Orthologs Set ID: EOG4006C1


Orthology Database
OrthoDB4
Gene Symbol(s)
LOC100562657,NM_001098134.1

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Anolis carolinensis 17335 799, 888, 1317, 1420, 1485, 1852, 2057, 2164, 2285, 2291
Apis mellifera 29177 778, 1279, 1543, 1741, 1858, 2164, 2376
Bos taurus 28966 748, 1858, 2057, 2164, 2291, 2605, 2643
Caenorhabditis elegans 27636 1324, 1958, 2566
Drosophila melanogaster 5234 615, 787, 1401, 1516, 1813, 1905, 2270, 2468, 2608
Ixodes scapularis 16037 213, 778, 1159, 1252, 1513, 1753, 1852, 2164, 2264, 2376, 2578
Linepithema humile 4571 778, 1279, 1513, 1741, 1858, 2164, 2376, 2587
Nasonia vitripennis 1512 78, 209, 603, 778, 1279, 1741, 1858, 2164, 2376, 2587
Nematostella vectensis 3686
Oryzias latipes 12555 742, 1852, 2057, 2164, 2291, 2575, 2629
Pediculus humanus 10616 2164
Pogonomyrmex barbatus 16511 2164, 2376, 2587
Pogonomyrmex barbatus 16512 603, 1855, 2275, 2575
Tribolium castaneum 2895 606, 936, 1546, 1801, 1971, 2578

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 17335 ENSACAT00000009789 100562657 ENSACAG00000009748 LOC100562657 anoCar1
Apis mellifera 29177 GB10197-PA apiMel3
Bos taurus 28966 ENSBTAT00000039016 615490 ENSBTAG00000027209 NM_001098134.1 bosTau4
Caenorhabditis elegans 27636 T04F3.2, NM_073563 179609 WBGene00011437 T04F3.2 ce6
Drosophila melanogaster 5234 FBtr0088399, NM_165732 36048 FBgn0262169 magu dm3
Ixodes scapularis 16037 ISCW019551-RA ISCW019551 IscaW1
Linepithema humile 4571 LH19959-RA 1.2
Nasonia vitripennis 1512 NV12111-RA 1.2
Nematostella vectensis 3686 e_gw.11018.3.1 Nemve1
Oryzias latipes 12555 ENSORLT00000012522 ENSORLG00000009978 SMOC1 oryLat2
Pediculus humanus 10616 PHUM607640-RA 8237119 PHUM607640 PhumU1
Pogonomyrmex barbatus 16511 PB18377-RA 1.2
Pogonomyrmex barbatus 16512 PB18376-RA 1.2
Tribolium castaneum 2895 GLEAN_10525 Tcas3.0

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 9435 ENSACAP00000009592 100562657 ENSACAG00000009748 LOC100562657 anoCar1
Apis mellifera 196 GB10197 apiMel3
Bos taurus 3494 ENSBTAP00000038820 615490 ENSBTAG00000027209 NM_001098134.1 bosTau4
Caenorhabditis elegans 23135 T04F3.2 179609 WBGene00011437 T04F3.2 ce6
Drosophila melanogaster 4810 FBpp0087487 36048 FBgn0262169 magu dm3
Ixodes scapularis 16038 ISCW019551-PA ISCW019551 IscaW1
Linepithema humile 8244 LH19959-PA 1.2
Nasonia vitripennis 2083 NV12111-PA 1.2
Nematostella vectensis 13975 e_gw.11018.3.1 Nemve1
Oryzias latipes 11752 ENSORLP00000012521 ENSORLG00000009978 SMOC1 oryLat2
Pediculus humanus 10414 PHUM607640-PA 8237119 PHUM607640 PhumU1
Pogonomyrmex barbatus 8376 PB18376-PA 1.2
Pogonomyrmex barbatus 8377 PB18377-PA 1.2
Tribolium castaneum 10254 GLEAN_10525 Tcas3.0

multiple sequence alignment in CLUSTALW format


Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------------------------------------------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      ------------------------------------------------------------
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 ------------------------------------------------------------
Tribolium_castaneum|2895     ------------------------------------------------------------
Pediculus_humanus|10616      ------------------------------------------------------------
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      ------------------------------------------------------------
Apis_mellifera|29177         ------------------------------------------------------------
Nasonia_vitripennis|1512     ATGTTGACGGATAACGAACTCGTCAGGACGACTTTGGTTAGTGGCGAGCCGGAACTTGGC
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------------------------------------------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      ------------------------------------------------------------
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 ------------------------------------------------------------
Tribolium_castaneum|2895     ------------------------------------------------------------
Pediculus_humanus|10616      ------------------------------------------------------------
Pogonomyrmex_barbatus|16512  ---------------------ATGTGTAGCTGTGCGCGGGCGTGCTTTTCAGACGAGTTT
Linepithema_humile|4571      ------------------------------------------------------------
Apis_mellifera|29177         ------------------------------------------------------------
Nasonia_vitripennis|1512     AAGGCCTTCCTCTTTGAGGCTGCAATCTCCTGGGCAAAGGAGGGCCGGCAGATACATTAC
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------------------------------------------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      ------------------------------------------------------------
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 ------------------------------------------------------------
Tribolium_castaneum|2895     ---------------------------------------------------ATGGGTAGA
Pediculus_humanus|10616      ------------------------------------------------------------
Pogonomyrmex_barbatus|16512  CCCGTCCATTCGTCATTTTCCTCATTTTCCGAGAAACACATTGACAAGATTGGAGAAAAC
Linepithema_humile|4571      ------------------------------------------------------------
Apis_mellifera|29177         ------------------------------------------------------------
Nasonia_vitripennis|1512     TTTACGTCCAAGCAGCTCGAGTCTCTACCACCGGCGTTTCACGACAGGAGCGAGCCTTCG
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------------------------------------------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      ---------ATGAGCGATCAGCGGCGTCGTTGGTTGCCCCTGCGCAGT------------
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 ATGTTGGCGAGATGTGTTTTGTTCGTCACTTGGCTGGCGGTTTTC---------------
Tribolium_castaneum|2895     GCTGCACGGACTGAACACCTGTTCACAATAGCAACAGGAATGCAGACCCAGTCAGTCGAA
Pediculus_humanus|10616      ---------ATGAAAAATTTAGTATTGATATTAGTATTGTTATCAATCGAAACATTTTTT
Pogonomyrmex_barbatus|16512  GCAATGATGATCCCGACGATACGAGCCATCGTTGTTTTATTATTCATCGTCGATTTCGAT
Linepithema_humile|4571      ------------------------------------------------------------
Apis_mellifera|29177         ------------------------------------------------------------
Nasonia_vitripennis|1512     GCGAACGCGCTCAAGAACATAACTTTTATCTACACGCCCAGCTACGAGGAGCTGATCGCC
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------------------------------------------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      ------------------------------------------------------------
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 ------------------------------------------------------------
Tribolium_castaneum|2895     CAC---------------------------------------------------------
Pediculus_humanus|10616      CAAATAATT---------------------------------------------------
Pogonomyrmex_barbatus|16512  GCTGTGGCAGCTAAT---------------------------------------------
Linepithema_humile|4571      ------------------------------------------------------------
Apis_mellifera|29177         ------------------------------------------------------------
Nasonia_vitripennis|1512     CAGCTGATTCGCCTCCGGAGCTTCCAGAAGCCACCCTCGATCCTGCTGGTCGACGAGCTG
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------------------------------------------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      ------------------------------------------------------------
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 ------------------------------------------------------------
Tribolium_castaneum|2895     ------------------------------------------------------------
Pediculus_humanus|10616      ------------------------------------------------------------
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      ------------------------------------------------------------
Apis_mellifera|29177         ------------------------------------------------------------
Nasonia_vitripennis|1512     GACGTGTTCAGCGACTACCGGAACATCGGCTCCTCCTCCCGCGAACTCCACGCCGCCCGC
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------------------------------------------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      ------------------------------------------------------------
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 ------------------------------------------------------------
Tribolium_castaneum|2895     ------------------------------------------------------------
Pediculus_humanus|10616      ------------------------------------------------------------
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      ------------------------------------------------------------
Apis_mellifera|29177         ------------------------------------------------------------
Nasonia_vitripennis|1512     TGTTGCGCCGTCCTTCTGAACGCTGCTCAGTCCTGCGCCAGGCTCACTTGCCCTCCACTT
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------------------------------------------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      ------------------------------------------------------------
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 ------------------------------------------------------------
Tribolium_castaneum|2895     ------------------------------------------------------------
Pediculus_humanus|10616      ------------------------------------------------------------
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      ------------------------------------------------------------
Apis_mellifera|29177         ------------------------------------------------------------
Nasonia_vitripennis|1512     GTCCACGTCTGCGTCACGAGTTTCTCCACAGACCAGGCTCGTCGAGCGACTTACGGGAAG
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------------------------------------------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      ------------------------------------------------------------
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 ------------------------------------------------------------
Tribolium_castaneum|2895     ------------------------------------------------------------
Pediculus_humanus|10616      ------------------------------------------------------------
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      ------------------------------------------------------------
Apis_mellifera|29177         ------------------------------------------------------------
Nasonia_vitripennis|1512     TACTTTGACAATTTCTGGAACATCTCTTCCGAGACGGCTGGCAGCGTGTGGATGAGACGA
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------------------------------------------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      ---------------------------------------------TCGGACGGCGACGCC
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 ---------------------------------------------ATTGCGACTGGAAAA
Tribolium_castaneum|2895     ---------------------------------------------CTGGGCAACCGGGAT
Pediculus_humanus|10616      ---------------------------------------------AGTGCGGGAAATGAT
Pogonomyrmex_barbatus|16512  ---------------------------------------------ACTGTGACATCAGCT
Linepithema_humile|4571      ------------------------------------------------------------
Apis_mellifera|29177         ------------------------------------------------------------
Nasonia_vitripennis|1512     GGCGATGGCCAGAAAGCCATGGAATTCAAAAGGCTGGATGACGCGGTCCTGGTGCTCAAG
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------------------------------------TGCCCCCACGAA
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      TCCCGCAAGTGCGCCGTGTCCGACGCGGACTGCAGCGAGGCCGAC---------------
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 AGTGACGATCAGTTGATGAAGCTCCCCGCCTGCGCCGCCAAACAGGGAGAGTGCGATGAT
Tribolium_castaneum|2895     GCGGCGGAAACTCCCTGCAACCCGAAGGCCTGCAGCAAAGACGTGGATAAC---------
Pediculus_humanus|10616      GGGGAAACATGTTCGAAAAGTTTCGAAGAATGCGAAAAGGTTTTCAACGGAAAGAAAAAA
Pogonomyrmex_barbatus|16512  AAGGAGGAATGTAGGAAAAGGATAGCTGAATGCATGATGAATGGTGGTGGA---------
Linepithema_humile|4571      ---------------------------------------------GGTGGA---------
Apis_mellifera|29177         ---GAAGAGTGCAGGAAAAGGATAGCTGAATGTACAATGAGTGATGGTGCA---------
Nasonia_vitripennis|1512     AGAGAAGACTGCCGGTGGAAGCTGAACGCCTGCACGACGGACGCCTCGGCG---------
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    CGGGGCCGCCCCATTTGTGGCTCTGACGGGAAGCTCTACAAGTCGCCCTGCCTCTTCCAA
Bos_taurus|28966             ------------------AATTCAGATGATGCCTCAGCTCCAGCGCTGGAG---------
Oryzias_latipes|12555        ---------------------------------------------------ATGGAGACC
Ixodes_scapularis|16037      ---TCACGAGTGCTGTGCGGTTCGGACGGGCGCACCTACTCTTCACAGTGCGAGGTGGAC
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 AACGAGGGTCCCGTCTGCGGCACCGATGGCCAAACCTATCCCACCAGGTGTCATCTGCTG
Tribolium_castaneum|2895     ---GAGAAGAACGTTTGCGGTTCCGACGGACTGACATATCCGAATCGGTGTCATTTTGAG
Pediculus_humanus|10616      CAAGATTTAAAATTATGCGGGTCAAACAATGTTACGTACGTTAATCGGTGCTTTTTAGAA
Pogonomyrmex_barbatus|16512  ---AGCATGCCGATGTGTGGAAGTGACGGAATCACATATTCCAATCAATGTCAAGTTATT
Linepithema_humile|4571      ---AATACGCCAGTGTGCGGAAGTGACGGAATTACATATTCCAGTCAATGTCAAGTCATT
Apis_mellifera|29177         ---AGTACACCGGTATGTGGGAGTGACGGTGTTACGTATTCGAGTCACTGTCGGGTCATC
Nasonia_vitripennis|1512     ---AACGTCCCGGTCTGCGGCAGCGACGGGCTCACCTACCCGAACCAGTGCAGGGTCATA
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ---ATGCGGCCCGAACACTTGTCTTTACAATTATTG------------------------
Anolis_carolinensis|17335    AGGGCCCGGTGCCGGGACCCTTCCCTCGAGGCTTTGCCCCGCTTCCGGTGTGGGGTGGCC
Bos_taurus|28966             ---ACTCAGCCTCAAGGAGACGAGGAAGATGTTGCATCACGGTACCCCACACTT------
Oryzias_latipes|12555        CACAcccccccGGAGGGCGACGagaTTACACCGTCAACGCTG------------------
Ixodes_scapularis|16037      CGAGCGCGCTGCGAAGGACACCTCGTCGAAGTCAAGCACGAGGGACAGTGCCCA---GAC
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 CGGGCGCAGTGCGGTGGCCACCAGGTGAGCCTCAAGTACAGCGGCTCCTGCAAT------
Tribolium_castaneum|2895     AAAGCTCGCTGCGTCAACAAGAATTTAACATTGGCGAAAAGGGGCCCTTGCCGG---CAA
Pediculus_humanus|10616      ATGGATGTTTGCATCGGGAATAAAATAACAATCAAACACAAAGGACGATGTCGG---ACA
Pogonomyrmex_barbatus|16512  TCTAAGCAATGTCAAGGCATGTCCGTCCTTATCAAACATTCCGGACCTTGTCCA------
Linepithema_humile|4571      TCTAAACAATGTCAAGGAATATCTATTCTTATTAAACACACCGGATCTTGCCCA---GAA
Apis_mellifera|29177         TCGAAGCAGTGTCAAGGCATGTCTATTCTTATCAAACATACTGGCCCTTGTCCA---GAG
Nasonia_vitripennis|1512     TCGAAGCAGTGCCTCGGCGAGTCTATCCTGGTTAAGCACACCGGACCATGCTCA---GAA
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    GCCCACCGAGAACCAAACAAGGACCGGATGGCGGCCCTCTCACAGTCCCGCCGCCAGGCC
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      GCGCGCCGGTGCTGG---TCGCAGCGGAGCCAGGCCCTGGAGCAAGTCCGGAGCGGGGCG
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 ------GCCTGCCTG---GAGGCGGTGAAATTTGCC---CGTCGTCAGCAGGAGCGAGAT
Tribolium_castaneum|2895     CAGAAACTCTGCCGC------GATTGGGAGATCTAC---AGGCATTCGAACCCCGACTAC
Pediculus_humanus|10616      AGGCAACCTTGCTTC---AGAGAATTGAAAAAAGCC---GAGAGAAATCGGGAAAACCAA
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      ACACCAGCGTGTTTT------------------TCA---GCAAGATTAACCGCTCGATCG
Apis_mellifera|29177         ACACCAGCGTGCTTC------------------TCC---GCAAGATTGACTGCTAGACCA
Nasonia_vitripennis|1512     ACGCCGCCCTGTCTG------------------TCG---GCGCGGGTGACGGCCCGGCCA
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    CATGGGACATACGTCCCCGAATGCGACGAAGGAGGCTCCTTCCAGCAGGTCCAGTGCCAC
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      TCCGGAGTCTTCGTGCCGGACTGCTCCGCGGACGGAGCCTTCGTCCAGGTGCAGTGCCAC
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 CCCGGATACTTTGTGCCCCGATGCAGGAAGGATGGCAACTTTGCGGCTATGCAGTGCTAC
Tribolium_castaneum|2895     AAA------TTTCACGCGACATGTCGCCCAGACGGCAGCTACGCCGCTGCCCAGTGCCAC
Pediculus_humanus|10616      GAG------TTCGTACCTACCTGTTTGAAAGATGGTACGTTTTCCCCGATGCAATGTCAC
Pogonomyrmex_barbatus|16512  ---GGTTTGTATCTTTATCTTTGTCCT---------------------------------
Linepithema_humile|4571      GGC------GCACAACCTGTCTGCCGAAGCGATGGAACATATGCGCCGGTACAATGTCAC
Apis_mellifera|29177         AGT------GCACGACCAATCTGTCGTTCGGATGGCACTTATGCACCGGTGCAATGTCAC
Nasonia_vitripennis|1512     GGC------GCCCGCATAGTCTGCCGTCCCGACGGCACCTACGCCCCGGTGCAGTGCCAC
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ---------------GCTTGGATATACTTGATTAATGGGAATCCAATTGTTCAG------
Anolis_carolinensis|17335    AAACAGACTGGTTACTGCTGGTGCTCCACTCCAGAAGGCAAGCCCATCAGTGGAACCTCA
Bos_taurus|28966             ------------------TGGACTGAACAAGTTAAAAGTCGACAGAAC------------
Oryzias_latipes|12555        ------------------TGGGAGAagcattttaatgaaaagtaTTTCAGGCCGAACAAC
Ixodes_scapularis|16037      CGGCTCACGGGCTACTGCTGGTGCGTCGACGCGCAGGGAAAAGTGCTGTCCGGATCCTCC
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 GGGAACAACGGA---TGCTGGTGCAGCGACAGTCAGGGCAGGCCCATCGCGGATGATAAC
Tribolium_castaneum|2895     CCTGACACCGGCTTCTGCTGGTGCGTCACTCCTCAGGGAATCCCTCTGCCGTACACCTCC
Pediculus_humanus|10616      AACGAGACCGGTTTTTGTTGGTGCGTGACTCCCAAAGGAAAACTAATACCCAATTCTGCA
Pogonomyrmex_barbatus|16512  ------------TTGGTGTGGACCATACACGCGCAA------------------------
Linepithema_humile|4571      ATGGAGAGTGGATATTGTTGGTGTGTAACGAAGCAAGGCCGGCCGTTGCCCGATACGTCG
Apis_mellifera|29177         GAGGAAACCGGGTATTGTTGGTGTGTGACACCACAGGGCAGACCGCTCCCTGATACCTCA
Nasonia_vitripennis|1512     CCGCAGACGAGTTACTGCTGGTGCGTCACGCCCCAGGGCCGACCCATCCCGAACTCGACG
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    GTCCTTAATGGG---------ACTCCCAATTGCACAGGTACTTTCCCCATCCTCATGCCC
Bos_taurus|28966             AAAACCAATAAG------------------------------------------------
Oryzias_latipes|12555        TCCACCTCCAGA------------------------------------------------
Ixodes_scapularis|16037      GTGCAGAACAGA---------AGGCCCAACTGC---------------------------
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 AAGCAATTCCGGCGAAAGGGAAAGCTGCGCTGCAGGGCCAATCGACGTGACCGACGCCGC
Tribolium_castaneum|2895     GTGCGCTGGCGTCCCGACGCCAAGCCGCACTGCGGCCGCAAGAAGAAGTCGACCCGGAGG
Pediculus_humanus|10616      AAACGTCACGAT---------AAACCAAATTGTTCGAGAAAATTTAAAATG---CGGAGG
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      GTAAGACATCAA---------AAACCGAGATGTTCGAAA---CTCGGTTCC---AGATCT
Apis_mellifera|29177         GTAAGAAACGAA---------AGACCAAGATGCATAAAAAAACTCGGTCCC---AGATCT
Nasonia_vitripennis|1512     GTGCGCGAGGGT---------CGACCCCGGTGCGCCCGAGCTGGCGCAGCA---GCCGCA
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    TACTCC------------------------------------------------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      ------------------------------------------------------------
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 CTGGCATCGCATCAGATTGGC---------------------------------------
Tribolium_castaneum|2895     CGGTCCCCGCCTCGCAAGGGC---------------------------------------
Pediculus_humanus|10616      AGAGCATCCGTACGGAAAGAC---------------------------------------
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      GCTGCATCCACTAGGAACGGC---------------------------------------
Apis_mellifera|29177         TCTGCGTCCACTAAAAGTGGA---------------------------------------
Nasonia_vitripennis|1512     GCGGCCGTCGCGGGCAACGGCAGCGGCGCCGGCACCGGCCCCGGCGAGACCACGAGGAGC
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------------------------------------------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      ------------------------------------------------------------
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 ---------------TACAATCCGGATACATCTGCGTCCAAAGGCAGTTCGGAGGCAGGA
Tribolium_castaneum|2895     ------------------------------------------------------------
Pediculus_humanus|10616      ------------------------------------------------------------
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      ---------------CAAAGACGACGCTCGCCGAGTTGGAAACAGCGCAGACAATATGTC
Apis_mellifera|29177         ---------------CAACGAAGACGTTCGCCGAATTGGAAACAACGAAGACAATAT---
Nasonia_vitripennis|1512     AGGGCTAACGGACAGCGCAGCAGGAGCTCGCAGAACTGGAAGCAGAGGAGGCAGTAC---
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------------------------------------------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      ---------ACGCACCCCGGCTGCACCAACGCAGACAGGAGCCAGTTCAACGGAAACCTC
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 TCAACAGCCCACCGG---ACTTGCAGCAAGTCCGATCGGTCGCAATTCAACACCAACCTG
Tribolium_castaneum|2895     ---------CGCAACCGCACCTGCAAGCAGCTGGACAAAGCCAAATTCAACAACAACCTC
Pediculus_humanus|10616      ---------AATAAAGAAATTTGCGGACCCAACGACAAACAAAAATTCAGTGAAAATTTG
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      AGTAACAGACATAGGAATACTTGCGATCGTTCCGAGAAATCTAAATTTCACGAAAATCTT
Apis_mellifera|29177         AGCAGTAAGCATAGGAATACATGTGATCGGACAGAAAAATCCAAATTTAACGGAAACTTG
Nasonia_vitripennis|1512     AGCAACCGGCACAGGAACACCTGCGACAGGGTCGACAAGGCCCGCTTCAATGGCAACCTC
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------------------------------------------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      GTAGACATCTTCCAGAAAGAGTTCAAGAGGCTTCCCAGCCAACCCGCTTCCGACATGAGT
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 ATGAGGATGTTCCGGAACGAGGCT---------------------CAGAGCTTTTTCCGC
Tribolium_castaneum|2895     ATCAACATCTTCCACACGGAGTGG------------AGTCGCGACCACGGAGGCGTCATC
Pediculus_humanus|10616      TTAAATTTGTTCAGAGCCGAGTAC------------GGTAAAGATTTGAACGAGGATGTG
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      ATTGAGAATTTCAAGATTGAATAC---------------AGACGAATAAACATATCTGTT
Apis_mellifera|29177         ATAGAAAATTTCAAAATCGAGTAT---------------AGGCGAACAAATATTTCTTCC
Nasonia_vitripennis|1512     ATCGAGAATTTCAAGATCGAGTAC---------------AGGAGAATCAACGGCTCGGCC
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ---------------------------------------------------AAAGGGGGA
Anolis_carolinensis|17335    ---------------------------------------------------TTGGGTtCA
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      CAGTTGCCGGCCTCTCTGCTGGACACGACCGAGAAGCAGGTCATC------CAGTGGAAG
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 CAG---------------CCATCTCTCTCGGATTCCCACATCCTG------GAGTGGCAG
Tribolium_castaneum|2895     AAG---------------CCGCACAACAACGAGAGCGACCTTCTGGTCAACCAGTGGAAG
Pediculus_humanus|10616      GAT---------------ACGGTACTGTTAAATCAAAAAATACTC------AATTGGAAA
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      GAT---------------GATGATAAGAATGTTGAGCAGATATTG------TCATGGAAA
Apis_mellifera|29177         GAT---------------GGCGATAAAAATGTAGAACGAGTATTA------TCATGGAAA
Nasonia_vitripennis|1512     GAA---------------GCCGAGAAAAACGCGGAGCGCGTGCTC------TCCTGGAAG
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 CTTGAAGTTCTGGATATTACTGACTCAAATGATTTGTCTGTTCGTCAAAGATTCGAAGAA
Anolis_carolinensis|17335    AGGGAtggactagac---caggggtccccaaactttttaagcagagggccagtccacaat
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      TTCACCGAGCTGGAC---CTGAACCGGGACGAGGTGCTCCAGAGGCGCGAGGTTCGGGAT
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 TTCTCCAAGCTGGAC---ACGAATGGCAACAAGTTGCTCGATCGTCAGGAGATTCGGGAG
Tribolium_castaneum|2895     TTCGGCACCATGGAC---GCTGACCGCAACGGCGTCCTCGACAAGAACGAGTACCGGGAC
Pediculus_humanus|10616      TTTCAATCGATTGAT---AGAAACGACGACGAGTACCTTCAACGTGCGGAGTATAAAGTT
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      TTTATAACCTTGGAC---AAAGATGGGGACGGATTCTTAGACAGGGCAGAGTACAAGGAG
Apis_mellifera|29177         TTCATTACATTGGAT---AAAAATAGCGATGGCTATTTGGATAGAACGGAATATAAAGAA
Nasonia_vitripennis|1512     TTCGGCAGTCTCGAC---AAGGACGGCGACGGCTACCTAGACCGGGACGAGTACAAGGAG
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 GTTATACGTCTA------------------------------------------------
Anolis_carolinensis|17335    ------------------------------ccttcagactgccta---------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      CTGCGGCGCATGGCGCGGCGCTTCGTCGAGCCCCGGGCATGCGCCCGCAGCTTCACCCGC
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 CTGAAGAAGGTACTCAGGCGGAACGTTAAACCTCGTCGTTGTGGACGGACCTTTGGTAAA
Tribolium_castaneum|2895     CTGAAGCGCGTCGCCAAGAAGGCCGTCAAGCCCAAGAAGTGCGCCAAGATGTTCCCCAAG
Pediculus_humanus|10616      TTGAGAAGGTTG---AAAAAATTAATAAAGCCTAAAAAATGTGCGAAAATGTTTGCGAAA
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      CTCCGAAGGCTCGCTAAGAAAGCGGTGAGACCGAAGAAATGCGCACGAACATTTGCTCGC
Apis_mellifera|29177         TTGAGAAGGCTAGCGAAGAAGGCAGTAAAACCGAAGAAATGTGCTCGCACGTTCGCCCGC
Nasonia_vitripennis|1512     CTCCGCAGACTGGCCAAGAAGGCGGTCCGCCCGAAAAAGTGCGCCCGGACCTTCGCTCGC
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------actctgcctatcccctgggctgagtggATGGCACTTAACCTG
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      TACTGCGACCACAACCAGGACAAGCGCATCTCCAGGTCCGAGTGGTCCGTCTGCCTCGGC
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 TACTGTGATGTAACCAAGGATGCCAATCTCAATTGGTTGGAATGGAGCGTCTGCTTTACC
Tribolium_castaneum|2895     TCCTGCGACGTCAACAGCGACACCCTCATCACGCAGCAGGAGTGGGCCGAGTGCCTTACG
Pediculus_humanus|10616      ATATGCGATTTGGATCGCGATTTTAAAATATCAAAATCCGAATGGTCGGCTTGCTTGGGA
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      ACGTGCGACCTAGATCGGGATTTAAAGCTATCCAGGCAGGAATGGGGTGCTTGTCTCGCA
Apis_mellifera|29177         ACATGCGACCTAAATCGAGATTTGAAACTTTCCAGGCAAGAATGGGGTGCCTGTCTTGCG
Nasonia_vitripennis|1512     ACCTGCGACCTCAACCAAGACCTCAGGCTTTCGCGAGCGGAATGGGGCGCTTGTCTCGCC
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    AACGATACGGGT------------------------------------------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      GTCGACATCAACAACGAGGAGCATGGAGGGGCCGCGGCGGAAGCCGCTGCGCCGAGCACC
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 AAGGAGTTTCACAACCGTAGTGCTGTCGTAAATCTTCTGGCGAGCAGTGCAGCCACCGCA
Tribolium_castaneum|2895     AGGGACGGCATG------------------------------GACGACGGGGGTGGAATC
Pediculus_humanus|10616      GTGAGCATGATA------------------------------------------------
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      AACGATTTCACTCTACGTTTGTTCTTGTCGCTGAACCCTGCAGACGAGCGTTCTGAGGTC
Apis_mellifera|29177         AACGACTTCACT------------------------------CACGAGCGCCCCGAGGTC
Nasonia_vitripennis|1512     AACGATTTCACT------------------------------------------------
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------------------------------------------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      GCCCCGCCCGCTCACCGGGACAGGGCCGCCGCTGTCCCCAGGACACCGTCGATGCCCCGA
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 CCACCACACTCCACCCACTACAGCATCCACAACACCAACGTCAATGGCCACCACCGAGGT
Tribolium_castaneum|2895     AAC---------------------------------------------------------
Pediculus_humanus|10616      ------------------------------------------------------------
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      CCT---------------------------------------------------------
Apis_mellifera|29177         CCT---------------------------------------------------------
Nasonia_vitripennis|1512     ------------------------------------------------------------
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------------------------------------------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      CCGGCCCTCCAGGACTCGCCCAGGAGGGACCCCGGCGGAGCGGACGAGTTCCTCCTCAGC
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 CACACCAATACCATTGGCACTGGAGTTAATCCACACTCATATTCCGAGGATGCGAGTGGC
Tribolium_castaneum|2895     ------------------------------------------------------------
Pediculus_humanus|10616      ------------------------------------------------------------
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      ------------------------------------------------------------
Apis_mellifera|29177         ------------------------------------------------------------
Nasonia_vitripennis|1512     ------------------------------------------------------------
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------------------------------------------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      AAGGTGGCCAGGAGCCGCGTCGTCATCGGCGGCGGGGACGAGGACGACGATCGCAACGAC
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 AGTGAGGAGCACGAGGACAACTACGAGGACAGTGCAACGGGCTACGGAGGTGAAGAGGAC
Tribolium_castaneum|2895     ------------------------------AATTCTGAGGATAATGGGGACGATCAAGAG
Pediculus_humanus|10616      ------------------------------------------------------------
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      ------------------------------GAGGCCCAAAGGACACGGCCCACGGACCAA
Apis_mellifera|29177         ------------------------------GAGGCGCAGAGGACTCGGGTCATGGACCAA
Nasonia_vitripennis|1512     ------------------------------------------------------------
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------------------------------------------------
Bos_taurus|28966             ------------------------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      GGTGAAAGACTCCGGCCTCCAGGTGGCATCTGGGGCGACCCCGACACGAGGCTCAACAGT
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 GACTCGCAAGGAGCAGATCTG------------------CCCAGTTCACGAACGCATATC
Tribolium_castaneum|2895     GACTACGCCGACGCCTTCCCT------------------CCGCACAGGCCTCTGCCGCAT
Pediculus_humanus|10616      ACCCTAAAGGGAAGTCCCATA------------------GCTTCACTTTCGGGTCAA---
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      GTTTTGAAAGGCAGTCCAGCA------------------CCTATTCATTCTCTATCG---
Apis_mellifera|29177         GTGTTGAAAGGTAATCCTCCC------------------TCAATGCATTCTCGACCA---
Nasonia_vitripennis|1512     CTTCTGCAGGGCAATCCGTCA------------------CCGGTTCACGCTCGGCCG---
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ---------------------------------CAACATAATGCAACTTCGAACTACCCA
Bos_taurus|28966             ---------------------------------------------------AATTCAGTG
Oryzias_latipes|12555        ---------------------------------------------AAGCAAGATAAGGTT
Ixodes_scapularis|16037      GGGACCAGGTATACGGATGACCAA---GACGTCTTAGAAAACAAAGACGAAGACGAAGTC
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 CCATCATTATATATGCTCAACTCAAAGCCAGAGACGGCGAGCCAGGACTTGGAAAATGAC
Tribolium_castaneum|2895     GCATTGACTTACGACGACGACTCCTCGGAAATTCGCGAC------------GAAGACCCC
Pediculus_humanus|10616      ------CTTCCGGGTTTCGAACACGTGAATCGTAAAGAC------CAAGAACCCGAAGCA
Pogonomyrmex_barbatus|16512  ------------------------------------------------GATTTTCAGACA
Linepithema_humile|4571      ------ATATTTAATGACGATGTTTCGGATACTAAGGATACTACGGAGGAGAGCGATGCG
Apis_mellifera|29177         ------GCATTTAATGATGATCCAATCGATACGAAAGAA---------GATAATGATGCA
Nasonia_vitripennis|1512     ------ACGTTCAACGACGATCCGCCGGACGCTAACGAT---------GACACTGACGCC
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 ---GATTGTGCATCACAAAGACGAAAAGCATTAAAA---AGAAAAACTGACGGAGATGCT
Anolis_carolinensis|17335    CCCTCCTGTGAACAGGAGCGGCGTGAAGCCATCGACGAGGCCCGGCAGCACCAGCAAGAG
Bos_taurus|28966             TCCTCGTGCGACCAGGAACAGCAGTCGGCCCTGGAGGAGGCCAGGCAGCCCAAGAACGAC
Oryzias_latipes|12555        CCCTCCTGTGACCAGGAGAGGCAGAGCGCTCTGAGCGACGCTCGGCACATCTCCGAGCAG
Ixodes_scapularis|16037      CAGGACTGCTCGAGCGCTCGCCGAAAGGCTCTGGAGGCCCACCGCCAGGCTCCCAAGGGC
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 TCCAACTGCTGGATGGATCAGTCGGTCACGCTGGAGGAGCAAGGCCACGGTGGAAAGAGC
Tribolium_castaneum|2895     AGTGATTGTCTTTCGGACCGGCAAACAGCCTTGAACGACGGCGGCCAA------------
Pediculus_humanus|10616      AACGATTGTTTCTCGGATAGACAAGCCGTACTCGCCGAACAAAGGTCGAATAAT------
Pogonomyrmex_barbatus|16512  CCGGCATGCTTATCAGCAAGACTGATTGCTCGACCGGGTGTACGA---------------
Linepithema_humile|4571      GCCGATTGCATATCGGATCAAAAATCAGCATTGGAAGATCAGAAGAAAAATTCGAAAGGC
Apis_mellifera|29177         AACGACTGTTTAACGGATAGACGATCTGTATTAGAAGATGAGAGGCAACATTCTCAGGAG
Nasonia_vitripennis|1512     AACGACTGCATATCGGACAGACGCTCGGTGATGGAAGATCAGCGTCAGAATTCCGACCGG
Pogonomyrmex_barbatus|16511  ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|27636 AGAATTTATATTCCAACATGTTCTCCAAAAAACTCATTATTATATGATAAAGTGCAATGC
Anolis_carolinensis|17335    GGCACCTTCATCCCTGAATGTGAGGGAGACGGCACG------TACAAGGCCGTCCAGTGC
Bos_taurus|28966             AACGTGGTCATCCCCGAGTGCGCCCATGGCGGCCTC------TACAAGCCGGTGCAGTGC
Oryzias_latipes|12555        GACGCCTTCATCCCGGACTGCGGTTCCGGAGGCCTC------TACCGGCCCGTGCAGTGC
Ixodes_scapularis|16037      AGGATCTACGTCCCGGAGTGCGGCAGCGACGGCACG------TACGCCGAGGCCCAGTGT
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 GTCCTATTTGTGCCGCAGTGCCTTCCGGATGGTCGC------TATCAGCGCATTCAGTGC
Tribolium_castaneum|2895     ---TTTTATGTCCCGGAATGCACCCCCGATGGCCGA------TATAAAAAGATTCAGTGC
Pediculus_humanus|10616      ---TTATACGTTCCTGAATGCACTCCCGACGGTCGA------TACAATCGCATACAATGT
Pogonomyrmex_barbatus|16512  ------------CCCGCTTGCCAAAACGATGGAACG------TATATGCCGGTTCAGTGC
Linepithema_humile|4571      AAATATTATATTCCAGATTGCACGTCCGATGGAAGG------TATCGTCGGGTGCAATGT
Apis_mellifera|29177         AAATTTTATGTACCTGCATGTACACCTGATGGAAGA------TACCACAGAGTCCAATGT
Nasonia_vitripennis|1512     AAATTCTACATTCCGGAGTGCACGCCGGACGGCAGG------TACCACAAAGTGCAGTGC
Pogonomyrmex_barbatus|16511  ---------------------ATGTCCGATGGAAGG------TATCATCGAGTGCAATGC
                                                                                         

Caenorhabditis_elegans|27636 TATGAT------GTTTCAATTTATTGTTGGTGTGTGGACGAACTGTCCGGAGAGCCAAAG
Anolis_carolinensis|17335    CACCAG------GCCACCGGGTATTGCTGGTGCGTGCGGACGGACACCGGGCGACCTGTT
Bos_taurus|28966             CATCCG------TCCACGGGCTACTGCTGGTGCGTCCTGGTGGACACCGGCCGCCCCATC
Oryzias_latipes|12555        CACCAG------TCCACCGGCTACTGCTGGTGTGTTCTGGAGGAGACAGGACGGCCCATA
Ixodes_scapularis|16037      CAC------------ACGGGCTACTGCTGGTGCGTCAATCAGCGCACCGGAAGACCCATC
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 TACTCCTCCACGTCCACTTCGTACTGCTGGTGCGTCAACGAGGACACGGGAAAGAGCATC
Tribolium_castaneum|2895     TACAAG------GCGGCCGGATATTGCTTCTGCGTGCACGAAGACACCGGAAAGAACATT
Pediculus_humanus|10616      TACAAA------TCGACGGGATACTGTTGGTGCGTCAACGAAGACGATGGAAAACCCATT
Pogonomyrmex_barbatus|16512  CACGCG------GAGACCGGGTATTGTTGGTGCGTAACGCCGCAA---GGCCGGCCGTTG
Linepithema_humile|4571      TAT------------TCGGGTTATTGCTGGTGCGTATATGAGGACACAGGTAAACCAATA
Apis_mellifera|29177         TAT------------TCAGGTTATTGTTGGTGTGTATATCAAGATACTGGCAAACCAATA
Nasonia_vitripennis|1512     TAC------------TCGGGCTACTGCTGGTGCGTCTACCAGGACACGGGCAAGCCGATA
Pogonomyrmex_barbatus|16511  TAT------------TCAGGTTATTGTTGGTGCGTATATCAAGATACAGGTAAGCCAATA
                                                                                         

Caenorhabditis_elegans|27636 TTAGGCTCATCGACAACAAGAGGAAAACCAAAATGT------------------------
Anolis_carolinensis|17335    CCGGGGACCTCTACGCGAAACTTCCCTCCAGACTGT------------------------
Bos_taurus|28966             CCCGGCACGTCCACCAGGTACGAGCAGCCGAAATGC------------------------
Oryzias_latipes|12555        GCTGGATCCGCCACAAGGTACAGGATGCCCGACTGT------------------------
Ixodes_scapularis|16037      CGAGGCATCGCCACCCTCGGCGTGAAGCCCGACTGC------------------------
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 CCGGGCACATCGGTGAAGAACAAGCGGCCTCAGTGT------------------------
Tribolium_castaneum|2895     CCGGGCACGTCGGTGAAAAATGGAAAGCCCAAATGC------------------------
Pediculus_humanus|10616      CCCGGAACATCCGTTAAAGATCAATTGCCCAAATGC------------------------
Pogonomyrmex_barbatus|16512  CCCGATACAACGGTAAGATACAAAAAACCGAGATGTTTGAGATCCGGTTCCAGATCTGCT
Linepithema_humile|4571      CCAGGCACATCCTCGAAAGATCACACGCCAAATTGT------------------------
Apis_mellifera|29177         CCTGGAACATCTTCCAAAAATCATACTCCAAATTGT------------------------
Nasonia_vitripennis|1512     CCGGGAACCTCCTCCAAGGACCTGACGCCGAACTGC------------------------
Pogonomyrmex_barbatus|16511  CCAGGAACATCCTCCAAGGATCGTTCGCCGAATTGT------------------------
                                                                                         

Caenorhabditis_elegans|27636 GAAGAA------------ACTCCAACAACTACAGTTGCTCCAAAAAGAGTGAGAAGAAAC
Anolis_carolinensis|17335    GAATTGGACACAGCAGCCAAAAGCACGGAAATGGGTTCCCTTTACCGGGACCGAACATTA
Bos_taurus|28966             GACAACACGGCCAGGGCTCATCCGGTCAGAACGCGGGACCTGTACAAGAGCCGCCAGCTC
Oryzias_latipes|12555        GACGGA---------------GCGCGGGTCACCGAGGACCCCTTCGCTGCGACAGACCTG
Ixodes_scapularis|16037      GCCGCC------------------------------GCGAGGCTACTCGCGAGGTCGTTC
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 GACGAG---------------------------------AGCGTGGCCGTGCGACCCATG
Tribolium_castaneum|2895     GACCAA------------------------------CTTTCGAACGGAAACCGGCCCATG
Pediculus_humanus|10616      GATTCC------------------------------GTTCCGGTTCCCATTCGACCCATG
Pogonomyrmex_barbatus|16512  GCTTCTATTAGGAGCGGCCAAAGGCGACGCTCACCTCAGCCTTGGAAACATAGACCGTAT
Linepithema_humile|4571      TATCCA------------------------------GTCCCAACTCCCAGTAGACCTATG
Apis_mellifera|29177         AATCCA------------------------------GTACCTATTCCTACTAGGCCTATG
Nasonia_vitripennis|1512     AATCCC------------------------------GTACCCGTGCCCGACAGACCCATG
Pogonomyrmex_barbatus|16511  AATCCA------------------------------GCTCCGACTCCTAGTAGACCTATG
                                                                                         

Caenorhabditis_elegans|27636 AATCGG---------------------TGTAAGGAAAAGAAGAGAACACGATTTCTGAGG
Anolis_carolinensis|17335    CCAGGT---------------------TGCCCTGGTCCCAAAAAGGCAGAGTTCCTCTCC
Bos_taurus|28966             CAAGGT---------------------TGTCCTGGTGCCAAAAAGCGCGAGTTTCTGACG
Oryzias_latipes|12555        CCAGGC---------------------TGCCCAGAGGGGAAGAAAGCGGAATTCATTACC
Ixodes_scapularis|16037      AAGGGC---------------------TGTTCCTACAAGAAGAAACAGACCTTCCTGACC
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 AAGGGA---------------------TGCACCGAGCCGCGCAAGACGCAGTTCCTCAAA
Tribolium_castaneum|2895     AAAGGC---------------------TGTCCCAACGAGAAAAAGACTATCTTCCTCCGA
Pediculus_humanus|10616      AAAGGT------------------------------------------------------
Pogonomyrmex_barbatus|16512  GTCGGTAGTAATAGGCAGCGGAATACCTGTGATCGCACTGAAAAGTCCAAGTTTAACGCA
Linepithema_humile|4571      AAAGGA---------------------TGTCCAGAAATGAAGAAACAACAATTTCTTCGG
Apis_mellifera|29177         AAAGGT---------------------TGTCCTGAACAAAAAAAACAATTGTTTCTACGT
Nasonia_vitripennis|1512     AAAGGT---------------------TGTCCGGAGCCGAAGAAGCAGCAGTTCTTGCGC
Pogonomyrmex_barbatus|16511  AAAGGA---------------------TGTCCAGAGTTGAAAAAACAATTATTCCTTCGG
                                                                                         

Caenorhabditis_elegans|27636 CGATTAGTATCAACTCTCAAATCAGAAATGATAATGAGTGGAATAAATGCAACAAAA---
Anolis_carolinensis|17335    AACCTGATCAAAGCCTTAGCTACGGATATGTTACAGTCACGGATGATGCCTGTCCCATAC
Bos_taurus|28966             AGCGTGCTGGACGCGCTGTCCACGGACATGGTCCACGCGGTCTCCGATCCCTCCTCCCCC
Oryzias_latipes|12555        AGCTTGTTAGATGCCCTCACCACAGACATGGTGCAGGCCATGAACTCACCAGCCCCCTCT
Ixodes_scapularis|16037      GAACTAATCGACAACTTCCGCCGGGACAAGGAGCGGAACGGCAGTTCTCCCGAGGGACCG
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 GAGCTAAAGGCTTACCTCAACACCTCTCTTCTGCCCAGCAGCACCACCGGTTCGAATTCT
Tribolium_castaneum|2895     GATCTCATCCAGTTCCTACATGCTCGCATGTTGAAAGATAACGACACGGTCAACCTATAC
Pediculus_humanus|10616      ---CTGATGGAATTTTTGGCGGACAAAGTCATTTCGAAAAACGTGACACAATATTCGATG
Pogonomyrmex_barbatus|16512  AACCTCATCGAAAATTTCAAAATCGAATACAGACGGACTAATATATCCGCTGAAGATGTT
Linepithema_humile|4571      GATTTGATGAATCTCATGCTGGAGAAAATGATGGCATCCAACACCGATTCTGACGAAACC
Apis_mellifera|29177         GATTTAATGGATTTGATGCATAAAAAGATGAAGGCTTCTGGCACTGATTCAGATGAAACA
Nasonia_vitripennis|1512     GACTTGATGGACCTGATGCAGAAGAAGATGAAAGCCTCCAGCACGGACTCGGACGAGGCG
Pogonomyrmex_barbatus|16511  GATTTAATGGATCTCATGCAGGAGAAAATGGAAACCTCTAGCAACAATTCTAATGAAACT
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------GTTAGCAGAGATTCAGCAATTAGA
Anolis_carolinensis|17335    CGCAGTAATTGGCTTTCAGAGGGCCTGGCGGGCCCCAGCCTGGAGGAGCGTGCGGTGCGC
Bos_taurus|28966             ------GGCAGGCTCTCGGAACCTGACCCCAGCCACACGCTGGAGGAGCGAGTAGTCCAC
Oryzias_latipes|12555        GGTGGTGGGAGGTTCGTTGAGCCCGACCCCAGCCACACCCTGGAGGAGCGGGTGGTGCAG
Ixodes_scapularis|16037      GCACCA------------------------------ATTACGCGAGACGAGGCGGTGCGG
Nematostella_vectensis|3686  ---------------------------------------------------------ATG
Drosophila_melanogaster|5234 AGCATG---TGGAAAACA---------------------GACGATGAGCGAATCGCCACT
Tribolium_castaneum|2895     AGCCTGCCCTGGATGTCC------------------TCGAAAGAGGAGCAGGCGGCCACT
Pediculus_humanus|10616      ---------------------------------------------GAACAAGTCGTGTCT
Pogonomyrmex_barbatus|16512  ------------------------------------AAAAATGTCGAACGGGTATTGTCG
Linepithema_humile|4571      ACCGCTAAATGGCAAACT------------------TCTAAAGAAGAACATATAGCTACA
Apis_mellifera|29177         ACAGCTAAATGGCAAGCT------------------TCTAAAGAGGAACAAATAGCAACT
Nasonia_vitripennis|1512     ACGGACAAGTGGCAGGCT------------------TCGAAGGAGGAGCGCGTCGCGACC
Pogonomyrmex_barbatus|16511  ACAGTTAAATGGGAGGCT------------------TCTAAGGAGGAAAGGATAGCCACG
                                                                                         

Caenorhabditis_elegans|27636 TGGAAGTTTAATCAACTCAATATAAATCATAATAATGTGCTTGAAAGAAGTGAATGG---
Anolis_carolinensis|17335    TGGCAGTTTGTGCGCCTGGACAAAGACTTCAGCAACAGCATCAGCGAGCGGGAGCTG---
Bos_taurus|28966             TGGTATTTCAAACTGCTGGATAAAAACAACAGTGGGGACATCGGCAAAAAGGAAATC---
Oryzias_latipes|12555        TGGTACTTTGACCAGCTGGACAACAACGGCAGTCAAGACGTCAACAAGAAGGAACTC---
Ixodes_scapularis|16037      TGGAAGTTCTCCAGCCTTGACGTCAATCTTAACAAGGTGCTCGAACGGCGCGAGTGG---
Nematostella_vectensis|3686  TGGAAGTTTAACCAACTCGATACCAACGCAGACTATTTCCTGGAATGGAGTGAGCTC---
Drosophila_melanogaster|5234 CTGAGCTTTGTTTATCTGGACAAGAACAAGAATAAGTCGTGGGATCGTCGAGAGTGG---
Tribolium_castaneum|2895     TGGAGCTTCGTCGAATTTGACAAGAACAAGAACAAAATGCTGGATCGGAACGAGTGG---
Pediculus_humanus|10616      CTCAGTTTTCTCTCGCTCGATTCGAACAATAATAAATATTTGGATAGAAAAGAATGG---
Pogonomyrmex_barbatus|16512  TGGAAATTCCTTATGCTGGATCAGAACGCGGACGGCTACTTGGATAAGGAAGAATAC---
Linepithema_humile|4571      TGGCATTTTGTGATGCTTGATAACAATAAAAACAAGGTCTTAGAAAGGAAAGAATGG---
Apis_mellifera|29177         TGGCATTTCGTCATGCTTGATAAAAATAAAAATAAAGTTTTAGAAAGAAAAGAATGG---
Nasonia_vitripennis|1512     TGGCACTTTGTCATGCTTGACAAAAACAAAAACAAGTTTTTGGAGCGAAAGGAATGG---
Pogonomyrmex_barbatus|16511  TGGCATTTTGTAATGCTTGATAAGAATAAAAATAAGGTTTTAGAAAGAAAAGAATGG---
                                 . **        * .*    .*    ..  .       ..  .  . **.      

Caenorhabditis_elegans|27636 ---AAACCTTTTAAA---------------------------------TCAGTTTTGTTA
Anolis_carolinensis|17335    ---CGGCCCCTGAAG---------------------------------CTGTACATGAAG
Bos_taurus|28966             ---AAGCCCTTCAAG---------------------------------AGATTTCTTCGG
Oryzias_latipes|12555        ---AAACCGTTCAAG---------------------------------AGGTACCTGAAG
Ixodes_scapularis|16037      ---AAGCCTTTCCGACGTGGCTGGAAGGACTTCCTCAAGAATGGCTCCAGGACCGGAGGC
Nematostella_vectensis|3686  ---CATGGTTTTCTG---------------------------------CGCATGTCAAAG
Drosophila_melanogaster|5234 ---AAGAACTTTCGC---------------------------------GATCTGGTTACC
Tribolium_castaneum|2895     ---AAGATTTTCAAA---------------------------------GAGGTCGTCGCG
Pediculus_humanus|10616      ---AAAAATTTTCGA---------------------------------ACTCTCATCGTC
Pogonomyrmex_barbatus|16512  ---AAAGAGCTCAGA---------------------------------AGACTCGCCAAG
Linepithema_humile|4571      ---AAAAGTTTTCGC---------------------------------ACAATGGTGGCA
Apis_mellifera|29177         ---AAAAGTTTTCGC---------------------------------TCAATGGTAGCG
Nasonia_vitripennis|1512     ---AAGAGCTTCCGA---------------------------------ACGATGGTGGCC
Pogonomyrmex_barbatus|16511  ---AAAAGTTTTCGT---------------------------------ACAATGGTAGCG
                                ..     * .                                               

Caenorhabditis_elegans|27636 GAATGGAAGAATGTCAGACAGTGCTCCAGAAATCTTTTCAAAACTTGCGATCTGAATAAG
Anolis_carolinensis|17335    AAGAACACCCGGCCCAAGCGCTGCGTCCGCAAGTTCCTGGACTACTGCGACTTGAACGAG
Bos_taurus|28966             AAGAAGTCCAAACCCAAGAAATGCGTGAAGAAGTTTGTGGAGTACTGCGATGTGAATAAC
Oryzias_latipes|12555        AAGAAGGCCAAGCCGAAGAGGTGCGCCCGCAAGTTCACCGACTACTGTGACCGGAACAAG
Ixodes_scapularis|16037      GGTCGCAAGAAACTGCGCAAGTGCTGGCGGAACTTCCTGCGCTACTGCGACGAAGACGCG
Nematostella_vectensis|3686  AAAGCGATTCACCCCAAGAAATGCAGCAAGACGTTTGTGGGTTACTGTGATGAGAACCAA
Drosophila_melanogaster|5234 AGTGCCAGCCACTTGCGCAGATGCGGCAAGAAGATGCCGCGCTACTGCGACGTCAATGGT
Tribolium_castaneum|2895     AAGGAGAAGAATTTGAGGAAGTGCGGCAAGAAGTTGCCGAGGTACTGTGATATTAATAAG
Pediculus_humanus|10616      GACAATAAAAACCTTAGACGTTGCGGAAAAAGACTACCTAGATTTTGCGATATTAATAAT
Pogonomyrmex_barbatus|16512  AAGGCAGTGAGACCGAAGAAGTGCGCGCGCACGTTTGCTCGCACGTGTGACCTAAATCGA
Linepithema_humile|4571      AATAATATGCAGCTTCGAAGGTGCGGTAAAAAATTACCAAGATATTGTGACATTAATAAT
Apis_mellifera|29177         AATAATAGACAACTTCAAAGATGTGGTAAAAGACTTCCAAGATATTGTGATATTAATAAT
Nasonia_vitripennis|1512     AACAACCCGCAGCTGCGCAGGTGCGGCAAGAAACTGCCGAGGTACTGTGATATCAACAAC
Pogonomyrmex_barbatus|16511  AATAATAAACAACTTCGGAGATGTGGTAAAAAATTACCGAAATATTGTGACATCAACAAT
                             ..       ..    .. .. **    .. *   *     . :  ** **    .*    

Caenorhabditis_elegans|27636 GATAGAAAATTGACATTCGATGAATGGAGAAAATGCATTGTTCAAGAAATCAACCGAGTA
Anolis_carolinensis|17335    AACAAGCTCATCTCCCTCCACGAGCTCAAAGGCTGCCTGGGCTTGAGC------------
Bos_taurus|28966             GACAAGTCCATCTCCCTGCAAGAGCTGATGGGCTGCCTGGGCGCGACCAGAGAGGAGGTC
Oryzias_latipes|12555        GACCGGGCCATCTcgctgcaggagctgaagggCTGCCTGGGCGTCGGCAAGGAGGGAAGC
Ixodes_scapularis|16037      GACAACCGAGTCACTTTCGACGAGTGGATTAAGTGCACGGAGCAAGCGCCGGTGCCCGCG
Nematostella_vectensis|3686  GACCAGAGGATCTCACGCAACGAGTGGTACGCCTGCTTCGGTGTCCAAGGTACCAGCATA
Drosophila_melanogaster|5234 GACAAAAAGATCTCGCTGGCCGAGTGGCTCAATTGCCTGCAAGCAACTCCGCGGGAAAGT
Tribolium_castaneum|2895     GACCGGCACATAAGCATGACGGAGTGGCTCGACTGCCTCAACGTG------CAGCAAGGA
Pediculus_humanus|10616      GATAGAAGGATCAGTATGACGGAATGGACGAATTGTTTACAT------------------
Pogonomyrmex_barbatus|16512  GATTTAAAACTATCCAAACAGGAATGGGGTGCTTGTCTCGCCAATGACTTCACTCAAACC
Linepithema_humile|4571      GACAGAAAAATCAGTATGACAGAATGGTACAGCTGTCTTAATATT------CAGCATCCA
Apis_mellifera|29177         GATAGAAAAATTAGCATGACGGAATGGTTCAGTTGTCTAAATGCT------CAACGTACT
Nasonia_vitripennis|1512     GATCGTGAGATCAGCATGACGGAATGGCTCAGCTGTCTCAATGCC------CAGCGGCCG
Pogonomyrmex_barbatus|16511  GATAGAAGGATCAGTATGACAGAATGGCTCAGCTGTCTCAATGCT------CAGCGTCCA
                             .*        * :      . **.      .  **                         

Caenorhabditis_elegans|27636 CCAGCCAAACGTCCAGATCAACTAAACCCATTCCTGTACATTTTAAGATCAGAA------
Anolis_carolinensis|17335    ------------------------------------------------------------
Bos_taurus|28966             AAGGCGGACACGAGGAAGCGCCACACCCCTAGAGGTAATGCTGAAAGCACTTCTAATAGA
Oryzias_latipes|12555        TCAACCACAGTCGGGAACAAAGGGACCAGGCAGGGGACAAACGTCTTCTGTCGCCTGGTG
Ixodes_scapularis|16037      GCTACGCAACGACGACAGCTGTGCAAGTGCTTTTTTGTGCGAGCAACATTGCGCGGCAAG
Nematostella_vectensis|3686  TGGCAAATCAGAAGAGAATCATTT------------------------------------
Drosophila_melanogaster|5234 GCCACCACGGCCAAGCCGGCACAGTCAAATGAGACCGCCAGTCCAAAGTTTCAAGGTGTG
Tribolium_castaneum|2895     GCCACAACGAGCGCCCCCAGCTCG------------------TCCAGAGCCGGCAAAAAG
Pediculus_humanus|10616      ------------------------------------------------AGGAGGGGGCCA
Pogonomyrmex_barbatus|16512  GAACTCTTG---------------------------------------------------
Linepithema_humile|4571      GCAACAGCCAACGATCCAGAGAAA------ACATCAACGAGTACACCGAGGAGAGGTCCA
Apis_mellifera|29177         ACAACATGTAAT------------------------------------------------
Nasonia_vitripennis|1512     GCTACTGCTGACAGCTCGATGGAAAAGGCCTCGACGTTGAAGCCCAAAAGAATGGGTCCC
Pogonomyrmex_barbatus|16511  ACAACAGTCGATGATCCAGCGAAA------ACATCAATTACTCCAAAAAGAATAGGTCCA
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------------------------------
Anolis_carolinensis|17335    ------------------------------------------------------------
Bos_taurus|28966             CAGCCAAGGAAGCAAGGA------------------------------------------
Oryzias_latipes|12555        ------------------------------------------------------------
Ixodes_scapularis|16037      GAACTCCGACGTCAGCAGAAGCGTCGACGCATTATCGATGACGTCAAGGGCAACGCCACG
Nematostella_vectensis|3686  ------------------------------------------------------------
Drosophila_melanogaster|5234 AAT------------------------------------------------------CCG
Tribolium_castaneum|2895     AAC------------------------------------------------------CCC
Pediculus_humanus|10616      AAT------------------------------------------------------CCA
Pogonomyrmex_barbatus|16512  ------------------------------------------------------------
Linepithema_humile|4571      AAT------------------------------------------------------CCA
Apis_mellifera|29177         ------------------------------------------------------------
Nasonia_vitripennis|1512     AAC------------------------------------------------------CCA
Pogonomyrmex_barbatus|16511  AAT------------------------------------------------------CCA
                                                                                         

Caenorhabditis_elegans|27636 ------------------------------------TAA
Anolis_carolinensis|17335    ------------------------------------TAA
Bos_taurus|28966             ------------------------------------TAG
Oryzias_latipes|12555        ------------------------------------TGA
Ixodes_scapularis|16037      CTTTCTCGCTTGACGAAAAGCGAAACTAACAAGAAGTGA
Nematostella_vectensis|3686  ------------------------------------TAA
Drosophila_melanogaster|5234 GTGGAGCGATATCTGAAAGAT---------------TAA
Tribolium_castaneum|2895     CTGGATGTACTAATAGAAGAT---------------TAG
Pediculus_humanus|10616      CTTAAATCCTACCTGAAAGATGACGAT---------TAA
Pogonomyrmex_barbatus|16512  ------------------------------------TAA
Linepithema_humile|4571      ATAGACTTAATTCTCTATGGTGAT------------TAA
Apis_mellifera|29177         ---------TATTTT---------------------TAA
Nasonia_vitripennis|1512     CTCGATCAGTTCCTTAACGACGACGAT------------
Pogonomyrmex_barbatus|16511  TTAGACCGATTCCTCAATGATGATGAC---------TAG
                                                                    

multiple sequence alignment in CLUSTALW format


Caenorhabditis_elegans|23135 ------------------------------------------------------------
Anolis_carolinensis|9435     ------------------------------------------------------------
Bos_taurus|3494              ------------------------------------------------------------
Oryzias_latipes|11752        ------------------------------------------------------------
Ixodes_scapularis|16038      ------------------------------------------------------------
Nematostella_vectensis|7792  ------------------------------------------------------------
Nematostella_vectensis|13975 ------------------------------------------------------------
Drosophila_melanogaster|4810 ------------------------------------------------------------
Tribolium_castaneum|10254    ---------------------------------------------------------MGR
Pediculus_humanus|10414      ------------------------------------------------------------
Pogonomyrmex_barbatus|8376   ---------------------------MCSCARACFSDEFPVHSSFSSFSEKHIDKIGEN
Linepithema_humile|8244      ------------------------------------------------------------
Apis_mellifera|196           ------------------------------------------------------------
Nasonia_vitripennis|2083     MLTDNELVRTTLVSGEPELGKAFLFEAAISWAKEGRQIHYFTSKQLESLPPAFHDRSEPS
Pogonomyrmex_barbatus|8377   ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|23135 ------------------------------------------------------------
Anolis_carolinensis|9435     ------------------------------------------------------------
Bos_taurus|3494              ------------------------------------------------------------
Oryzias_latipes|11752        ------------------------------------------------------------
Ixodes_scapularis|16038      ---MSDQRRRWLPLRS--------------------------------------------
Nematostella_vectensis|7792  ------------------------------------------------------------
Nematostella_vectensis|13975 ------------------------------------------------------------
Drosophila_melanogaster|4810 MLARCVLFVTWLAVF---------------------------------------------
Tribolium_castaneum|10254    AARTEHLFTIATGMQTQSVEH---------------------------------------
Pediculus_humanus|10414      ---MKNLVLILVLLSIETFFQII-------------------------------------
Pogonomyrmex_barbatus|8376   AMMIPTIRAIVVLLFIVDFDAVAAN-----------------------------------
Linepithema_humile|8244      ------------------------------------------------------------
Apis_mellifera|196           ------------------------------------------------------------
Nasonia_vitripennis|2083     ANALKNITFIYTPSYEELIAQLIRLRSFQKPPSILLVDELDVFSDYRNIGSSSRELHAAR
Pogonomyrmex_barbatus|8377   ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|23135 ------------------------------------------------------------
Anolis_carolinensis|9435     ------------------------------------------------------------
Bos_taurus|3494              ------------------------------------------------------------
Oryzias_latipes|11752        ------------------------------------------------------------
Ixodes_scapularis|16038      ------------------------------------------------------------
Nematostella_vectensis|7792  ------------------------------------------------------------
Nematostella_vectensis|13975 ------------------------------------------------------------
Drosophila_melanogaster|4810 ------------------------------------------------------------
Tribolium_castaneum|10254    ------------------------------------------------------------
Pediculus_humanus|10414      ------------------------------------------------------------
Pogonomyrmex_barbatus|8376   ------------------------------------------------------------
Linepithema_humile|8244      ------------------------------------------------------------
Apis_mellifera|196           ------------------------------------------------------------
Nasonia_vitripennis|2083     CCAVLLNAAQSCARLTCPPLVHVCVTSFSTDQARRATYGKYFDNFWNISSETAGSVWMRR
Pogonomyrmex_barbatus|8377   ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|23135 ------------------------------------------------------------
Anolis_carolinensis|9435     ------------------------------------CPHERGRPICGSDGKLYKSPCLFQ
Bos_taurus|3494              ----------------------------------------------NSDDASAPALE---
Oryzias_latipes|11752        ---------------------------------------------------------MET
Ixodes_scapularis|16038      ---------------SDGDASRKCAVSDADCSEAD------SRVLCGSDGRTYSSQCEVD
Nematostella_vectensis|7792  -----------------------------------------ASPVCGTDMRTYASRCHLQ
Nematostella_vectensis|13975 ------------------------------------------------------------
Drosophila_melanogaster|4810 ---------------IATGKSDDQLMKLPACAAKQGECDDNEGPVCGTDGQTYPTRCHLL
Tribolium_castaneum|10254    ---------------LGNRDAAETPCNPKACSKDVDN----EKNVCGSDGLTYPNRCHFE
Pediculus_humanus|10414      ---------------SAGNDGETCSKSFEECEKVFNGKKKQDLKLCGSNNVTYVNRCFLE
Pogonomyrmex_barbatus|8376   ---------------TVTSAKEECRKRIAECMMNGGG----SMPMCGSDGITYSNQCQVI
Linepithema_humile|8244      -----------------------------------GG----NTPVCGSDGITYSSQCQVI
Apis_mellifera|196           ---------------------EECRKRIAECTMSDGA----STPVCGSDGVTYSSHCRVI
Nasonia_vitripennis|2083     GDGQKAMEFKRLDDAVLVLKREDCRWKLNACTTDASA----NVPVCGSDGLTYPNQCRVI
Pogonomyrmex_barbatus|8377   ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|23135 -MRPEHLSLQLL------------------------------------------------
Anolis_carolinensis|9435     RARCRDPSLEALPRFRCGVAAHREPNKDRMAALSQSRRQAHGTYVPECDEGGSFQQVQCH
Bos_taurus|3494              -TQPQGDEEDVASRYPTL------------------------------------------
Oryzias_latipes|11752        HTPPEGDEITPSTL----------------------------------------------
Ixodes_scapularis|16038      RARCEGHLVEVKHEGQCP-DARRCW-SQRSQALEQVRSGASGVFVPDCSADGAFVQVQCH
Nematostella_vectensis|7792  LAKCKGHKVKMIYKGRCKGEKEKCP--------RQKKSIPFSGYVPECDSDGSYQSVQCL
Nematostella_vectensis|13975 ------------------------------------------------------------
Drosophila_melanogaster|4810 RAQCGGHQVSLKYSGSCN----ACL-EAVKFA-RRQQERDPGYFVPRCRKDGNFAAMQCY
Tribolium_castaneum|10254    KARCVNKNLTLAKRGPCR-QQKLCR--DWEIY-RHSNPDYK--FHATCRPDGSYAAAQCH
Pediculus_humanus|10414      MDVCIGNKITIKHKGRCR-TRQPCF-RELKKA-ERNRENQE--FVPTCLKDGTFSPMQCH
Pogonomyrmex_barbatus|8376   SKQCQGMSVLIKHSGPCP-----------------------GLYLYLCP-----------
Linepithema_humile|8244      SKQCQGISILIKHTGSCP-ETPACF------S-ARLTARSG--AQPVCRSDGTYAPVQCH
Apis_mellifera|196           SKQCQGMSILIKHTGPCP-ETPACF------S-ARLTARPS--ARPICRSDGTYAPVQCH
Nasonia_vitripennis|2083     SKQCLGESILVKHTGPCS-ETPPCL------S-ARVTARPG--ARIVCRPDGTYAPVQCH
Pogonomyrmex_barbatus|8377   ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|23135 -----AWIYLINGNPIVQ------------------------------------------
Anolis_carolinensis|9435     KQTGYCWCSTPEGKPISGTSVLNG---TPNCTGTFPILMPYS------------------
Bos_taurus|3494              ------WTEQVKSRQN----KTNK------------------------------------
Oryzias_latipes|11752        ------WEKHFNEKYFRPNNSTSR------------------------------------
Ixodes_scapularis|16038      RLTGYCWCVDAQGKVLSGSSVQNR---RPNC-----------------------------
Nematostella_vectensis|7792  QPSTSCWCVDASGTEIPATRVTNQ---RPACPSKFKHLSSYKGKFHC-------------
Nematostella_vectensis|13975 ------------------------------------------------------------
Drosophila_melanogaster|4810 GNNG-CWCSDSQGRPIADDNKQFRRKGKLRCRANRRDRRRLASHQIG-------------
Tribolium_castaneum|10254    PDTGFCWCVTPQGIPLPYTSVRWRPDAKPHCGRKKKSTRRRSPPRKG-------------
Pediculus_humanus|10414      NETGFCWCVTPKGKLIPNSAKRHD---KPNCSRKFKM-RRRASVRKD-------------
Pogonomyrmex_barbatus|8376   ----LVWTIHAQ------------------------------------------------
Linepithema_humile|8244      MESGYCWCVTKQGRPLPDTSVRHQ---KPRCSK-LGS-RSAASTRNG-------------
Apis_mellifera|196           EETGYCWCVTPQGRPLPDTSVRNE---RPRCIKKLGP-RSSASTKSG-------------
Nasonia_vitripennis|2083     PQTSYCWCVTPQGRPIPNSTVREG---RPRCARAGAA-AAAAVAGNGSGAGTGPGETTRS
Pogonomyrmex_barbatus|8377   ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|23135 ------------------------------------------------------------
Anolis_carolinensis|9435     ------------------------------------------------------------
Bos_taurus|3494              ------------------------------------------------------------
Oryzias_latipes|11752        ------------------------------------------------------------
Ixodes_scapularis|16038      -----------------------THPGCTNADRSQFNGNLVDIFQKEFKRLPSQPASDMS
Nematostella_vectensis|7792  ------YVYGTQFVWVDLRFFFFGLVGCPENVRASFNAEVINLLEREFLAYARRSSSDDS
Nematostella_vectensis|13975 ------------------------------------------------------------
Drosophila_melanogaster|4810 -----YNPDTSASKGSSEAGSTAHR-TCSKSDRSQFNTNLMRMFRNEA-------QSFFR
Tribolium_castaneum|10254    -----------------------RNRTCKQLDKAKFNNNLINIFHTEW----SRDHGGVI
Pediculus_humanus|10414      -----------------------NKEICGPNDKQKFSENLLNLFRAEY----GKDLNEDV
Pogonomyrmex_barbatus|8376   ------------------------------------------------------------
Linepithema_humile|8244      -----QRRRSPSWKQRRQYVSNRHRNTCDRSEKSKFHENLIENFKIEY-----RRINISV
Apis_mellifera|196           -----QRRRSPNWKQRRQY-SSKHRNTCDRTEKSKFNGNLIENFKIEY-----RRTNISS
Nasonia_vitripennis|2083     RANGQRSRSSQNWKQRRQY-SNRHRNTCDRVDKARFNGNLIENFKIEY-----RRINGSA
Pogonomyrmex_barbatus|8377   ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|23135 -----------------KGGLEVLDITDSNDLSVRQRFEEVIRL----------------
Anolis_carolinensis|9435     -----------------LGSRDGLD-QGSPNFLSRGPVHN----------PSDCL-----
Bos_taurus|3494              ------------------------------------------------------------
Oryzias_latipes|11752        ------------------------------------------------------------
Ixodes_scapularis|16038      QLPASLLDTTEKQVI--QWKFTELD-LNRDEVLQRREVRDLRRMARRFVEPRACARSFTR
Nematostella_vectensis|7792  Q-----SIAGIRLVHLLMWKFNQLD-TNADYFLEWSELHGFLRMSKKAIHPKKCSKTFVG
Nematostella_vectensis|13975 ------------------------------------------------------------
Drosophila_melanogaster|4810 Q-----PSLSDSHIL--EWQFSKLD-TNGNKLLDRQEIRELKKVLRRNVKPRRCGRTFGK
Tribolium_castaneum|10254    K-----PHNNESDLLVNQWKFGTMD-ADRNGVLDKNEYRDLKRVAKKAVKPKKCAKMFPK
Pediculus_humanus|10414      D-----TVLLNQKIL--NWKFQSID-RNDDEYLQRAEYKVLRRL-KKLIKPKKCAKMFAK
Pogonomyrmex_barbatus|8376   ------------------------------------------------------------
Linepithema_humile|8244      D-----DDKNVEQIL--SWKFITLD-KDGDGFLDRAEYKELRRLAKKAVRPKKCARTFAR
Apis_mellifera|196           D-----GDKNVERVL--SWKFITLD-KNSDGYLDRTEYKELRRLAKKAVKPKKCARTFAR
Nasonia_vitripennis|2083     E-----AEKNAERVL--SWKFGSLD-KDGDGYLDRDEYKELRRLAKKAVRPKKCARTFAR
Pogonomyrmex_barbatus|8377   ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|23135 ------------------------------------------------------------
Anolis_carolinensis|9435     ------TLPIPWAEWMALNLNDTG------------------------------------
Bos_taurus|3494              ------------------------------------------------------------
Oryzias_latipes|11752        ------------------------------------------------------------
Ixodes_scapularis|16038      YCDHNQDKRISRSEWSVCLGVDINNEEHGGAAAEAAAPSTAPPAHRDRAAAVPRTPSMPR
Nematostella_vectensis|7792  YCDENQDQRISRNEWYACFENHFNLTP---------------------------------
Nematostella_vectensis|13975 ------------------------------------------------------------
Drosophila_melanogaster|4810 YCDVTKDANLNWLEWSVCFTKEFHNRSAVVNLLASSAATAPPHSTHYSIHNTNVNGHHRG
Tribolium_castaneum|10254    SCDVNSDTLITQQEWAECLTRDGM----------DDGGGIN-------------------
Pediculus_humanus|10414      ICDLDRDFKISKSEWSACLGVSMI------------------------------------
Pogonomyrmex_barbatus|8376   ------------------------------------------------------------
Linepithema_humile|8244      TCDLDRDLKLSRQEWGACLANDFTLRLFLSLNPADERSEVP-------------------
Apis_mellifera|196           TCDLNRDLKLSRQEWGACLANDFT----------HERPEVP-------------------
Nasonia_vitripennis|2083     TCDLNQDLRLSRAEWGACLANDFT------------------------------------
Pogonomyrmex_barbatus|8377   ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|23135 ------------------------------------------------------------
Anolis_carolinensis|9435     ------------------------------------------------------------
Bos_taurus|3494              ------------------------------------------------------------
Oryzias_latipes|11752        ------------------------------------------------------------
Ixodes_scapularis|16038      PALQDSPRRDPGGADEFLLSKVARSRVVIGGGDEDDDRNDGERLRPPGGIWGDPDTRLNS
Nematostella_vectensis|7792  -----------------------------------------------------PSNQSRG
Nematostella_vectensis|13975 ------------------------------------------------------------
Drosophila_melanogaster|4810 HTNTIGTGVNPHSYSEDASGSEEHEDNYEDSATGYGGEEDDSQGADL------PSSRTHI
Tribolium_castaneum|10254    ------------------------------NSEDNGDDQEDYADAFP------PHRPLPH
Pediculus_humanus|10414      ----------------------------------------TLKGSPI------ASLSGQ-
Pogonomyrmex_barbatus|8376   ------------------------------------------------------------
Linepithema_humile|8244      ------------------------------EAQRTRPTDQVLKGSPA------PIHSLS-
Apis_mellifera|196           ------------------------------EAQRTRVMDQVLKGNPP------SMHSRP-
Nasonia_vitripennis|2083     ----------------------------------------LLQGNPS------PVHARP-
Pogonomyrmex_barbatus|8377   ------------------------------------------------------------
                                                                                         

Caenorhabditis_elegans|23135 ---------------------DCASQRRKALK-RKTDGDARIYIPTCSPKNSLLYDKVQC
Anolis_carolinensis|9435     -----------QHNATSNYPPSCEQERREAIDEARQHQQEGTFIPECEGDGT--YKAVQC
Bos_taurus|3494              -----------------NSVSSCDQEQQSALEEARQPKNDNVVIPECAHGGL--YKPVQC
Oryzias_latipes|11752        ---------------KQDKVPSCDQERQSALSDARHISEQDAFIPDCGSGGL--YRPVQC
Ixodes_scapularis|16038      GTRYTDDQ-DVLENKDEDEVQDCSSARRKALEAHRQAPKGRIYVPECGSDGT--YAEAQC
Nematostella_vectensis|7792  RLMGFNLPPLSLPREKGEYHDRCIGEYLAALRSPQQSPSGQSYLPKCQSDGS--FVPMQC
Nematostella_vectensis|13975 ------------------------------------------------------------
Drosophila_melanogaster|4810 PSLYMLNSKPETASQDLENDSNCWMDQSVTLEEQGHGGKSVLFVPQCLPDGR--YQRIQC
Tribolium_castaneum|10254    ALTYDDDSSEIRD----EDPSDCLSDRQTALNDGGQ-----FYVPECTPDGR--YKKIQC
Pediculus_humanus|10414      --LPGFEHVNRKD--QEPEANDCFSDRQAVLAEQRSNN---LYVPECTPDGR--YNRIQC
Pogonomyrmex_barbatus|8376   ----------------DFQTPACLSARLIARPGVR---------PACQNDGT--YMPVQC
Linepithema_humile|8244      --IFNDDVSDTKDTTEESDAADCISDQKSALEDQKKNSKGKYYIPDCTSDGR--YRRVQC
Apis_mellifera|196           --AFNDDPIDTKE---DNDANDCLTDRRSVLEDERQHSQEKFYVPACTPDGR--YHRVQC
Nasonia_vitripennis|2083     --TFNDDPPDAND---DTDANDCISDRRSVMEDQRQNSDRKFYIPECTPDGR--YHKVQC
Pogonomyrmex_barbatus|8377   -----------------------------------------------MSDGR--YHRVQC
                                                                                         

Caenorhabditis_elegans|23135 YD--VSIYCWCVDELSGEPKLGSSTTRGKPKC--------EE----TPTTTVAPKRVRRN
Anolis_carolinensis|9435     HQ--ATGYCWCVRTDTGRPVPGTSTRNFPPDC--------ELDTAAKSTEMGSLYRDRTL
Bos_taurus|3494              HP--STGYCWCVLVDTGRPIPGTSTRYEQPKC--------DNTARAHPVRTRDLYKSRQL
Oryzias_latipes|11752        HQ--STGYCWCVLEETGRPIAGSATRYRMPDC--------DG-----ARVTEDPFAATDL
Ixodes_scapularis|16038      H----TGYCWCVNQRTGRPIRGIATLGVKPDC--------AA----------ARLLARSF
Nematostella_vectensis|7792  YP--AIGYCWCVDEQTGKHIPGTTKKTNSLDC--------------------TRYSKYE-
Nematostella_vectensis|13975 ------------------------------------------------------------
Drosophila_melanogaster|4810 YSSTSTSYCWCVNEDTGKSIPGTSVKNKRPQC--------DE-----------SVAVRPM
Tribolium_castaneum|10254    YK--AAGYCFCVHEDTGKNIPGTSVKNGKPKC--------DQ----------LSNGNRPM
Pediculus_humanus|10414      YK--STGYCWCVNEDDGKPIPGTSVKDQLPKC--------DS----------VPVPIRPM
Pogonomyrmex_barbatus|8376   HA--ETGYCWCVTPQ-GRPLPDTTVRYKKPRCLRSGSRSAASIRSGQRRRSPQPWKHRPY
Linepithema_humile|8244      Y----SGYCWCVYEDTGKPIPGTSSKDHTPNC--------YP----------VPTPSRPM
Apis_mellifera|196           Y----SGYCWCVYQDTGKPIPGTSSKNHTPNC--------NP----------VPIPTRPM
Nasonia_vitripennis|2083     Y----SGYCWCVYQDTGKPIPGTSSKDLTPNC--------NP----------VPVPDRPM
Pogonomyrmex_barbatus|8377   Y----SGYCWCVYQDTGKPIPGTSSKDRSPNC--------NP----------APTPSRPM
                                                                                         

Caenorhabditis_elegans|23135 NR-------CKEKKRTRFLRRLVSTLKSEMIMSGINATK-------------VSRDSAIR
Anolis_carolinensis|9435     PG-------CPGPKKAEFLSNLIKALATDMLQSRMMPVPYRSNWLSEGLAGPSLEERAVR
Bos_taurus|3494              QG-------CPGAKKREFLTSVLDALSTDMVHAVSDPSSP--GRLSEPDPSHTLEERVVH
Oryzias_latipes|11752        PG-------CPEGKKAEFITSLLDALTTDMVQAMNSPAPSGGGRFVEPDPSHTLEERVVQ
Ixodes_scapularis|16038      KG-------CSYKKKQTFLTELIDNFRRDKERNGSSPEGPAP----------ITRDEAVR
Nematostella_vectensis|7792  ---------CTSQIWPIYKRKLLHLFRKEVRRSARSGNLVAWGTF-------LSDNQVLA
Nematostella_vectensis|13975 -----------------------------------------------------------M
Drosophila_melanogaster|4810 KG-------CTEPRKTQFLKELKAYLNTSLLPSSTTGSNSSM-WKT-------DDERIAT
Tribolium_castaneum|10254    KG-------CPNEKKTIFLRDLIQFLHARMLKDNDTVNLYSLPWMS------SKEEQAAT
Pediculus_humanus|10414      KG-------------------LMEFLADKVISKNVTQYSM---------------EQVVS
Pogonomyrmex_barbatus|8376   VGSNRQRNTCDRTEKSKFNANLIENFKIEYRRTNISAEDV------------KNVERVLS
Linepithema_humile|8244      KG-------CPEMKKQQFLRDLMNLMLEKMMASNTDSDETTAKWQT------SKEEHIAT
Apis_mellifera|196           KG-------CPEQKKQLFLRDLMDLMHKKMKASGTDSDETTAKWQA------SKEEQIAT
Nasonia_vitripennis|2083     KG-------CPEPKKQQFLRDLMDLMQKKMKASSTDSDEATDKWQA------SKEERVAT
Pogonomyrmex_barbatus|8377   KG-------CPELKKQLFLRDLMDLMQEKMETSSNNSNETTVKWEA------SKEERIAT
                                                                                         

Caenorhabditis_elegans|23135 WKFNQLNINHNNVLERSEW--KPFK-----------SVLLEWKNVRQCSRNLFKTCDLNK
Anolis_carolinensis|9435     WQFVRLDKDFSNSISEREL--RPLK-----------LYMKKNTRPKRCVRKFLDYCDLNE
Bos_taurus|3494              WYFKLLDKNNSGDIGKKEI--KPFK-----------RFLRKKSKPKKCVKKFVEYCDVNN
Oryzias_latipes|11752        WYFDQLDNNGSQDVNKKEL--KPFK-----------RYLKKKAKPKRCARKFTDYCDRNK
Ixodes_scapularis|16038      WKFSSLDVNLNKVLERREW--KPFRRGWKDFLKNGSRTGGGRKKLRKCWRNFLRYCDEDA
Nematostella_vectensis|7792  WKFHQLDSNRDRIINSREFFVVSMK-----------KMLGKIKRGRKCSRKLLADCDFDK
Nematostella_vectensis|13975 WKFNQLDTNADYFLEWSEL--HGFL-----------RMSKKAIHPKKCSKTFVGYCDENQ
Drosophila_melanogaster|4810 LSFVYLDKNKNKSWDRREW--KNFR-----------DLVTSASHLRRCGKKMPRYCDVNG
Tribolium_castaneum|10254    WSFVEFDKNKNKMLDRNEW--KIFK-----------EVVAKEKNLRKCGKKLPRYCDINK
Pediculus_humanus|10414      LSFLSLDSNNNKYLDRKEW--KNFR-----------TLIVDNKNLRRCGKRLPRFCDINN
Pogonomyrmex_barbatus|8376   WKFLMLDQNADGYLDKEEY--KELR-----------RLAKKAVRPKKCARTFARTCDLNR
Linepithema_humile|8244      WHFVMLDNNKNKVLERKEW--KSFR-----------TMVANNMQLRRCGKKLPRYCDINN
Apis_mellifera|196           WHFVMLDKNKNKVLERKEW--KSFR-----------SMVANNRQLQRCGKRLPRYCDINN
Nasonia_vitripennis|2083     WHFVMLDKNKNKFLERKEW--KSFR-----------TMVANNPQLRRCGKKLPRYCDINN
Pogonomyrmex_barbatus|8377   WHFVMLDKNKNKVLERKEW--KSFR-----------TMVANNKQLRRCGKKLPKYCDINN
                               *  :: : .      *     :                   . ::* : :   ** : 

Caenorhabditis_elegans|23135 DRKLTFDEWRKCIVQEINRVPAKRPDQLNPFLYILRSE----------------------
Anolis_carolinensis|9435     NKLISLHELKGCLGLS--------------------------------------------
Bos_taurus|3494              DKSISLQELMGCLGATREEVKADTRKRHTPRGNAESTSNRQPRKQG--------------
Oryzias_latipes|11752        DRAISLQELKGCLGVGKEGSSTTVGNKGTRQGTNVFCRLV--------------------
Ixodes_scapularis|16038      DNRVTFDEWIKCTEQAPVPAATQRRQLCKCFFVRATLRGKELRRQQKRRRIIDDVKGNAT
Nematostella_vectensis|7792  DNGLSLNEWSYCLSNRYQVHLS--------------------------------------
Nematostella_vectensis|13975 DQRISRNEWYACFGVQGTSIWQIRRESF--------------------------------
Drosophila_melanogaster|4810 DKKISLAEWLNCLQATPRESATTAKPAQSNETASPKFQGVN------------------P
Tribolium_castaneum|10254    DRHISMTEWLDCLNV--QQGATTSAPSS------SRAGKKN------------------P
Pediculus_humanus|10414      DRRISMTEWTNCLH----------------------RRGPN------------------P
Pogonomyrmex_barbatus|8376   DLKLSKQEWGACLANDFTQTELL-------------------------------------
Linepithema_humile|8244      DRKISMTEWYSCLNI--QHPATANDPEK--TSTSTPRRGPN------------------P
Apis_mellifera|196           DRKISMTEWFSCLNA--QRTTTCN------------------------------------
Nasonia_vitripennis|2083     DREISMTEWLSCLNA--QRPATADSSMEKASTLKPKRMGPN------------------P
Pogonomyrmex_barbatus|8377   DRRISMTEWLSCLNA--QRPTTVDDPAK--TSITPKRIGPN------------------P
                             :  ::  *   *                                                

Caenorhabditis_elegans|23135 ------------
Anolis_carolinensis|9435     ------------
Bos_taurus|3494              ------------
Oryzias_latipes|11752        ------------
Ixodes_scapularis|16038      LSRLTKSETNKK
Nematostella_vectensis|7792  ------------
Nematostella_vectensis|13975 ------------
Drosophila_melanogaster|4810 VERYLKD-----
Tribolium_castaneum|10254    LDVLIED-----
Pediculus_humanus|10414      LKSYLKDDD---
Pogonomyrmex_barbatus|8376   ------------
Linepithema_humile|8244      IDLILYGD----
Apis_mellifera|196           ---YF-------
Nasonia_vitripennis|2083     LDQFLNDDD---
Pogonomyrmex_barbatus|8377   LDRFLNDDD---