKAMAVMGYKMTAREKP-ERNKLIEQR
Dasypus_novemcinctus|13505          --------QAITFPCSTCGHEIDPHSFFFHKKQHLALVTLGFS-LSGKIP-QQSMMIVQR
Ornithorhynchus_anatinus|13337      ----------IKFPCSVCKQDTCPSDFFYHKKLHKAMATMGFQWSKGRRP-DRKTLTLQR
Erinaceus_europaeus|14318           --------QDPTFPCSTCNREIDIPGTFHHKKRHVALATLGVQWDGIKRL-GSSEIILQR
Sorex_araneus|2466                  --------QEITVPCSKCKNEIILPNFFLHQKQHVALYTLGFEWTDRNNL-EPSVIADHR
Mus_musculus|20976                  ---------MVTFPCSVCYRELNKARNFLHKKHHNALSMLGFQWMGGRQP-KPKLVSLHR
Rattus_norvegicus|20976             --------DMVTFPCSVCHQELNTAGNFLHKKHHNALSTLGFEWMGGRKP-KPKMVSFHR
Cavia_porcellus|331                 --------PGITFPCSLCKEEIEITGAFFHKKEHIAQATLGLRWLDRTKQ-PSTKTVVQR
Ochotona_princeps|10069             --------HVITFPCSTCKQEIDIRGAFGHKKQHVALATLGFQWLGGKMP-RFFAIASHR
Bos_taurus|22700                    --------AMLTFPCSICKREVGLPGVFSHKKQHMALSTLGLQWTGGKKP-GLSAIIGQR
Myotis_lucifugus|10667              --------QAITIPCSICKKEIDLTGFFLHKRQHEALAALGLEWKRGMKP-THSAISSKR
Procavia_capensis|9436              --------QLITFPCFTCKHEIDPPGSFFHKKQHTALTSLGFDWMGEKKP-LRSEIVAQR
Loxodonta_africana|5101             --------QAITFPCSICKHEIDLPGFFFHKKQHIALTSLGFHWMGEKIP-LRSEIVAQR
Spermophilus_tridecemlineatus|11101 --------REITFPC-LCKQEIVTTGIFFHKKQHAVLATLDFPWMGGRKP-PFSVLDAQR
Tupaia_belangeri|7919               --------ETITLPCSTCKHEVDVRGVFFHKKQHIALATLGFHWLGGRKP-LPSATAMQR
Vicugna_pacos|1237                  ------------------------------------------------------------
Pteropus_vampyrus|13583             --------QVITFPCSKCKCEIDLPGVFLHKKQHAALTTLGFQWIGGNKP-GHSVIAIQR
Canis_familiaris|16285              --------QMITFPCSICKHEIDLRETFLHKKQHMALATLEFQWMGEKKP-ALPVITIQR
Felis_catus|14904                   --------HMITFPCSICKHEIDVREIFLHKKQHVAWATLGFQLMGGKKP-GPSVIAIQR
Equus_caballus|16255                ----------ITFPCSICKHEIEPSGTFFHKKQHIALATLGFHWMGRKKP-GPSVIAIQR
Tarsius_syrichta|2709               -----------------------------------------------KKP-QSSVIILQR
Callithrix_jacchus|4062             --------QVTTLPCFICKQEIDLSGVFLHKKQHVALATLGFQWMGGKKP-QPSVIAVQR
Rhesus_macaque|10521                --------QATTLPCSICKHEIDLTGIFPHKKQHVALATLGFQWMGGKKP-QPSVIAVQR
Pongo_abelii|3859                   --------QRTTLPCSICKHEIDLPGIFLHKKQHIALATLGFQWMGRKKP-QPSVIAVQR
Pan_troglodytes|12648               --------QGTTLPCSICKHEIDLTGIFLHKKQHVALATLGFQRMGRKKP-QPSVIAVQR
Gorilla_gorilla|9628                --------QGTTLPCSICKHEIDLTGIFLHKKQHVALATLGFQWMGRKKP-QPSVIAVQR
Homo_sapiens|47250                  --------QGTTLPCSICKHEIDLTGIFLHKKQHVALATLGFQWMGRKKP-QPSVIAVQR
                                                                                                

Nematostella_vectensis|24168        KLIIQRMQESSAQRGDKGFSD----RQLQKINTAFEILKTSLGGRM-DSFRLLSNSLD-V
Branchiostoma_floridae|7042         KRLLKRLTSEAT------PEKPISQDKLRKINDAYELLKSDLEGTF-EVFRQIREDIQVD
Nematostella_vectensis|15853        RSLMRKLNENAN------FENPVSIRKLQKLNAAYELLKSNLVDRW-GTLREVALVDPKE
Xenopus_tropicalis|8052             REVISYIKDHCG------YKQ----ALIHNVDRSYDILKRIQITPI-KDIRRISPQDFEK
Gallus_gallus|14005                 QKLISKVTKLPK------NSE----RHRQKINDSFEFLMDG---HA-STLYCDLDNT--N
Monodelphis_domestica|18464         QFLISTFIEAHL------YNE----KTKRSLDSACEFLCKH---PV-PSYYKIFSTSF-N
Macropus_eugenii|5598               TSLISTLIEAYL------YDE----KTRQNIDNACELLCKQ---HI-PSYYKILSNSF-N
Dasypus_novemcinctus|13505          QILISQLLSASL------FNE----KTLQSINHAFELLWKK---QV-PAYYKIIDSID-N
Ornithorhynchus_anatinus|13337      QCLLSKLMEASL------FNQ----KIRQSIDSSYELLKKR---KE-SESFNILPSVV-E
Erinaceus_europaeus|14318           KLIIAKLLSSST------LTE----KHLHSINSAFELLWKK---EL-PEYYKICESSP-G
Sorex_araneus|2466                  QDLITKLLAVEK------LNE----KNLKNINNAFELLWEK---QL-RSNCMITDYIQ-R
Mus_musculus|20976                  ECIISNLLRSST------YNE----KVLHNVNYAFEFLWKK---QV-PSYFKLCDKVG-E
Rattus_norvegicus|20976             ECIISNLLRSST------YSE----KVLQSMNYAFELLRKK---QI-PSYFKLCDKVG-E
Cavia_porcellus|331                 QVLIANLLSSFM------FNE----KVLQSINNAFELLWKK---QM-PAASKVSDSIS-R
Ochotona_princeps|10069             QFIISKVMSSFI------FSE----KILQIINDAFELLRKK---QI-PGYYKILDSTD-R
Bos_taurus|22700                    QSVITKLLSSFA------FNE----KTLQSINNAFELLWKR---QI-PAYYKIMQNIC-E
Myotis_lucifugus|10667              KFTITKLLTSST------YSE----KGLDSMNNALELLWKK---QI-PAYYKIMDNIP-N
Procavia_capensis|9436              RSLITNLLSSFT------FSE----KALQIINNAFELVWKK---QV-PEYYKIIDNIA-G
Loxodonta_africana|5101             QLLITKLLSSRI------FSE-----KLQTVNNAFELIWKK---QV-PAYYKIIENID-N
Spermophilus_tridecemlineatus|11101 QFIISQLLSSFE------FNE----KILQNINNAFELLEKK---QI-PLYYKIIDYID-G
Tupaia_belangeri|7919               QLIISKLLSSFT------LTE----KILQSINYAFELLWKK---KI-PAYYKIFDNLD-G
Vicugna_pacos|1237                  -----------------------------------------------------------K
Pteropus_vampyrus|13583             QFIITKLLSSFT------FTE----QILQSIDHAFELLWKK---QI-PAYYKIIDNIN-S
Canis_familiaris|16285              QFIITKLLSSSL------FTE----KILESINYAFELLWQK---QI-PAYYKMIDNVH-R
Felis_catus|14904                   QLIIAKLLSSSR------FTE----KILQSINNAFELLWKK---QI-PAYFKIVDSIH-R
Equus_caballus|16255                QFVITKVLSFSL------FSE----RVLQSINNAFELLWNK---EI-PQYYKIVDNIH-M
Tarsius_syrichta|2709               QFVISKLLSSAS------LTE----KSLQSINRAFELLWKK---QI-PAYYKIFEDVHGR
Callithrix_jacchus|4062             QFMISKLLSSFM------LTE----KNLQSINNAFELLWKK---QIPPAYYKIFDNID-R
Rhesus_macaque|10521                QFMISKLLSSFM------FTE----KTLQSINNAFELLWKK---KI-PAYYKIFDNID-R
Pongo_abelii|3859                   QFMISKLLSSFM------LTE----KTLQSINNAFELLWKK---QI-PAYYKIFDNID-R
Pan_troglodytes|12648               QFMISKLLSSFT------FTE----KTLQSINNAFELLWKK---QI-PAYYKIFDNID-R
Gorilla_gorilla|9628                QFMISKLLSSFM------FTE----KTLQSINNAFELLWKK---QI-PAYYKIFDNID-R
Homo_sapiens|47250                  QFMISKLLSSFM------FTE----KTLQSINNAFELLWKK---QI-PAYYKIFDNID-R
                                                                                                

Nematostella_vectensis|24168        HVSEGRGDRLSCTKAVGVCEEVNARWK-NMEDAHHLQDDFLPQTPSCFIGIYDGYCGGTT
Branchiostoma_floridae|7042         IEGIALNCSALCARAVGICADANPRWRTSMEDFGVFQNHFGEDPNKTFFALYDGHHGPFA
Nematostella_vectensis|15853        YHVMGQSTLLNCALAFGICEDKNSRWKTTMEDRHTFCDYFCNDPQSGFFAVFDGYNGATA
Xenopus_tropicalis|8052             TLVCKTDKINALIPSIAVCCDKNPSWQRDMEDSFVILDKYGGRSDTCLVGIFDGCRGKSA
Gallus_gallus|14005                 SVNTLKNVKNSSIKALSICQDKNSMWQRDMEDRFFVVDNYGSRSDTCFLGLIDGHHGTTA
Monodelphis_domestica|18464         SSVHFMKTNNPLVKSVAICEDQNKTWRPVMEDRYIFRGKFGQKFNTCYFGLFDGHHGSVA
Macropus_eugenii|5598               SSVHLRKTDNPLVNAVAICEDQNKSWRPVMEDRYIFRNRFGKKSNACFFGLFDGHHGSVA
Dasypus_novemcinctus|13505          SSIYSQKISLALIKGVAVCEDRNATWRADMDDKFTVVNNFGNKPNVSLLGLFDXXXXXXX
Ornithorhynchus_anatinus|13337      SSVHLREINNPLIHAVAICEDRNSPWRVDMEDTFIILDNYGNRSNVCFFGLFDGHHGAVA
Erinaceus_europaeus|14318           NSSYTENISTLLIKGVAICADRNSTWKADMNDKVTVVNNFGSKPNVCFFSLFAGHKGASA
Sorex_araneus|2466                  SAVQLKNVCHLLVKGVAVCNDRNTIWKASMNDRFTIVNEFGHKPDVCFLGLFDGHHGATA
Mus_musculus|20976                  TSTYSPNSNHLMIKGIAICSNNNSAWKAEPNCKFTVVNDFGDKANVCFFGLFDSHYGYAA
Rattus_norvegicus|20976             TSIYSPTSYHLLIKGIAICSNSNSTWKAEPNCKFTVVNDFGDKANVCFFGLFDSHHGYAA
Cavia_porcellus|331                 SYAYSQKTHHLLIKGVATCEFRNPTKKADTNSKFTIINNFGSKPNVCFFGLFDGHRGFPA
Ochotona_princeps|10069             SSTTSHKVCHLLIKGVAICEDMNSTWRHDMNDKFTVLNHFGNKPNVCFFGLFDGCHGAAA
Bos_taurus|22700                    SSIHPQKIGHLLIKGAAVCKDRNSTWRVDMNNKFIVVNNFGSKPNVCFFGLFDGHHGDSA
Myotis_lucifugus|10667              SSIYSQKIRHLLIKGAAICNDKNSTWKVHMNDRFTVVNHFGSKPNVCFFGLFDGHHGPSA
Procavia_capensis|9436              SSVYPQQVNHLLIKGVAICEDRNSAWRTTMEDKFTVVNSFGNKSNVCFLGLFDGHCGVSA
Loxodonta_africana|5101             SSVYSQKVCHLLIKGVAICEDRNSTWRATMEDKFAIVNNFGNKSNVCFFGLFDGHHGVSA
Spermophilus_tridecemlineatus|11101 SSVSSQHIPHLLIKGVAICRDRNAAWKVDMNDKFTVMNNFGNKPNVCFFGLFDGHHGAAA
Tupaia_belangeri|7919               SSTYSPQICHVLIKGLAICEDRNSTWKADMNDMFTIVNNFGNKPNVCFLGMFDGHHGSSS
Vicugna_pacos|1237                  SSTY-QKICHLL-KGAAICEDRNSTWRVDMNDKFTIVNNFGNKPNVCFFGLFDGHHGASA
Pteropus_vampyrus|13583             SSTYFQKICHLLIKGVAVCENRNSTWRVAMNDRFTVVNNFGNKPNVCFFGLFDGHHGAPA
Canis_familiaris|16285              SSIYSQTISHVLIKGVAICEDGNSAWKADMNDKFTVVDNFGKKPDVCFFGLFDGHHGASA
Felis_catus|14904                   SSTHPQTICHLLIKGVAICEDRNSTWRADMNDKFTVVNNFGNKHNVCFFGLFDGHHGVSA
Equus_caballus|16255                SSTYSQKVCHLLIKGVAICEDRNSTWKANMNDKFTVVNRFGNKPNVCFFGLFDGHHGASA
Tarsius_syrichta|2709               SSTYPQKTCHLLIKGVAISKNRNSTWKANMNDTFTVVDHFGNRPNVCFFGLFDGHHGVSA
Callithrix_jacchus|4062             SVVYSQKICHLLIKGVGICEDRNSTWKANMNDKFTVVSNFGNKPNVCFFGLFDGHHGASA
Rhesus_macaque|10521                SVIYSQKIRHLLIKGVGICEDRNSTWKADMNDKFTVVSNFGNKPNVCFFGLFDGHHGASA
Pongo_abelii|3859                   SVIHSQKICHLLIKGVGICEDRNSTWKADMNDKFTVVSNFGNKPNVCFFGLFDGHHGASA
Pan_troglodytes|12648               SVIYSQKICHLLIKGVGICEDRNSTWKADMNDKFTVVSNFGNKPNVCFFGLFDGHHGASA
Gorilla_gorilla|9628                SVIYSQKICHLLIKGVGICEDRNSTWKADMNDKFTVVSNFGNKPNVCFFGLFDGHHGASA
Homo_sapiens|47250                  SVIYSQKICHLLIKGVGICEDRNSTWKADMNDKFTVVSNFGNKPNVCFFGLFDGHHGASA
                                                  . . .   *   :   :    . . :        ..:         

Nematostella_vectensis|24168        ARKCASQLHQLVSEQLASH-----TDLTKTD------FKTAFRRS----YARF----QEL
Branchiostoma_floridae|7042         AEVASDELHRYLIEEVAKFDPDVVYDRPDDLQHPEDYLNLTDKDETAVTYRSVNQDGETA
Nematostella_vectensis|15853        AGTSAKTFPEVLARKV---ESV--YRPGLASEGVDAKITTALRET----YEDV-------
Xenopus_tropicalis|8052             ACTMAREFPTLFLGQLLNLDPS--YTITDKEKRFLDSLDTVFKDH----YKDA----EKH
Gallus_gallus|14005                 AETVAAELPLLFLDQLAQTDPS--CRMTKEEQQILDSFATVITED----YRKK----ERI
Monodelphis_domestica|18464         AETSAAELHKFLLEQLSQYDPS--YKMTSKQQKFVHSFNTVFRRD----YRTQ----EYH
Macropus_eugenii|5598               AETTAVELPKFFLDQLAQYDSS--YRMTKREKRFVHSFDTVFKEA----YRRQ----EYL
Dasypus_novemcinctus|13505          XXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXX----XXXX----XXX
Ornithorhynchus_anatinus|13337      ANTARKELPILLLDQLSKFDSS--YQMTKEDQQMIDSFDTVITAE----FRKL----EDI
Erinaceus_europaeus|14318           ADLASTELPVLLLHQLSRIDPS--YQMTLEEQNLINSFGTVFKEH----YTAT----EDF
Sorex_araneus|2466                  ADLTAMELHILLLHQLAQFDPS--YQMTLQEQEVINSFCTVFKKE----YTCI----EEL
Mus_musculus|20976                  ADLASKEFQVLLLHQLSIQDPS--YQMTAEQKQLINSFDTVFREE----YRAR----EEA
Rattus_norvegicus|20976             ADLASKEFQVLLLHQLSVQDPS--YQMTAEQQDLINSFHTVFREE----YRAR----EEA
Cavia_porcellus|331                 ADLVSTELPVLLLHQLSKFDPS--YQMTPEQQQVIDSFHSIFRED----YTAT----EAL
Ochotona_princeps|10069             AGLAATELPVLFLHQLSNFDPS--YQMTQEQQKMIHSFHTVFRKE----YTAL----EDL
Bos_taurus|22700                    ADLTSMELPVLLLHQLSRLDPS--YQMTSEEQKVINSFNTVFSED----YRAI----EES
Myotis_lucifugus|10667              ADFTSKELPVLLLHQLSGFDPS--YQMTPEEQKLINSFHTVFREE----YIAL----ESL
Procavia_capensis|9436              ADLASMELPVLLLHQISRFDPS--YQMTPEQQKVIDSFHTVFKEE----YIRI----EDR
Loxodonta_africana|5101             AELASMELPVLLLHQISRFDPS--YQMTPEQQKLIDTFHTVFKEE----YRKI----EDR
Spermophilus_tridecemlineatus|11101 ADLASAELPILLLHQLSKFDPS--YQMTTEQQEIINSFHTVFREE----YTAI----EDL
Tupaia_belangeri|7919               ADLASMELPILLLHQLSKLDPS--YQMTPEEQQVINSFHTVFREE----YTAI----EDF
Vicugna_pacos|1237                  ADLTSVEFPVLLLHQLSTLDPS--YQMTSDEQSTIDSFHTVFRAD----YTAV----EDL
Pteropus_vampyrus|13583             ADLASIELPVLLLHQLSRFDPS--YQMTPQEEKLISSFHTVFREE----YRAI----ENF
Canis_familiaris|16285              ANLTSVELPILFLHQLSRFDPS--YHMTSEEQNVINSFLTVFREE----YIAK----EEL
Felis_catus|14904                   AELTSVELPVLLLHQLSRFDPS--YQMTPEEQNIIESFHTVFREE----YIAI----EEL
Equus_caballus|16255                ADLSSVELPVLLLHQLSRLDPS--YQMTPKEQKVIDSFHTVFREE----YTAI----EDF
Tarsius_syrichta|2709               AELTSRELPVLILHQLSQIDPS--YQMTPAEWQIVDSFHTVFRED----YTVA----EDL
Callithrix_jacchus|4062             AELTSVELPVLLLHQLSKFDPS--YQMTADEQQIINSFCTVFREE----YTAI----EDL
Rhesus_macaque|10521                AELTSMELPVLLLHQLSKFDPS--YQMTTDEQQIINSFYTVFREE----YTAI----EDL
Pongo_abelii|3859                   AELTSMELPVLLLHQLSKFDPS--YQMTTDEQQIINSFYTVFREE----YTAI----EDL
Pan_troglodytes|12648               AELTSMELPVLLLHQLSKFDPS--YQMTTDEQQIINSFYTVFREE----YTAI----EDL
Gorilla_gorilla|9628                AELTSMELPVLLLHQLSKFDPS--YQMTTDEQQIINSFYTVFREE----YTAI----EDL
Homo_sapiens|47250                  AELTSMELPVLLLHQLSKFDPS--YQMTTDEQQIINSFYTVFREE----YAAI----EDL
                                                                                                

Nematostella_vectensis|24168        LRT--------------------------------RTEDEERSRNRWSGCSALTCVVTPS
Branchiostoma_floridae|7042         RSTKTGEQATVPSDPYTEDVATAFRRAHQQTDWVLTRGRDEQSRVRWSGCSTLTCLVQST
Nematostella_vectensis|15853        -------------------------------DRILLYGVDEDSRNRWSGCSAVTCLLRGN
Xenopus_tropicalis|8052             FSS-ALYEKASSEMDI-KAIHIAYAKAFWRMDRILQLGRKESSRAIWSGCSSVSCLFDGF
Gallus_gallus|14005                 FSD-RQENKTHKTNTY-EWIHKAYAKAFWRMDRLLQLGRNEVSRVRWSGCSVVTCLMERL
Monodelphis_domestica|18464         FSS-----QRKSNCSY-ELVHKAFAKAFWRMDRVLKLGRQEMSSFYWSGCSAVTCLLECD
Macropus_eugenii|5598               FSS----KREILTCDY-EWIHRAFAKAFWRMDRVLKLGRQEVSNFYWSGCSAVACLLECD
Dasypus_novemcinctus|13505          XXX-XXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Ornithorhynchus_anatinus|13337      FSSEVGRRESLKKSGY-EWLHKAFAKSFWRMDRLLRLGRKEVSRVRWSGCSCVICLLESN
Erinaceus_europaeus|14318           FTK--KVIKAPPAGEY-ESIHKAFAKAFWRMDRLLRLGRKEVSRVQWSGCSAVTCILEDK
Sorex_araneus|2466                  FST---KERTEKRCGY-TKIHSAFAKAFLRMDRLLRLGRKEESKFRWSGCSALACVLEGN
Mus_musculus|20976                  FSS-TYKTFRTSRREY-EDTHKAFAKAFWRMDRLLRLGRNETSRVRWSGCSALTCILEGG
Rattus_norvegicus|20976             FSS-TYKTFRTNKREY-EDVHKAFAKAFWRMDRLLRLGRNEVSRVRWSGCSALTCILEGG
Cavia_porcellus|331                 FSS-PKTTTSANSCNY-EHIQKAFAKAFWRMDRLLRLGRKETSRVLWSGCSVLTCMLEGK
Ochotona_princeps|10069             FSS-THKRTRGLKNDY-ENIHKAFAKAFWRMDRLLRLGRNEVSRVRWSGCSAVTCILEGS
Bos_taurus|22700                    FSS-KKKRTKGMKSVY-ENIHKAFAKAFWRMDRLLRLGRREASRVRWSGCSAVTCILESS
Myotis_lucifugus|10667              FSV--SKQTTESWCEH-ESIHKAFAKAFWRMDRLLRLGRQEVSRVRWSGCSAVACILEGK
Procavia_capensis|9436              FTF-SSRKTKALHGEF-EAIHKAFAKAFWRMDRLLRLGRNEASNIKWSGCSALICILESS
Loxodonta_africana|5101             FSF-IPQKTKALHGEF-EAIHKGFAKAFWRMDRLLRLGRKEVSRVQWSGCSAVTCILEGN
Spermophilus_tridecemlineatus|11101 FSS-IYKKPRALKYEY-EDTHKAFAKAFWRMDRLLRLGRNEVSRVRWSGCSAVTCILEGS
Tupaia_belangeri|7919               FSS-MHKRTRMPSCEY-EGIHKAFAKAFWRMDRLLRLGRKEASRVLWSGCSAVTCILEGK
Vicugna_pacos|1237                  FSR--KRKTRELKGEY-EKIHTAFAKAFWRMDRLLRLGRKEASRVRWSGCSAVTCLLEGN
Pteropus_vampyrus|13583             FSE--KKRTKELMCEY-ENIHKAFAKAFWRMDRLLRLGRKEVSRVRWSGCSAVTCILEGS
Canis_familiaris|16285              FSS-IKKRRKTGKCEY-ENIHKAFAKAFWRMDRLLLLGRNEVSRVRWSGCSAVTCILEGN
Felis_catus|14904                   FSS-ITKKTKTLKCEY-ENIHKAFAKAFWRMDRLLRLGRKEVSRVRWSGCSAVTCILEGN
Equus_caballus|16255                FSA-IKKRAKVLTCEH-ENIHRAFAKAFWRMDRLLRLGRKEVSRVRWSGCSAVTCILEGN
Tarsius_syrichta|2709               FSS---VNKRARASEY-EDTHKAFAKAFWRMDRLLRLGRNEVSRVRWSGCSAVTCILEGN
Callithrix_jacchus|4062             FSA--INKTDAVRCEF-EDIHKAFAKAFWRMDRLLRLGRKEVSRVQWSGCSAVTCILEGE
Rhesus_macaque|10521                FSA--INKTEAVRREY-EDIHKAFAKAFWRMDRLLRLGRKEVSRVQWSGCSAVTCILEGK
Pongo_abelii|3859                   FSA--INKTEAVRCEY-EDIHKAFAKAFWRMDRLLGLGRKEVSRVQWSGCSAVTCILEGK
Pan_troglodytes|12648               FSA--INKTEAVRCEY-EDTHKAFAKAFWRMDRLLGLGRKEVSRVQWSGCSAVTCILEGK
Gorilla_gorilla|9628                FSA--INKTEAVRCEY-EDTHKAFAKAFWRMDRLLGLGRKEVSRVQWSGCSAVTCILEGK
Homo_sapiens|47250                  FSA--INKTEAVRCEY-EDTHKAFAKAFWRMDRLLGLGRKEVSRVQWSGCSAVTCILEGK
                                                                                                

Nematostella_vectensis|24168        ----------------------------------------TCYLSHVGDVGAILIREDGV
Branchiostoma_floridae|7042         NMEEVSDDE-------TDEVKTTRTNPSTVEKDLPQE-KGVLYVANAGNTHAVLCR-DGK
Nematostella_vectensis|15853        ----------------------------------------KLYIANAGNVRAVLCKGDGS
Xenopus_tropicalis|8052             ----------------ADAKSSQKEAQLLGSTQEHKRRLGVLHIASVG------------
Gallus_gallus|14005                 ----PSENMDD-----TEERKHLENSSQSSLTRTTEDVAGLLHIANIGNTHAVLCK-NGK
Monodelphis_domestica|18464         -AHSSSSSLES-----TSSNSEEGLDE-----------TGILHVANVGNVHVVLCK-NGK
Macropus_eugenii|5598               --EHFASSTSW--------HQKWKWKKEEFSIFQTLKATGVLHIANV-------------
Dasypus_novemcinctus|13505          -XXXXXXXXXX------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNVQAVLCR-NGM
Ornithorhynchus_anatinus|13337      RVKDDTAAVSISSKVEEKSTDFYEDLICSQSEQECKSINGVLHIANTGNVHAVLCR-NGR
Erinaceus_europaeus|14318           -TKNPTVKRSW-----KKSIDNRGL-----FKRTSQILSGVLHIANTGNVEAVLCR-NGK
Sorex_araneus|2466                  -IKHPSVTMNL--------RGNDTHAENFASGKMPQVISGVLHVANTGNVEAVLCR-NGK
Mus_musculus|20976                  -IKNPHANKDW-----EKTYQQG--STSLPFQKTPQIISGVLHLANAGNVQAVLCR-NGK
Rattus_norvegicus|20976             -IKNPQATKDW-----EKTYQHG--VNSSPFQKIPQIISGVLHIANAGNVQAVLCR-NGK
Cavia_porcellus|331                 -IKYPYVNMNW-----RKINS-DKLAENFPSQMVPQVIAGILHIANTGNVQAVLCR-NGK
Ochotona_princeps|10069             -IKNPHVQRSW-----KGSSNHDEPADSSSSPTMPQLVSGVLHIANTGNVQAVLCR-NGK
Bos_taurus|22700                    -VESPEARRSW-----GRISDLAALADRHLFPGMPQITTGVLHIANAGNVQAVLCR-NGK
Myotis_lucifugus|10667              -ITSSHDKKN------QRPTDHDGLPEKLPSQNLPQIISGELHIAYT-------------
Procavia_capensis|9436              -VKSLHLNNYW-----RKQHVHESWRQSAPFRKRPEIISGVLHVANAGNVQAVLCR-NGK
Loxodonta_africana|5101             -IKSLHAHNHW-----RRKHGHGHLLESAHSGKMPQIISGVLHVANVGNVHAVLCR-NGK
Spermophilus_tridecemlineatus|11101 -IKNPHVNKNW-----KGTNNWDGLSKNNPSQMMPQIISGVLHIANAGNVQAVLCR-NGK
Tupaia_belangeri|7919               -SRGLYATRNW------RTSNYDTLSDSSSSQLMEQMISGVLHIANAGNVQAVLCR-NGK
Vicugna_pacos|1237                  -VKNPYAERSW-----RRMGGRDGLADRFPFQEMPQVISGVLHIANTGNVQAILCR-NGK
Pteropus_vampyrus|13583             -IKYPYAKK-W-----RKTNDHDGWAERFPSQKMPQIISGVLHIANTGTVEAVLCR-NGK
Canis_familiaris|16285              -IKTPYTKKNW------RISNDDGLPKNSPSQVMPQIISGVLHVANTGNVQAVLCR-NGK
Felis_catus|14904                   -IKNPYAEK--------RIHKRVSVAESS-SQXXXXXXXXXXXXXXTGNVQAVLCR-NGK
Equus_caballus|16255                -TENPLA-KNW-----RRTNDYGGLAEKFSSPIMPQIISGVLHIANTGIVQAVLCR-NGK
Tarsius_syrichta|2709               -IKCPYAPKN------QRTSDWDGSAESSPSQKMPQIISGVLHIANTGNVQAVLCR-NGT
Callithrix_jacchus|4062             -PKSPY--KNW-----RRTNNHDGLAESSSSQELPKIISGTLHVANTGNVQAVLCR-NGK
Rhesus_macaque|10521                -PKSPYAHKNW-----KRKTNHDGLAESSTSQEMPQIFPGILHVANTD------------
Pongo_abelii|3859                   -PKSPYAHKNC-----KRKNNHDGLAESSPSQEMPKIISGILHVANTG------------
Pan_troglodytes|12648               -PKSPYAHKNW-----KRKNTHDGLAESSPSQEMPKIISGILHVANTGNVQAVLCR-NGK
Gorilla_gorilla|9628                -PKSPYAHKNW-----KRKNTHDGLAESSPSQAMPKIISGILHVANTGNVQAVLCR-NGK
Homo_sapiens|47250                  -PKSPYAHKNW-----KRKNTHDGLAESSPSQEMPKIISGILHVANTGNVQAVLCR-NGK
                                                                                                

Nematostella_vectensis|24168        TKILTRKHDLYNKKERDRVRKSSGVIVKTEKCAL-VNGALGVTRGLGNIGDGELNQSVII
Branchiostoma_floridae|7042         TYRITRDHTTSNPHERSRVIRTGGTITGSKKHGR-IFGTMATTRGLGNHGDINIKKCVLN
Nematostella_vectensis|15853        MIRLTQEHTPRNKRERHRVSKYGEVYKS-EKTAL-VNGLTTNTRGLGNHGDPHLKSSVIC
Xenopus_tropicalis|8052             ------------------------------------------------------------
Gallus_gallus|14005                 SYHLSEEHSTSNVREKKRILQNDGNISTNEPDGL-VEGHLRTTRGLGYHGDPVLKRSVIP
Monodelphis_domestica|18464         AHLLTKDHTTQSVSERDRVLSRGGKISTNEPTGF-TEETVKITRGLGFHGNAKLKRSVIP
Macropus_eugenii|5598               ------------------------------------------------------------
Dasypus_novemcinctus|13505          DFCLTKEHTTHNLMERRRVLKDGAMISSNEPGRISLEGQMKITRGLGFHGNLKMKKLVIP
Ornithorhynchus_anatinus|13337      SYCLTKEHSTRSLSERRRILGAGGSISPNEPTGL-TEGIIKTTRGLGHHGNPKFKKSFIP
Erinaceus_europaeus|14318           GFCLTKDHTTRNTSERRRVLQSGATISSNEPHGL-LEGQIKTTRGLGFHGNPRLKRFIIP
Sorex_araneus|2466                  GFCLTKEHTTRNIHERKRVLEKGAVISSNEPYGL-IEGQEKLTRGLGFHGHPKLKNVIIP
Mus_musculus|20976                  GFCLTKEHSTRNTKERRRVLYSEAVISSDDPYGL-LDGHIKTTRGLGFHGNLRLKKSIIP
Rattus_norvegicus|20976             GFCLTKEHTTRNTKERRRVLYSEVGISSDDPYGL-LDGHIKTTRGLGFHGNLRLKKAIIP
Cavia_porcellus|331                 GFCLTKEHTTANISERRRVLQNGALITSSEPYGL-LEGYIKTTRGLGFHGNLKLKKFIIP
Ochotona_princeps|10069             GFCLTKEHTTRNTNERNRVLQNGAVITSNEPYGL-LEGEIEITRGLGFHGNLRLKKFFIP
Bos_taurus|22700                    GFCLTKEHSTRNLDERRRVLRQGAVISANAPHGL-LQGQTTTTRGLGFHGNLKLKRFIIP
Myotis_lucifugus|10667              ------------------------------------------------------------
Procavia_capensis|9436              GFCLTKEHTMQNKMERRRVLQNGATVTSGESDEL-LEGQMKTTRGLGFHGNPKLKKFFIP
Loxodonta_africana|5101             GFCLTKEHTIQNAMERRRVLHNGAIINSNEPNGF-LEVQTKTTRGLGFHGNLKLKKFIIP
Spermophilus_tridecemlineatus|11101 SFCLTKEHTTRNIKERRRVLQTGAVISSNEPYGL-LEGQIKTTRGLGFHGNLKLKKSIIP
Tupaia_belangeri|7919               GFCLTKEHTTRNINERRRVLQNGAMISSNEPYGL-LEGQVQTTRGLGFHGNLKLKKSIIP
Vicugna_pacos|1237                  GFCLTKEHTMQNINERRRVLQNGAVSSSNEPYGL-VEEQIKTTRGLGFHGNPKLKKFIIP
Pteropus_vampyrus|13583             GFCLTKKHNMQNVNERRRVLKKGAIISSNESDGL-LEGQIKTTRGLGFHGNPKLKNFIIP
Canis_familiaris|16285              GFCITKEHTTRNITERRRLLKNGAIISSNEPYGL-LEGQIKTTRGLGFHGNLKLKKSIIP
Felis_catus|14904                   GFCITKEHTTRNITERRRLLQNGAMISSNEPHGL-LEGQIKTTRGLGFHGNLKLKKSIIP
Equus_caballus|16255                SFCLTKEHTTRNISERRRVLQRGAMISSR---------QTRVTRGLGFHGSLKLKKFIIP
Tarsius_syrichta|2709               GFCLTKEHTTRNTQERRRVLQNGAVISSSEPHGL-LEGQVKTTRGLGFHGNLKLKKVIIP
Callithrix_jacchus|4062             CFCLTKEHTTRNTNERRRILQNGAVISANEPYGL-VEGQVKTTRGLGFHGNLKLKKSIIP
Rhesus_macaque|10521                ------------------------------------------------------------
Pongo_abelii|3859                   ------------------------------------------------------------
Pan_troglodytes|12648               GFCLTKEHTTRNTNERRRILQNGAVISSNEPYGL-VEGQVKTTRGLGFHGNLKLKKSIIP
Gorilla_gorilla|9628                GFCLTKEHTTRNTNERRRILQNGAVISSNEPYGL-VEGQVKTTRGLGFHGNLKLKKSIIP
Homo_sapiens|47250                  GFCLTKEHTTRNTNERRRILQNGAVISSNEPYGL-VEGQVKTTRGLGFHGNLKLKKSIIP
                                                                                                

Nematostella_vectensis|24168        APKFRCTCLTNRDQVLVFASSGLWKVFSAEEVANLVLGFFRQIKESVRKGIIWGSRVPCV
Branchiostoma_floridae|7042         EPFTTCVSIDQYAQFLILASNGVWEVLSDKEAVSLLLQMVPGQEIPPPSDQPPISIHGGS
Nematostella_vectensis|15853        QPSVNCVTLDEADQFVILATNGVWEVFSEEEVILLLEDLMP-------------------
Xenopus_tropicalis|8052             ------------------------------------------------------------
Gallus_gallus|14005                 VPHSISVPIDDSCQFLILASNGLWEVLDYKQVCALTLTTFT-------------------
Monodelphis_domestica|18464         APQTISVHIDNSCQFLIVATTGLWGVLDKNEATAIAMSLFS-------------------
Macropus_eugenii|5598               ------------------------------------------------------------
Dasypus_novemcinctus|13505          APQTISVPIDDLCQFLILATNGLWEVLDKKEVISLAMATFH-------------------
Ornithorhynchus_anatinus|13337      VPQTISVPIDNLCQVLILATNGLWEVLDKNEVMALALTMLG-------------------
Erinaceus_europaeus|14318           APQTISVPIDILCQFLILATSGLWEVMDTKEVTALAMTTFE-------------------
Sorex_araneus|2466                  APQTISVPIDDLCQFLILATNGLWEVLDKKEVTALAITIFQ-------------------
Mus_musculus|20976                  APQTISVPIDDLCQFLILATNGLWQVLDKKEVTALVITLFH-------------------
Rattus_norvegicus|20976             VPQTISVPIDDLCQFLILATNGLWQVLDKKEVTALVITLFH-------------------
Cavia_porcellus|331                 APETISVPIDDLCQFLILATNGLWEVLDKEEVIALAITLFQ-------------------
Ochotona_princeps|10069             APQTISVPVDDLCQFLILATNGLWEVLDKKEVIALTITEFQ-------------------
Bos_taurus|22700                    APQTVSVPIDDLCQFLILGTDGLWGVLDTKEVTALAMSAFQ-------------------
Myotis_lucifugus|10667              ------------------------------------------------------------
Procavia_capensis|9436              APQTISVPIDDLCQFLVLATNGLWEVLDKNEVIPLAISMFH-------------------
Loxodonta_africana|5101             APQTISVPIDDLCQFLVLATNGLWEVLDKNEVIALAMTMFH-------------------
Spermophilus_tridecemlineatus|11101 APQTISIPMDDLCQFLILATNGLWEVLDKKEVTAMVITMFH-------------------
Tupaia_belangeri|7919               APQTISIPIDDLCQFLILATNGLWEVLDKKEVTALAMTMFH-------------------
Vicugna_pacos|1237                  APQTISVPIDDLCQFLILATNGLWEVLDIKEATALTMTAFH-------------------
Pteropus_vampyrus|13583             APQTISVPIDDLCQFLILATNGLWEVLDKKEVTALAMTMFH-------------------
Canis_familiaris|16285              APQTISVPIDDLCQFLILATNGLWEVLDTKEVTALAMTMFQ-------------------
Felis_catus|14904                   APHTISVPIDDLCQFLILATHGLWEVLDTKEVTALAMTMFQ-------------------
Equus_caballus|16255                APQTLSVPIDDLCQFLILATNGLWEVLDKKEVTALAITMFQ-------------------
Tarsius_syrichta|2709               APQTLSVPIDDLCQFLILATNGLWEVLDQEEVTALAMMMFH-------------------
Callithrix_jacchus|4062             APQTISVLIDDLCQFVILATNGLWEVLDKEEVTALAMTTFH-------------------
Rhesus_macaque|10521                ------------------------------------------------------------
Pongo_abelii|3859                   ------------------------------------------------------------
Pan_troglodytes|12648               APQTISVPIDDLCQFLILATNGLWEVLDKEEVTALAMTTFH-------------------
Gorilla_gorilla|9628                APQTISVPIDDLCQFLILATNGLWEVLDKEEVTALAMTTFH-------------------
Homo_sapiens|47250                  APQTISVPIDDLCQFLIVATNGLWEVLDKEEVTALAMTTFH-------------------
                                                                                                

Nematostella_vectensis|24168        CANGHMEFEGKKFAARYA-NCGAYYRKFLRPEPKREIGRPATSHMFNFMSYNELDNITEE
Branchiostoma_floridae|7042         RWNGQSSFAGSNRPMIGD-NHALNRGGGKTDRSQKGKARAQT-ALSVKLHTPRDVEKTAE
Nematostella_vectensis|15853        -------------------------ELDVKEIVRRMNNASEK-KSKVAKQCNTKRESAKT
Xenopus_tropicalis|8052             ------------------------------------------------------------
Gallus_gallus|14005                 ------HY-------------------YLIPLSEEELRDSKATNYQQVGTEMLDSNTEIF
Monodelphis_domestica|18464         ------IYTDAYKSRRDTYKSFQQRMSFLPSISASSISTQDS-KIKLLYRNSAAFRRVGY
Macropus_eugenii|5598               ------------------------------------------------------------
Dasypus_novemcinctus|13505          ------LYKETYYSIIQN-KPSPSTGPPIISLSEETNNTKSETNIHILFQYKP-SQECLP
Ornithorhynchus_anatinus|13337      ------TYEET--------TAFPHKRPATSSVSSRDSKIRQP----------GEDDQHFQ
Erinaceus_europaeus|14318           ------VYKSSYYSIIES-KYLPSENFLLSPANKPNIIEPEN-NIHLLFQSKSESKESLT
Sorex_araneus|2466                  ------TYEKTY--------SKPAKGSLFSPNS---NLKSKS-NSNIPSEFKSDSERIVS
Mus_musculus|20976                  ------AYKETHVPRPKS-KPWPPIGLLSPPDS----------NIRVLFQYQPENEDIMS
Rattus_norvegicus|20976             ------AYKETCVSGPRN-KPWPSKSLLFPPDS----------NIRVLFQYQPENEDITS
Cavia_porcellus|331                 ------IYKDTCASTMQN-K-LPYMKPLYLSISDTSTTESES-NIHVLFQYNPESKEHVS
Ochotona_princeps|10069             ------MYKDTHDSTMQN-KCQPPIKSLLFPVSAPSTTTSEG-HIHVLFECKLETNERVS
Bos_taurus|22700                    ------AHRETRGPATGN-QPSPPRGSLLCPISEQTTSKSET-NIHIVFQRK--SGERAS
Myotis_lucifugus|10667              ------------------------------------------------------------
Procavia_capensis|9436              ------AYKEKYYPR----KCISPPKP-----SEPSVTQEECTNIHVWYQCTPLATEYGS
Loxodonta_africana|5101             ------TYKEK-CFMAEN-ESSSSK------LSEPSVRKPESNDIHILYQCKPLSKEHLS
Spermophilus_tridecemlineatus|11101 ------MYKETYTSITL--RSSPSTGPPLLPNSDKSNNEFES-DIHILFQCESESEEYVS
Tupaia_belangeri|7919               ------VYKETYYSTTQN-ASL-SYEPLLYTTGDPNITEPET-DIHVLFQYE--------
Vicugna_pacos|1237                  ------VYTETR-STTGN-KLSTSTGPLLSPINERNASKSET-NIHIVFQSKSEFEECVS
Pteropus_vampyrus|13583             ------MYKETYCSSFQN-KSSSSKELQFFPTNESSITKSES-TIRILFQSKSESKGYMS
Canis_familiaris|16285              ------VYKDTYYCITQN-QSLPSKEPFL--INELSNTKSES-NIHILFQYKSESTECVP
Felis_catus|14904                   ------VYKETYCFVKQN-KSLPSKEPLLFPINEPXXXXXXX-XXXXXXXXXXXXXXXXX
Equus_caballus|16255                ------AYQETYCSSSQN-TPSPSPG--------PSVSKSES-NIHILFQYKPESEECMS
Tarsius_syrichta|2709               ------MYKETYCSIT-N-KSSPSKGPLPLSVSEPRIPKSES-DIHVLFHYKSESKECVP
Callithrix_jacchus|4062             ------VYKETYCSITHN-KSSPSKGPLLFLNSEPNFMKTQS-NIHLLFQYKSESKECVS
Rhesus_macaque|10521                ------------------------------------------------------------
Pongo_abelii|3859                   ------------------------------------------------------------
Pan_troglodytes|12648               ------MYKETYCPIIPN-K-SPSKGPLLFSTSEPNLTKSQS-NIHVLFQYKSVSEVRVS
Gorilla_gorilla|9628                ------MYKETYCPIIPN-K-SPSKGPLLFSTSEPNLTKSQS-NIHVLFQYKSVSEVCVS
Homo_sapiens|47250                  ------MYKETYCPIIPN-K-SPSKGPLLFSTSEPNLTKSQS-NIHVLFQYKSVSEVRVS
                                                                                                

Nematostella_vectensis|24168        TPTTRAGLS--VPVWFKRVGRRLSDTCIVY----RDPDAIQDEQLNTSH-----------
Branchiostoma_floridae|7042         RENEGKKDEKKDEKKESAKLEEKLDIVSKSLEQGQDQEKFDDEEVEVGSVISENIKILEA
Nematostella_vectensis|15853        TGSSQQ-----ESKSTSASSKSS-----------DTISIRLPEI--VSN-----------
Xenopus_tropicalis|8052             ------------------------------------------------------------
Gallus_gallus|14005                 LPDSKSSLTHGKPKCSRTSYLQS-----------YTGQQLLKTTLPVDC-----------
Monodelphis_domestica|18464         PQDITQNLD--KSNGSKSRLNSK-----------TEISSARPF-----------------
Macropus_eugenii|5598               ------------------------------------------------------------
Dasypus_novemcinctus|13505          SINSKENLS--DSN-SEYSISNS-----------ESVEKFSPEV--SNQ-----------
Ornithorhynchus_anatinus|13337      SLDPAQHVS--EGLRKSTVAKPS-----------SSHTVEPPEM--RHL-----------
Erinaceus_europaeus|14318           TLYSKE-LP--DTKYSKHFIDNP-----------GKTETFQPET--TNY-----------
Sorex_araneus|2466                  TINPGVTLS--DSNLAQNIISNP-----------ENKDTLLSEV--TDF-----------
Mus_musculus|20976                  TADGTKGLS--DSIYAEAYTHQG---------------TFSPKV--TPY-----------
Rattus_norvegicus|20976             TTDVMKRLS--DSPFADTNIHQD-----------TSAETFLPKA--TSY-----------
Cavia_porcellus|331                 TTNLKKELS--DSKCSEHCAFNS-----------NNVETAPPQM--TNH-----------
Ochotona_princeps|10069             TTDSND-LS--GFKHSEYPNHNY-----------ENGETFPPEK--T-------------
Bos_taurus|22700                    TGSSEENLS--VSKHS---ICDP-----------ESSGLSPPKK--TTR-----------
Myotis_lucifugus|10667              ------------------------------------------------------------
Procavia_capensis|9436              VTNSQENLC--DSEGSQHSANDP-----------KNLESCPPKL--TLH-----------
Loxodonta_africana|5101             AINSKENLY--DSKYSDHSIGDL-----------ENSETFPPRP--TIR-----------
Spermophilus_tridecemlineatus|11101 TTNSKNSSD--------YSFDDP-----------KNEELSSPT---TSH-----------
Tupaia_belangeri|7919               -PHSKENVL--DSKYSEYCPYNL-----------ENVEKPAAKR--INQ-----------
Vicugna_pacos|1237                  ATNSKERS---DSKDSEHFTCNP-------------------------------------
Pteropus_vampyrus|13583             RTYSKENLS--DSKYF---TRDS-----------KNGQTFLPEI--TNR-----------
Canis_familiaris|16285              TINTKENLF--DSKYS-----NP-----------KNAETFPSEM--TNH-----------
Felis_catus|14904                   XXXXXENVS--DSKCS-----NS-----------KNAQTFPPEK--TNH-----------
Equus_caballus|16255                NINSKENLT--DSKYSKYCTFNP-----------KNEQTFPPEM--TNH-----------
Tarsius_syrichta|2709               TPNSKEMFS--DSNYSKCCIYSP-----------ENIETFLSEM--THR-----------
Callithrix_jacchus|4062             TTNSKENLS--DSNYSKYSNYDP-----------ENVETFPAET--IHH-----------
Rhesus_macaque|10521                -TRRNEHLP--E------------------------------------------------
Pongo_abelii|3859                   -TRRNEHLP--E------------------------------------------------
Pan_troglodytes|12648               TTNSKENLS--DSNYSKYCIYNP-----------ENVETFPAET--THR-----------
Gorilla_gorilla|9628                TTNSKENLS--DSNYSKYCIYNP-----------ENVETFPAET--THR-----------
Homo_sapiens|47250                  TTNSKENLS--DSNYSKYCIYNP-----------ENVETFPAET--THR-----------
                                                                                                

Nematostella_vectensis|24168        ---ERFTNRRHSLPHRAGMTKLYGPLGFRPDLSPQDKIELVAKSLAERIVKSALLAGSID
Branchiostoma_floridae|7042         DFGDQKSEVDSQKPVQHNYPAIYTQSELTSMPTKRELYCNLAKLMAERLVQSALLAGSRD
Nematostella_vectensis|15853        ---KGKAATASDSLIRME-EKAQE----------------LAKALSERLVQSALMAGSKD
Xenopus_tropicalis|8052             ------------------------------------------------------------
Gallus_gallus|14005                 ---KPPTHFEEDTKTYLS-GCESQIAG-KGGVTSKALYDNAASYISEQLVKAALDAGSRD
Monodelphis_domestica|18464         ---YLYGIEESDETSSLSESSKSD----LDSEIQKNFYDYAAEYVSHGLVKAAMTAGSRE
Macropus_eugenii|5598               ------------------------------------------------------------
Dasypus_novemcinctus|13505          ---DPRRRKETDGPFLAD-GVPTEPSEKEKESCSKNFYEGAAEYISQELVNAALAAGSRD
Ornithorhynchus_anatinus|13337      ---ERDSRQETDEELSLP-SNMTHSSTGQKETELKSFYDEAAEYISKQLVKVALTAGSRD
Erinaceus_europaeus|14318           ---ALYTGKEAXXXXXXX-XXXXX----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Sorex_araneus|2466                  -----------ENKTYQH-STPEDSSGKQKESRPQNFYKSAAEYLSHELVNAALAAGSKD
Mus_musculus|20976                  ---DPCSTKENSSLPTID-SKQEN----EKELCIKNFYKGAAEYIGCELVSAAIEGGSRD
Rattus_norvegicus|20976             ---DPYSTKESNSLPTTN-SKQES----EKEICIKNFYKGAAEYIGCQLVSAAIEGGSRD
Cavia_porcellus|331                 ---EPSSEKETDRPTSAD-DAPTS----EESPHSKNFFEGAAEYVSRELVNAALEAGSRD
Ochotona_princeps|10069             ---NPEADREGEAESCTD-GVS------DKQPGTGSFYDSAAEHVSRKLVRAALSAGSRD
Bos_taurus|22700                    ---DPCSEEGTGGLTSVD-REPKDSRERQGGPGSQSFYEGAAAYVSHELVNAALVAGSRD
Myotis_lucifugus|10667              ------------------------------------------------------------
Procavia_capensis|9436              ---QGYSREKIDGQVGAD-SVPTDLSEEEKEPQTWSFYERAAQYVSQELVNAALTAGSRD
Loxodonta_africana|5101             ---QHHGRKPTDGQVSAD-DVPTDPNEKAKEPSAKSFYEGAAAYVSRQLVKAALTAGSRD
Spermophilus_tridecemlineatus|11101 ---ENEIESADDEQTSI------------KKLGTKNFYEGAAEYISHKLVNAALEAGSRD
Tupaia_belangeri|7919               ---EPCN---------------------RKESCAKSFYEGAAEYVSHELVNAALEAGSRD
Vicugna_pacos|1237                  ---GPCSKKETDEPTSMD-SVPKDASDKEKKSYLKSFYEGAAEYISHELVNAALAAGSRD
Pteropus_vampyrus|13583             ---NPSTEREANIPTKAD-GEPKDSSK-NEKTRTKSFYEGAAEYISHELVNAALMAGSRD
Canis_familiaris|16285              ---HLYSEKERNGPTSVDVSKNSS----EKESCIKNFYEGAAKYISHELVSAALVAGSRD
Felis_catus|14904                   ---DLCSEKETKGPTSVS-DVPKDSSEKEKESRTKNFYEGAAKYISHELVNAALVAGSRD
Equus_caballus|16255                ---DPCSEKESDGPTSVD-ESSEK----EKETCAKSFYESAAEYISHELVNAALAAGSRD
Tarsius_syrichta|2709               ---EPSSEKETNRPTSVD-SVPTNQ---DREPSAKSFYEGAAEYVSHELVNAALQAGSRD
Callithrix_jacchus|4062             ---ERCSEKVTDRPTSVN-GVATN----EKELGTKSFYEGAAEYVSHELVNAALLAGSRD
Rhesus_macaque|10521                -------------------------------------YYG--------------------
Pongo_abelii|3859                   -------------------------------------YYG--------------------
Pan_troglodytes|12648               ---KPCSEKVTDRPTSVN-DVATN----EKESDTKSFYEGAAEYVSHELVNAALLAGSRD
Gorilla_gorilla|9628                ---KPCSEKVTDRPTSVN-DVATN----EKESDTKSFYEGAAEYVSHELVNAALLAGSRD
Homo_sapiens|47250                  ---KPCSEKVTDRPTSVN-DVATN----EKESDTKSFYEGAAEYVSHELVNAALLAGSRD
                                                                                                

Nematostella_vectensis|24168        NLTVCSVLLPGFSLVNVCTITPELIQKLDRPVTGDW
Branchiostoma_floridae|7042         NITVMVVLLPGCK-----I-----------------
Nematostella_vectensis|15853        NTTVAVILLKGCPLQMFLLPSLRQ------------
Xenopus_tropicalis|8052             ---------------KLLL-----------------
Gallus_gallus|14005                 NITVLVVLLNGCD---KLP-----------------
Monodelphis_domestica|18464         NITVLVVVLEGCD-SQLQG-----------------
Macropus_eugenii|5598               ------------------------------------
Dasypus_novemcinctus|13505          NITVMVILLKGSE-YQFLT-----------------
Ornithorhynchus_anatinus|13337      NITVLVALLRGCENYSNLS-----------------
Erinaceus_europaeus|14318           XXXXXXXXXXESE-YQLLT-----------------
Sorex_araneus|2466                  NITIMVILLSGLE-YQINL-----------------
Mus_musculus|20976                  SITVMVMFLNGSE-YHRLT-----------------
Rattus_norvegicus|20976             SITVMVMFLNGSE-YHRRT-----------------
Cavia_porcellus|331                 NITVMVIFLNGSE-YQLLI-----------------
Ochotona_princeps|10069             NITVMVVFLNG----RLPT-----------------
Bos_taurus|22700                    SITVMVILLSGAE-HQLLP-----------------
Myotis_lucifugus|10667              ------------------------------------
Procavia_capensis|9436              NITVVVILFSGSE-YQFRI-----------------
Loxodonta_africana|5101             NITVAVILLSGCE-YQFLI-----------------
Spermophilus_tridecemlineatus|11101 NITVMVIFLSGSE-YHLLP-----------------
Tupaia_belangeri|7919               NVTVMVIFLNGSE-YQFLT-----------------
Vicugna_pacos|1237                  NITVMVILLSGSE-YQFQM-----------------
Pteropus_vampyrus|13583             NITVMVILLNGSE-YQFLI-----------------
Canis_familiaris|16285              NITVMVILLKGSE-YQFLT-----------------
Felis_catus|14904                   NITVMVILLNGSE-YQFLM-----------------
Equus_caballus|16255                NITVMVILLSGSE-Y---------------------
Tarsius_syrichta|2709               NITVMVILLNGSE-YQFLA-----------------
Callithrix_jacchus|4062             NITVMVIFLNVTQ-YHLYT-----------------
Rhesus_macaque|10521                ------------------------------------
Pongo_abelii|3859                   ------------------------------------
Pan_troglodytes|12648               NITVMVIFLNGSE-YQLLT-----------------
Gorilla_gorilla|9628                NITVMVIFLNGSE-YQLLT-----------------
Homo_sapiens|47250                  NITVMVIFLNGSE-YQLLT-----------------