Orthologs Set ID: EOG4006C0


Orthology Database
OrthoDB4
Gene Symbol(s)
GM10496,GE11120,GD19493

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Drosophila melanogaster 14055 52, 170, 282, 413, 748, 1161
Drosophila sechellia 10674 52, 170, 282, 413, 748, 1161
Drosophila simulans 10150 52, 170, 282, 413, 748, 1161
Drosophila yakuba 1299 52, 170, 282, 413, 748

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Drosophila melanogaster 14055 FBtr0081600, NM_141450 40867 FBgn0037486 CG14605 dm3
Drosophila sechellia 10674 FBtr0193481 6614220 FBgn0165443 GM10496 droSec1
Drosophila simulans 10150 FBtr0219403 6727062 FBgn0190989 GD19493 droSim1
Drosophila yakuba 1299 FBtr0257638 6539871 FBgn0228946 GE11120 droYak2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Drosophila melanogaster 12899 FBpp0081118 dm3
Drosophila sechellia 542 FBpp0191973 6614220 FBgn0165443 GM10496 droSec1
Drosophila simulans 9282 FBpp0217895 6727062 FBgn0190989 GD19493 droSim1
Drosophila yakuba 1866 FBpp0256130 6539871 FBgn0228946 GE11120 droYak2

multiple sequence alignment in CLUSTALW format


Drosophila_yakuba|1299        ATGCAACTCTGTAGCAGACGCACCAGCTGGCAGTTGATTTCCACCCTGATATTGTGCATT
Drosophila_melanogaster|14055 ATGAAAATCTGTAGCAGACGCAACCGCTGGCAGTTGCTTTCCACCATGATACTGTGCATT
Drosophila_sechellia|10674    ATGCAAATCTGTAGCAGACGCACCCGCTGGCAGTTGCTTTCCACCATGATACTGTGCATG
Drosophila_simulans|10150     ATGCAAATCTGTAGCAGACGCACCCGCTGGCAGTTGCTTTCCACCATGATACTGTGCATT
                              ***.**.***************.*.***********.********.***** ******* 

Drosophila_yakuba|1299        ATGGCATTGGCTCAAGGAATATCCCTAGGATGGTTCTCGCCCACTCTGCCCACTCTCATC
Drosophila_melanogaster|14055 ATGTCGTTGACTCATGGAATATCCCTAGGATGGTTCTCGCCCACTCTGCCCACTCTCATC
Drosophila_sechellia|10674    ATGTCGTTGACTCATGGGATATCCCTAGGATGGTTCTCGCCCACTCTGCCCACTCTCATC
Drosophila_simulans|10150     ATGTCGTTGACTCATGGAATATCCCTAGGATGGTTCTCGCCCACTCTGCCCACTCTCATC
                              *** *.***.****:**.******************************************

Drosophila_yakuba|1299        TCCGACAACAGTCCAATTGGAAAACCAATTGACATCAGCGAGGTGAAGTGGATCGGTGCT
Drosophila_melanogaster|14055 TCCGACAACAGTCCAATTGGCCATCCAATTGACATCAGCGAGGTGAAGTGGATCGGTGCT
Drosophila_sechellia|10674    TCCGACAACAGTCCAATTGGCCATCCAATTGACATCAGCGAGGTGAAGTGGATCGGTGCT
Drosophila_simulans|10150     TCCGACAACAGTCCAATTGGCCATCCAATTGACATCAGCGAGGTGAAGTGGATCGGTGCT
                              ********************..*:************************************

Drosophila_yakuba|1299        GCTTTTGGAATTGGGTGTCTGTTTTGCAATTTGGTAATTTGCGTACCGGTCTCGTATTTC
Drosophila_melanogaster|14055 TCTTTCGGAATTGGGTGTCTTATTTGTAATATGGTAATTTGCGTTCCAGTCTCGTATTTC
Drosophila_sechellia|10674    GCTTTTGGAATTGGGTGTCTGATTTGTAATATGCTAATTTGCGTCCCGGTCTCGTATTTC
Drosophila_simulans|10150     GCTTTTGGAATTGGGTGTCTGATTTGTAATATGCTAATTTGCGTCCCGGTCTCGTATTTC
                               **** ************** :**** ***:** ********** **.************

Drosophila_yakuba|1299        GGAATTAAGAAGTGCATGTATTTCGTGCCCCTACCAAATATCATCAATTGGATCCTAATC
Drosophila_melanogaster|14055 GGAATTAAGAAGTGCATGTACTTTGTGCCCCTACCAAATATCCTTAATTGGGTCTTGATC
Drosophila_sechellia|10674    GGAATTAAGAAGTGCATGTACTTTGTGCCCCTACCAAATATCCTTAATTGGATCTTGATC
Drosophila_simulans|10150     GGAATTAAGAAGTGCATGTACTTTGTGCCCCTACCAAATATCCTTAATTGGATCTTGATC
                              ******************** ** ******************.* ******.** *.***

Drosophila_yakuba|1299        TACTTCGCAAGCAAATCCGCATATTTTTATGTGTGTCGTGTACTTTTGGGATTTTCTGGT
Drosophila_melanogaster|14055 TACTTCGCAAGCAAATCACTGTATTTTTATGTGTGTCGCGTCCTTTTGGGAATTTCTGGT
Drosophila_sechellia|10674    TACTTCGCAAGCAAATCACTGTATTTTTATGTGTGCCGCGTCCTTTTGGGATTTTCTGGT
Drosophila_simulans|10150     TACTTCGCAAGCAAATCACTGTATTTTTATGTGTGTCGCGTCCTTTTGGGATTTTCTGGT
                              *****************.  .************** ** **.*********:********

Drosophila_yakuba|1299        GGCACTTTGGTGGTTTGCTTTCCTGTATTTATCGCGGAAGTATCTGATAATAGCATTCGT
Drosophila_melanogaster|14055 GGCACTTTGGTAGTTTGCTTTCCTGTATTTATCGCGGAAGTATCTGATAATAGCGTTCGT
Drosophila_sechellia|10674    GGCACTTTGGTGGTTTGCTTTCCTGTATTTATCGCGGAAGTATCTGATAATAGCGTTCGT
Drosophila_simulans|10150     GGCACTTTGGTGGTTTGCTTTCCTGTATTTATAGCGGAAGTATCTGATAATAGCGTTCGT
                              ***********.********************.*********************.*****

Drosophila_yakuba|1299        GGCACTCTAGGCTCTATTTTTATGATGACCCTCTGTAGTGGCATAACGGTGGGATTTGTA
Drosophila_melanogaster|14055 GGAACTCTGGGCTCTTTTTTTATGATGACACTCTGTAGTGGCATAACAGTGGGATTTGTG
Drosophila_sechellia|10674    GGAACTCTAGGCTCTTTTTTTATGATGACACTCTGTAGTGGTATCACAGTGGGATTTGTA
Drosophila_simulans|10150     GGAACTCTAGGCTCTTTTTTTATGATGACACTCTGTAGTGGCATCACAGTGGGATTTGTA
                              **.*****.******:*************.*********** **.**.***********.

Drosophila_yakuba|1299        TTGGTCTATTGCCTATCCTACCATGTGCTTCCGTGCGTCGTCATAGTCCTGCCAATTCTA
Drosophila_melanogaster|14055 TTAGTATATTGCCTATCCTACCATGTGCTTCCGTGCGTCGTCATTTTCCTGCCCATTCTA
Drosophila_sechellia|10674    TTGGTCTATTGCCTATCCTACCATGTGCTTCCATGCGTCGTCATTTTCCTGCCAATTCTA
Drosophila_simulans|10150     TTGGTCTATTGCCTATCCTACCATGTGCTTCCGTGCGTCGTCATTTTCCTGCCAATTCTA
                              **.**.**************************.***********: *******.******

Drosophila_yakuba|1299        TATTTGTGCCTCATCATTCCCCTTCCTGAGCCGCCACAGGACTTACTGAAACGGGGCCAT
Drosophila_melanogaster|14055 TATTTGTGCCTCATCATTCCCCTTCCTGAGCCACCACAGGACCTACTGAAACGGGGTCAT
Drosophila_sechellia|10674    TATTTGTGCCTGATAATTCCGCTTCCTGAGCCTCCACAGGACCTTCTGAAACGGGGCTAT
Drosophila_simulans|10150     TATTTGTGCCTCATCATTCCGCTTCCTGAGCCTCCACAGGACCTTCTGAAACGGGGCTAT
                              *********** **.***** *********** ********* *:***********  **

Drosophila_yakuba|1299        GAAGAAAAGGCCGAAAAGTCTTTTTGTTTTTACAACAATTTCTCGAAGGATCCAGCCGAA
Drosophila_melanogaster|14055 GAAGAAAAGGCCGAAAAGTCCTTTTGCTTTTACAAGAACTTATCGAAGGACCCAGCGCAA
Drosophila_sechellia|10674    GAAGAAAAGGCCGAAAAGTCCTTTTGCTTTTACAAGAACTTATCGAAGGATCCAGCGCAA
Drosophila_simulans|10150     GAAGAAAAGGCCGAAAAGTCCTTTTGCTTTTACAAGAACTTATCGAAGGATCCAGCGCAA
                              ******************** ***** ******** ** **.******** *****  **

Drosophila_yakuba|1299        CAGGAAGAAATTAAAGCTGAATTTGTAAACTTGCGAAATAAAGTCCTTGACAGCGGCATA
Drosophila_melanogaster|14055 CAGGACGATAATAAAGCTGAATTTGACAAATTGCGGAATAAAGTTCTCGCCAGCGGCATA
Drosophila_sechellia|10674    CAGGCCGAAAATAAAGCTGAATTTGACATATTGCGAAATAAAGTTCTCGCCAGCGGCATA
Drosophila_simulans|10150     CAGGCCGAAAATAAAGCTGAATTTGACATATTGCGGAATAAAGTTCTCGCCAGCGGCATA
                              ****..**:*:**************:.*:.*****.******** ** *.**********

Drosophila_yakuba|1299        TCAGAGAAGTTTACTCGTGCAGATTTCTTTAACAAGGTCTCAGGAAAAGCATTTGGGCTA
Drosophila_melanogaster|14055 GCTGAAAAGATTACTCCTGCTGATTTCTTTAACAAGGTCTCGGGAAAAGCATTTGGACTG
Drosophila_sechellia|10674    ACTGAAAAGATTACTAGTGCTGATTTCTTTAACAAGGTCTCGGGAAAAGCATTTGGACTG
Drosophila_simulans|10150     ACTGAAAAGATTACTAGTGCTGATTTCTTTAACAAGGTCTCGGGAAAAGCATTTGGACTG
                               *:**.***:*****. ***:********************.**************.**.

Drosophila_yakuba|1299        ATCGCTGTTTTGCTGGTCTCCAATCAATTGTCGGGATCTTTTGCCATCTTCAACTATGCG
Drosophila_melanogaster|14055 ATCGCCGTTTTACTGCTCTCCAATCAGATGTCGGGATCCTTTGCCATCTTCAACTATTCG
Drosophila_sechellia|10674    ATCGCCGTTTTGCTACTCTCCAATCAGATGTCGGGATCCTTTGCCATCTTCAACTATTCG
Drosophila_simulans|10150     ATCGCCGTTCTGCTGCTCTCCAATCAGATGTCGGGCTCCTTTGCCATCTTCAACTATTCG
                              ***** *** *.**. **********.:*******.** ****************** **

Drosophila_yakuba|1299        TCGACCATCTTCGAGCAGCTCGGTAGCAGGATGGAACCTAATTTATGCGGCATATTTCTG
Drosophila_melanogaster|14055 TCGACCATCTTCGAACAGCTCGGTAGCAGGATGGAGCCCAATCTATGTGGCATATTTCTG
Drosophila_sechellia|10674    TCGACCATCTTCGAGCAACTAGGTAGCAGGATGGAGCCCAATCTATGTGGCATATTTCTG
Drosophila_simulans|10150     TCGACCATCTTCGAGCAACTGGGTAGCAGGATGGAGCCCAATCTATGTGGCATATTTCTG
                              **************.**.** **************.** *** **** ************

Drosophila_yakuba|1299        GGTGTTTTGCAGGTTTTGGGATTGATCAGCGCCGTTTTCCTGGTAGACCGAGTGGGTCGT
Drosophila_melanogaster|14055 GGTGTTGTGCAAATTTTTGGTTTGATTAGCGCCGTTTTGCTGGTGGACCGCGTGGGTCGT
Drosophila_sechellia|10674    GGTGTTGTGCAGATTTTTGGTTTGATCAGCGCCGTTTTGCTGGTGGACCGCGTGGGTCGT
Drosophila_simulans|10150     GGTGTTGTGCAGATTTTTGGTTTGATCAGCGCCGTTTTGCTGGTGGACCGCGTGGGTCGT
                              ****** ****..**** **:***** *********** *****.*****.*********

Drosophila_yakuba|1299        CGACGCCTTTTGATCCCATCGCTGGCCGGAGTGGGTATGGCGGAGCTGGGTGTGGGTCTA
Drosophila_melanogaster|14055 CGCCTCCTTTTGATCCCATCGCTGGCCGGAATGGGTTTGGCTGAGCTGGGAGTGGGTCTG
Drosophila_sechellia|10674    CGGCTCCTTTTGATCCCATCGCTGGCCGGAATGGGTTTGGCTGAGCTGGGAGTGGGTCTG
Drosophila_simulans|10150     CGGCTCCTTTTGATCCCATCGCTGGCCGGAATGGGTCTGGCTGAGCTGGGAGTGGGTCTG
                              ** * *************************.***** **** ********:********.

Drosophila_yakuba|1299        TTGAAGTCCTTTGCCTCACAGGAATTCTTAGACCGCAATGGTTGGATTGGACTAACCCTA
Drosophila_melanogaster|14055 CTAAAGTCCTTTGCTTCGCAGGACTTTTTACACAACAATGGTTGGATTGCACTTACCCTA
Drosophila_sechellia|10674    CTGAAGTCCTTTGCCTCGCAGGACTTTTTACACAACAATGGTTGGATTGCACTAACCCTA
Drosophila_simulans|10150     CTGAAATCCTTTGCCTCGCAGGACTTTTTACACAACAATGGTTGGATTGCACTAACCCTA
                               *.**.******** **.*****.** *** **..************** ***:******

Drosophila_yakuba|1299        ATGGGCATTGTGTCTTACACGGTGTCAGTGGGCATAGTGGCTCTCACATTTGTCATCATA
Drosophila_melanogaster|14055 ATGGGCATTGTGTCCTTCACGGCGTCAGCGGGCATAGTGGCTCTTACCTTTGTCATTATA
Drosophila_sechellia|10674    ATGGGCATTGTGTCCTTCACGGCGTCAGCGGGCATAGTGGCTCTTACCTTTGTCATCATA
Drosophila_simulans|10150     ATGGGCATTGTGTCCTTCACGGCGTCAGCGGGCATAGTGGCTCTTACCTTTGTCATCATA
                              ************** *:***** ***** *************** **.******** ***

Drosophila_yakuba|1299        GTTGAGCTTCTGCCCTTAAAGGTAAGCTCG------------------------GGTATG
Drosophila_melanogaster|14055 GTTGAGCTTCTGCCCTTTAAGATTCGCGCCCCTGGCATCTCCATCAGTATGTGCGGACTC
Drosophila_sechellia|10674    GTTGAGCTTTTGCCCTTTAAGATTCGCGCCCCTGGCATCTCCATCAGTATGTGCGGACTC
Drosophila_simulans|10150     GTTGAGCTTCTGCCCTTTAAGATTCGTGCCCCTGGCATCTCCATCAGTATGTGCGGACTC
                              ********* *******:***.*:.*  *                         **:.* 

Drosophila_yakuba|1299        ---------------------CTTATTTCTCAAAGGATTTTACTT---------------
Drosophila_melanogaster|14055 AGTTTATCCGTATTCATTGCCCTCATCACTTATCCCGTCCTGATCAACGATTATGGAGTG
Drosophila_sechellia|10674    AGTTTATCCGTATTCATTGCCCTCATCACTTATCCCGTCCTGATCAACGATTATGGAGTG
Drosophila_simulans|10150     AGCTTATCCGTATTCATTGCCCTCATCACTTATCCCATCCTGATCAACGATTATGGAGTG
                                                   ** ** :** *:.  .*  *..*                

Drosophila_yakuba|1299        ------------------------------------------------------------
Drosophila_melanogaster|14055 CATGTCACAATGTTTGTGTCGGCGAGTTTCTGTCTACTAGGTTTGGTAGTTCTGGGAATA
Drosophila_sechellia|10674    CATATCACAATGTTTGTGTCAGCGAGTTTCTGTCTACTAGGTTTGGCAGTTCTGGGGATA
Drosophila_simulans|10150     CATGTCACAATGTTTGTGTCGGCGAGTTTCTGTCTACTAGGTTTGGTAGTTCTGGGAATA
                                                                                          

Drosophila_yakuba|1299        ------------------------------------TAA
Drosophila_melanogaster|14055 TTTTTGCCTGAGACCAGGGGCAAGAGCATTACCCAATGA
Drosophila_sechellia|10674    TTTTTGCCTGAGACCAGGGGCAAGAGCATTACCCAATGA
Drosophila_simulans|10150     TTTTTGCCTGAGACCAGGGGCAAGAGCATTACCCAATAA
                                                                  *.*

multiple sequence alignment in CLUSTALW format


Drosophila_yakuba|1866        MQLCSRRTSWQLISTLILCIMALAQGISLGWFSPTLPTLISDNSPIGKPIDISEVKWIGA
Drosophila_melanogaster|12899 MKICSRRNRWQLLSTMILCIMSLTHGISLGWFSPTLPTLISDNSPIGHPIDISEVKWIGA
Drosophila_sechellia|542      MQICSRRTRWQLLSTMILCMMSLTHGISLGWFSPTLPTLISDNSPIGHPIDISEVKWIGA
Drosophila_simulans|9282      MQICSRRTRWQLLSTMILCIMSLTHGISLGWFSPTLPTLISDNSPIGHPIDISEVKWIGA
                              *::****. ***:**:***:*:*::**********************:************

Drosophila_yakuba|1866        AFGIGCLFCNLVICVPVSYFGIKKCMYFVPLPNIINWILIYFASKSAYFYVCRVLLGFSG
Drosophila_melanogaster|12899 SFGIGCLICNMVICVPVSYFGIKKCMYFVPLPNILNWVLIYFASKSLYFYVCRVLLGISG
Drosophila_sechellia|542      AFGIGCLICNMLICVPVSYFGIKKCMYFVPLPNILNWILIYFASKSLYFYVCRVLLGFSG
Drosophila_simulans|9282      AFGIGCLICNMLICVPVSYFGIKKCMYFVPLPNILNWILIYFASKSLYFYVCRVLLGFSG
                              :******:**::**********************:**:******** **********:**

Drosophila_yakuba|1866        GTLVVCFPVFIAEVSDNSIRGTLGSIFMMTLCSGITVGFVLVYCLSYHVLPCVVIVLPIL
Drosophila_melanogaster|12899 GTLVVCFPVFIAEVSDNSVRGTLGSFFMMTLCSGITVGFVLVYCLSYHVLPCVVIFLPIL
Drosophila_sechellia|542      GTLVVCFPVFIAEVSDNSVRGTLGSFFMMTLCSGITVGFVLVYCLSYHVLPCVVIFLPIL
Drosophila_simulans|9282      GTLVVCFPVFIAEVSDNSVRGTLGSFFMMTLCSGITVGFVLVYCLSYHVLPCVVIFLPIL
                              ******************:******:*****************************.****

Drosophila_yakuba|1866        YLCLIIPLPEPPQDLLKRGHEEKAEKSFCFYNNFSKDPAEQEEIKAEFVNLRNKVLDSGI
Drosophila_melanogaster|12899 YLCLIIPLPEPPQDLLKRGHEEKAEKSFCFYKNLSKDPAQQDDNKAEFDKLRNKVLASGI
Drosophila_sechellia|542      YLCLIIPLPEPPQDLLKRGYEEKAEKSFCFYKNLSKDPAQQAENKAEFDILRNKVLASGI
Drosophila_simulans|9282      YLCLIIPLPEPPQDLLKRGYEEKAEKSFCFYKNLSKDPAQQAENKAEFDILRNKVLASGI
                              *******************:***********:*:*****:* : ****  ****** ***

Drosophila_yakuba|1866        SEKFTRADFFNKVSGKAFGLIAVLLVSNQLSGSFAIFNYASTIFEQLGSRMEPNLCGIFL
Drosophila_melanogaster|12899 AEKITPADFFNKVSGKAFGLIAVLLLSNQMSGSFAIFNYSSTIFEQLGSRMEPNLCGIFL
Drosophila_sechellia|542      TEKITSADFFNKVSGKAFGLIAVLLLSNQMSGSFAIFNYSSTIFEQLGSRMEPNLCGIFL
Drosophila_simulans|9282      TEKITSADFFNKVSGKAFGLIAVLLLSNQMSGSFAIFNYSSTIFEQLGSRMEPNLCGIFL
                              :**:* *******************:***:*********:********************

Drosophila_yakuba|1866        GVLQVLGLISAVFLVDRVGRRRLLIPSLAGVGMAELGVGLLKSFASQEFLDRNGWIGLTL
Drosophila_melanogaster|12899 GVVQIFGLISAVLLVDRVGRRLLLIPSLAGMGLAELGVGLLKSFASQDFLHNNGWIALTL
Drosophila_sechellia|542      GVVQIFGLISAVLLVDRVGRRLLLIPSLAGMGLAELGVGLLKSFASQDFLHNNGWIALTL
Drosophila_simulans|9282      GVVQIFGLISAVLLVDRVGRRLLLIPSLAGMGLAELGVGLLKSFASQDFLHNNGWIALTL
                              **:*::******:******** ********:*:**************:**..****.***

Drosophila_yakuba|1866        MGIVSYTVSVGIVALTFVIIVELLPLKVSS--------GM-------LISQRILL-----
Drosophila_melanogaster|12899 MGIVSFTASAGIVALTFVIIVELLPFKIRAPGISISMCGLSLSVFIALITYPVLINDYGV
Drosophila_sechellia|542      MGIVSFTASAGIVALTFVIIVELLPFKIRAPGISISMCGLSLSVFIALITYPVLINDYGV
Drosophila_simulans|9282      MGIVSFTASAGIVALTFVIIVELLPFKIRAPGISISMCGLSLSVFIALITYPILINDYGV
                              *****:*.*.***************:*: :        *:       **:  :*:     

Drosophila_yakuba|1866        --------------------------------
Drosophila_melanogaster|12899 HVTMFVSASFCLLGLVVLGIFLPETRGKSITQ
Drosophila_sechellia|542      HITMFVSASFCLLGLAVLGIFLPETRGKSITQ
Drosophila_simulans|9282      HVTMFVSASFCLLGLVVLGIFLPETRGKSITQ