Orthologs Set ID: EOG4006C2


Orthology Database
OrthoDB4
Gene Symbol(s)
SLC28A3

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Anolis carolinensis 1480 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846
Bos taurus 25488 117, 216, 320, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Caenorhabditis elegans 24820 271, 430, 605, 750, 1337, 1634, 1764, 1948
Callithrix jacchus 43513 117, 216, 314, 412, 605, 750, 864, 964, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Canis familiaris 612 117, 216, 320, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Cavia porcellus 2593 216, 314, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Choloepus hoffmanni 2733 117, 216, 314, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Dasypus novemcinctus 94 117, 216, 314, 412, 591, 600, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Dipodomys ordii 1002 216, 282, 306, 314, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Equus caballus 15106 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Equus caballus 15108 216, 314, 412, 605, 750, 864, 963, 998, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Erinaceus europaeus 9218 117, 216, 281, 320, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1907, 1926, 1936, 1948, 2087
Felis catus 45683 117, 216, 314, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Fugu rubripes 5460 320, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1385, 1560, 1764, 1846, 1948, 2087, 2184
Gallus gallus 22892 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Gorilla gorilla 5611 117, 216, 314, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 2087
Homo sapiens 93736 117, 216, 314, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Loxodonta africana 22574 216, 314, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Macropus eugenii 618 216, 314, 412, 605, 684, 698, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Microcebus murinus 10641 117, 216, 314, 412, 605, 750, 864, 963, 1047, 1254, 1388, 1560, 1764, 1846, 1948
Monodelphis domestica 26362 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Mus musculus 11155 117, 216, 314, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Myotis lucifugus 6147 117, 216, 314, 343, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1314, 1388, 1560, 1764, 1846, 1948, 2087
Nematostella vectensis 19532 605, 750, 963, 1128, 1388, 1560, 1755
Ochotona princeps 1261 117, 216, 314, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Ornithorhynchus anatinus 14328 1388, 1560, 1764, 1846, 1953, 1969
Ornithorhynchus anatinus 15894 216, 314, 412, 605
Oryctolagus cuniculus 21323 216, 314, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Oryzias latipes 21673 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1856, 1882, 1937, 2087, 2201
Otolemur garnettii 2666 117, 216, 314, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1349, 1388, 1560, 1764, 1846, 1948, 2087
Pan troglodytes 37055 117, 216, 314, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Pongo abelii 27761 117, 216, 314, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Procavia capensis 16587 117, 216, 314, 412, 605, 750, 798, 819, 831, 843, 846, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Pteropus vampyrus 13310 117, 216, 314, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1467, 1560, 1764, 1846, 1948, 2087
Rattus norvegicus 14768 117, 216, 314, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Rhesus macaque 15650 117, 216, 314, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Sorex araneus 14769 117, 216, 314, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Spermophilus tridecemlineatus 15987 117, 216, 302, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1264, 1388, 1560, 1590, 1601, 1764, 1846, 1948, 2087
Sus scrofa 2512 216, 320, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2042, 2087
Taeniopygia guttata 18881 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Tarsius syrichta 82 216, 314, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1824, 1846, 1948, 2087
Tetraodon nigroviridis 3766 412, 605, 750, 864, 963, 1047, 1128, 1254, 1385, 1560, 1764, 1846, 1948, 2087
Tupaia belangeri 9820 231, 312, 412, 583, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Vicugna pacos 7402 117, 216, 314, 412, 605, 750, 864, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087
Xenopus tropicalis 2950 412, 605, 750, 869, 953, 963, 1047, 1128, 1254, 1388, 1560, 1764, 1846, 1948, 2087, 2195

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 1480 ENSACAT00000001393 100558261 ENSACAG00000001185 SLC28A3 anoCar1
Bos taurus 25488 ENSBTAT00000024328 508028 ENSBTAG00000018280 SLC28A3 bosTau4
Caenorhabditis elegans 24820 F27E11.2a.2 178769 WBGene00017868 slc-28.2 ce6
Callithrix jacchus 43513 ENSCJAT00000007475 100405916 ENSCJAG00000003868 SLC28A3 calJac3
Canis familiaris 612 ENSCAFT00000002139 607728 ENSCAFG00000001389 SLC28A3 canFam2
Cavia porcellus 2593 ENSCPOT00000013315 100727700 ENSCPOG00000013188 SLC28A3 cavPor3
Choloepus hoffmanni 2733 ENSCHOT00000002733 ENSCHOG00000002722 SLC28A3 choHof1
Dasypus novemcinctus 94 ENSDNOT00000004899 101413688 ENSDNOG00000004898 SLC28A3 dasNov2
Dipodomys ordii 1002 ENSDORT00000008008 ENSDORG00000008007 Slc28a3 dipOrd1
Equus caballus 15106 ENSECAT00000022254 100054999 ENSECAG00000020734 equCab2
Equus caballus 15108 ENSECAT00000011551 100054543 ENSECAG00000010890 LOC100054543 equCab2
Erinaceus europaeus 9218 ENSEEUT00000008340 ENSEEUG00000008317 SLC28A3 eriEur1
Felis catus 45683 ENSFCAT00000010705 101082270 ENSFCAG00000010701 SLC28A3 felCat3
Fugu rubripes 5460 ENSTRUT00000025981 101078042 ENSTRUG00000010280 SLC28A3 fr2
Gallus gallus 22892 ENSGALT00000020565 427459 ENSGALG00000012593 SLC28A3 galGal3
Gorilla gorilla 5611 ENSGGOT00000026256 ENSGGOG00000001212 SLC28A3 gorGor3
Homo sapiens 93736 ENST00000376238 64078 ENSG00000197506 SLC28A3 hg19,GRCh37
Loxodonta africana 22574 ENSLAFT00000014874 100654396 ENSLAFG00000014871 SLC28A3 loxAfr3
Macropus eugenii 618 ENSMEUT00000000626 ENSMEUG00000000617 SLC28A3 Meug_1.0
Microcebus murinus 10641 ENSMICT00000009948 ENSMICG00000009916 SLC28A3 micMur1
Monodelphis domestica 26362 ENSMODT00000010561 100029425 ENSMODG00000008334 SLC28A3 monDom5
Mus musculus 11155 ENSMUST00000022036 114304 ENSMUSG00000021553 Slc28a3 mm9
Myotis lucifugus 6147 ENSMLUT00000006064 102434322 ENSMLUG00000006059 SLC28A3 myoLuc1
Nematostella vectensis 19532 e_gw.356.22.1 Nemve1
Ochotona princeps 1261 ENSOPRT00000003638 101518611 ENSOPRG00000003632 SLC28A3 OchPri2.0
Ornithorhynchus anatinus 15894 ENSOANT00000032049 ENSOANG00000022150 ornAna1
Ornithorhynchus anatinus 14328 ENSOANT00000024735 ENSOANG00000015692 ornAna1
Oryctolagus cuniculus 21323 ENSOCUT00000005718 100355491 ENSOCUG00000005716 SLC28A3 oryCun2.0
Oryzias latipes 21673 ENSORLT00000006553 ENSORLG00000005199 SLC28A3 oryLat2
Otolemur garnettii 2666 ENSOGAT00000002569 100950872 ENSOGAG00000002566 SLC28A3 otoGar1
Pan troglodytes 37055 ENSPTRT00000046786 472969 ENSPTRG00000023914 SLC28A3 panTro2
Pongo abelii 27761 ENSPPYT00000022546 100440845 ENSPPYG00000019329 SLC28A3 ponAbe2
Procavia capensis 16587 ENSPCAT00000001687 ENSPCAG00000001655 SLC28A3 proCap1
Pteropus vampyrus 13310 ENSPVAT00000007180 ENSPVAG00000007180 SLC28A3 pteVam1
Rattus norvegicus 14768 ENSRNOT00000025745 140944 ENSRNOG00000018853 Slc28a3 rn4
Rhesus macaque 15650 ENSMMUT00000012142 709560 ENSMMUG00000008685 SLC28A3 rheMac2
Sorex araneus 14769 ENSSART00000014526 ENSSARG00000014522 SLC28A3 sorAra1
Spermophilus tridecemlineatus 15987 ENSSTOT00000015988 ENSSTOG00000015987 SLC28A3 speTri1
Sus scrofa 2512 ENSSSCT00000011997 100621750 ENSSSCG00000010960 SLC28A3 susScr2
Taeniopygia guttata 18881 ENSTGUT00000003257 ENSTGUG00000003104 SLC28A3 taeGut1
Tarsius syrichta 82 ENSTSYT00000008086 ENSTSYG00000008037 SLC28A3 tarSyr1
Tetraodon nigroviridis 3766 ENSTNIT00000008913 ENSTNIG00000006003 SLC28A3 tetNig2
Tupaia belangeri 9820 ENSTBET00000009821 ENSTBEG00000009820 SLC28A3 tupBel1
Vicugna pacos 7402 ENSVPAT00000001869 ENSVPAG00000001868 SLC28A3 vicPac1
Xenopus tropicalis 2950 ENSXETT00000057490 100492606 ENSXETG00000011724 slc28a3 xenTro2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 1129 ENSACAP00000001360 100558261 ENSACAG00000001185 SLC28A3 anoCar1
Bos taurus 575 ENSBTAP00000024328 508028 ENSBTAG00000018280 SLC28A3 bosTau4
Caenorhabditis elegans 20327 F27E11.2a.2 178769 WBGene00017868 slc-28.2 ce6
Callithrix jacchus 34835 ENSCJAP00000007076 100405916 ENSCJAG00000003868 SLC28A3 calJac3
Canis familiaris 13615 ENSCAFP00000001980 607728 ENSCAFG00000001389 SLC28A3 canFam2
Cavia porcellus 2032 ENSCPOP00000011872 100727700 ENSCPOG00000013188 SLC28A3 cavPor3
Choloepus hoffmanni 2412 ENSCHOP00000002411 ENSCHOG00000002722 SLC28A3 choHof1
Dasypus novemcinctus 84 ENSDNOP00000003788 101413688 ENSDNOG00000004898 SLC28A3 dasNov2
Dipodomys ordii 931 ENSDORP00000007513 ENSDORG00000008007 Slc28a3 dipOrd1
Equus caballus 8856 ENSECAP00000009038 100054543 ENSECAG00000010890 LOC100054543 equCab2
Equus caballus 18253 ENSECAP00000018376 100054999 ENSECAG00000020734 equCab2
Erinaceus europaeus 7582 ENSEEUP00000007598 ENSEEUG00000008317 SLC28A3 eriEur1
Felis catus 11764 ENSFCAP00000009939 101082270 ENSFCAG00000010701 SLC28A3 felCat3
Fugu rubripes 25876 ENSTRUP00000025876 101078042 ENSTRUG00000010280 SLC28A3 fr2
Gallus gallus 12835 ENSGALP00000020536 427459 ENSGALG00000012593 SLC28A3 galGal3
Gorilla gorilla 5256 ENSGGOP00000023479 ENSGGOG00000001212 SLC28A3 gorGor3
Homo sapiens 67131 ENSP00000365413 64078 ENSG00000197506 SLC28A3 hg19,GRCh37
Loxodonta africana 19930 ENSLAFP00000012459 100654396 ENSLAFG00000014871 SLC28A3 loxAfr3
Macropus eugenii 570 ENSMEUP00000000575 ENSMEUG00000000617 SLC28A3 Meug_1.0
Microcebus murinus 9029 ENSMICP00000009061 ENSMICG00000009916 SLC28A3 micMur1
Monodelphis domestica 15301 ENSMODP00000010361 100029425 ENSMODG00000008334 SLC28A3 monDom5
Mus musculus 12059 ENSMUSP00000022036 114304 ENSMUSG00000021553 Slc28a3 mm9
Myotis lucifugus 5535 ENSMLUP00000005539 102434322 ENSMLUG00000006059 SLC28A3 myoLuc1
Nematostella vectensis 11676 e_gw.356.22.1 Nemve1
Ochotona princeps 1096 ENSOPRP00000003345 101518611 ENSOPRG00000003632 SLC28A3 OchPri2.0
Ornithorhynchus anatinus 5203 ENSOANP00000028251 ENSOANG00000022150 ornAna1
Ornithorhynchus anatinus 26687 ENSOANP00000024731 ENSOANG00000015692 ornAna1
Oryctolagus cuniculus 7760 ENSOCUP00000004953 100355491 ENSOCUG00000005716 SLC28A3 oryCun2.0
Oryzias latipes 6103 ENSORLP00000006552 ENSORLG00000005199 SLC28A3 oryLat2
Otolemur garnettii 2293 ENSOGAP00000002294 100950872 ENSOGAG00000002566 SLC28A3 otoGar1
Pan troglodytes 14404 ENSPTRP00000046380 472969 ENSPTRG00000023914 SLC28A3 panTro2
Pongo abelii 891 ENSPPYP00000021660 100440845 ENSPPYG00000019329 SLC28A3 ponAbe2
Procavia capensis 15521 ENSPCAP00000001587 ENSPCAG00000001655 SLC28A3 proCap1
Pteropus vampyrus 12545 ENSPVAP00000006777 ENSPVAG00000007180 SLC28A3 pteVam1
Rattus norvegicus 448 ENSRNOP00000025745 140944 ENSRNOG00000018853 Slc28a3 rn4
Rhesus macaque 8524 ENSMMUP00000011390 709560 ENSMMUG00000008685 SLC28A3 rheMac2
Sorex araneus 13136 ENSSARP00000013139 ENSSARG00000014522 SLC28A3 sorAra1
Spermophilus tridecemlineatus 14308 ENSSTOP00000014307 ENSSTOG00000015987 SLC28A3 speTri1
Sus scrofa 11653 ENSSSCP00000011689 100621750 ENSSSCG00000010960 SLC28A3 susScr2
Taeniopygia guttata 5661 ENSTGUP00000003225 ENSTGUG00000003104 SLC28A3 taeGut1
Tarsius syrichta 81 ENSTSYP00000007418 ENSTSYG00000008037 SLC28A3 tarSyr1
Tetraodon nigroviridis 8944 ENSTNIP00000008743 ENSTNIG00000006003 SLC28A3 tetNig2
Tupaia belangeri 8505 ENSTBEP00000008506 ENSTBEG00000009820 SLC28A3 tupBel1
Vicugna pacos 6874 ENSVPAP00000001724 ENSVPAG00000001868 SLC28A3 vicPac1
Xenopus tropicalis 3492 ENSXETP00000057490 100492606 ENSXETG00000011724 slc28a3 xenTro2

multiple sequence alignment in CLUSTALW format


Caenorhabditis_elegans|24820        ------------------------------------------------------------
Macropus_eugenii|618                ------------------------------------------------------------
Nematostella_vectensis|19532        ------------------------------------------------------------
Tarsius_syrichta|82                 ------------------------------------------------------------
Choloepus_hoffmanni|2733            ---------------------------------------------------------GTG
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  ---------------------------------------------------------GTG
Xenopus_tropicalis|2950             ------------------------------------------------------------
Anolis_carolinensis|1480            ------------------------------------------------------------
Gallus_gallus|22892                 ------------------------------------------------------------
Taeniopygia_guttata|18881           ------------------------------------------------------------
Monodelphis_domestica|26362         ------------------------------------------------------------
Myotis_lucifugus|6147               ---------------------------------------------------------ATG
Erinaceus_europaeus|9218            ---------------------------------------------------------GTG
Procavia_capensis|16587             ------------------------------------------------------------
Ornithorhynchus_anatinus|14328      ------------------------------------------------------------
Spermophilus_tridecemlineatus|15987 ---------------------------------------------------------ATG
Dipodomys_ordii|1002                ------------------------------------------------------------
Tupaia_belangeri|9820               ------------------------------------------------------------
Pteropus_vampyrus|13310             ---------------------------------------------------------ATG
Sus_scrofa|2512                     ------------------------------------------------------------
Bos_taurus|25488                    ---------------------------------------ATGAGCAGCAAAATCTCTGTG
Sorex_araneus|14769                 ---------------------------------------------------------ATG
Equus_caballus|15106                ------------------------------------------------------------
Equus_caballus|15108                ------------------------------------------------------------
Mus_musculus|11155                  ATGTCCAGGGCAGAC------CCGGGAAAGAATTCCGAGCCCAGTGAGAGCAAGATGAGC
Rattus_norvegicus|14768             ATGTCCAGGTCAGACCCAGACCCGGGAAAGAATTCGGAGCCCAGTAAGAGCAAGATGAGC
Loxodonta_africana|22574            ------------------------------------------------------------
Canis_familiaris|612                ------------------------------------------------------------
Felis_catus|45683                   ---------------------------------------------------------GTG
Cavia_porcellus|2593                ------------------------------------------------------------
Ochotona_princeps|1261              ---------------------------------------------------------ATG
Oryctolagus_cuniculus|21323         ------------------------------------------------------------
Microcebus_murinus|10641            ---------------------------------------------------------ATG
Callithrix_jacchus|43513            ---------------------------------------------------------ATG
Gorilla_gorilla|5611                ---------------------------------------------------------ATG
Rhesus_macaque|15650                ---------------------------------------------------------ATG
Pongo_abelii|27761                  ---------------------------------------------------------ATG
Homo_sapiens|93736                  ---------------------------------------------------------ATG
Pan_troglodytes|37055               ---------------------------------------------------------ATG
Otolemur_garnettii|2666             ---------------------------------------------------------ATG
Dasypus_novemcinctus|94             ---------------------------------------------------------AAG
Oryzias_latipes|21673               ------------------------------------------------------------
Tetraodon_nigroviridis|3766         ------------------------------------------------------------
Fugu_rubripes|5460                  ------------------------------------------------------------
                                                                                                

Caenorhabditis_elegans|24820        ------------------------------------------------------------
Macropus_eugenii|618                ---------------------------------------------------------ATT
Nematostella_vectensis|19532        ------------------------------------------------------------
Tarsius_syrichta|82                 ------------------------------------------------------------
Choloepus_hoffmanni|2733            GAGCTGACAAGTGTCACAGCATCCGGAGCTGAGGGCCACAGCAACAGTGTTTTCCAGGAT
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  GAGCTGCTGAGGATGACAGCCCTCAGAACCCAGGGCCACAGCAACACCGGTTTCCAGGAT
Xenopus_tropicalis|2950             ------------------------------------------------------------
Anolis_carolinensis|1480            ------------------------------------------------------------
Gallus_gallus|22892                 ------------------------------------------------------------
Taeniopygia_guttata|18881           ------------------------------------------------------------
Monodelphis_domestica|26362         ------------------------------------------------------------
Myotis_lucifugus|6147               GAGCTGAGGACTGTGACCGCCTCTGAAGCCGACAGCTACCAAAACACTGCCTTCCAGAAT
Erinaceus_europaeus|9218            GAGCTGGGGGAGCTGCCAGCCCCCACAGCCCAGGGCTATAGCAACACTGGCTTCCAGNNN
Procavia_capensis|16587             ---------------------------------GGCTGCAACAACGCCGCTTTCCAGGAT
Ornithorhynchus_anatinus|14328      ------------------------------------------------------------
Spermophilus_tridecemlineatus|15987 GAGCTGACAAGTACAGCAGCCCCCAAAACCGAGGGCTTCAGCAACACTGGCTTCCGGAAT
Dipodomys_ordii|1002                ------------------------------------------------------------
Tupaia_belangeri|9820               ------------------------------------------------------------
Pteropus_vampyrus|13310             GAGCTGAAGAGTGTGACTGCCACCGGAGCTGAGGGCTACAGAAACACTGGCTTCCAGAGT
Sus_scrofa|2512                     ------------------------------------------------------------
Bos_taurus|25488                    GAGCTGCAGAGGGTGGCGGCCCTCCCAGCCCAGGGTTGCAGCAACACTGGCTTTCAGAAT
Sorex_araneus|14769                 GAGCTGGGCAAGGTGCCAGCCCCCAGAGCAAAGGGCTACAGCAACACTGGTTTCCAGACT
Equus_caballus|15106                ------------------------------------------------------------
Equus_caballus|15108                ------------------------------------------------------------
Mus_musculus|11155                  CTGGAGCTGAGGCCAACAGCCCCCAGCGACCTGGGCCGCAGCAATGAAGCCTTTCAGGAT
Rattus_norvegicus|14768             CTGGAGCTGAGGCCAACAGCCCCCAGCGACCAGGGCCGCCTCAACGAAGCCTTCCAGGAT
Loxodonta_africana|22574            ------------------------------------------------------------
Canis_familiaris|612                ------------ATGACAACCCCCAGAGCCGAGGGCTGCAGCAACACTGGCTTCCAGAAT
Felis_catus|45683                   GAGCTGAAGAGTAGGACGGCCGCCAGGGCGGAGGGCTACAGCAACACTGGCTTCCAGAAT
Cavia_porcellus|2593                ---------------------------------------------------TTTTTTCAG
Ochotona_princeps|1261              GAGCTGAAGGACAGAGCAGCCCGTGGAGCCGAGGGCTTCAACAACACCGCCTTCCAGATT
Oryctolagus_cuniculus|21323         ---------------------------------------------------------ATT
Microcebus_murinus|10641            GAGCTGAACAGCATGGCAGCCCCCGGAGCCCAGGGCTGCAGCAACACTGGCTTCCAGGAA
Callithrix_jacchus|43513            GAGCTGAGGAGCACGGCAGCCCCGAGAGCTAAGGGCTACAGCAACACAGCCTTCCAGAAT
Gorilla_gorilla|5611                GAGCTGAGGAGTACAGCAGCCCCCAGAGCTGAGGGCTACAGCAACGTGGGCTTCCAGAAT
Rhesus_macaque|15650                GAGCTGAGGAGTACGGCAGCCCCCAGAGCTGAAGGCTACAGCAACACGGGTTTCCAGAAT
Pongo_abelii|27761                  GAGCTGAGGAGTACAGCAGCCCCCAGAGCTGAGGGCTACAGCAACACAGGCTTCCAGAAT
Homo_sapiens|93736                  GAGCTGAGGAGTACAGCAGCCCCCAGAGCTGAGGGCTACAGCAACGTGGGCTTCCAGAAT
Pan_troglodytes|37055               GAGCTGAGGAGTACAGCAGCCCCCAGAGCTGAGGGCTACAGCAACGTGGGCTTCCAGAAT
Otolemur_garnettii|2666             GAGCTGAACAGTATGGCACCCCCCACAGCTGAGGGCCACCGCAACGCTGGCTTCCAGNNN
Dasypus_novemcinctus|94             GAGCTGAGGAGTGCTGTAGCATCTGTAACTGAGGGCCATAGCAATGCTGCTTTCCAGNNN
Oryzias_latipes|21673               ------------------------------------------------------------
Tetraodon_nigroviridis|3766         ------------------------------------------------------------
Fugu_rubripes|5460                  ------------------------------------------------------------
                                                                                                

Caenorhabditis_elegans|24820        ------------------------------------------------------------
Macropus_eugenii|618                AAGGAAGAAGATATCAAGAACCAGAATGGGTCAGGA---AGATATTCACTGAGAAATCGT
Nematostella_vectensis|19532        ------------------------------------------------------------
Tarsius_syrichta|82                 ---------AAGGAAGAAAATCAGAACAAGGCAGGAAATAACAACGTGATGAGGAGCAGA
Choloepus_hoffmanni|2733            GATGAAGACTTTCTTGAAAACAAGAACACCTCAGTAAACAACAGCTCACTAAGGAGTAGA
Ornithorhynchus_anatinus|15894      ---------------------------------AGCCCATCAAACAGAGTAAGAAACAGG
Vicugna_pacos|7402                  GAAGAAGGCTTTTCTGAAAACCAGAACACATCAGGAAATGACAACTCAGCAAGCAGCAGA
Xenopus_tropicalis|2950             ------------------------------------------------------------
Anolis_carolinensis|1480            ------------------------------------------------------------
Gallus_gallus|22892                 ------------------------------------------------------------
Taeniopygia_guttata|18881           ------------------------------------------------------------
Monodelphis_domestica|26362         ------------------------------------------------------------
Myotis_lucifugus|6147               GAAGAAGACATTAATGAAAACCAGAACACATCAGGA---AACAACTCCATAAGGAATAGA
Erinaceus_europaeus|9218            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNN
Procavia_capensis|16587             GAAAATGACTTTCTTAAAAACGGAAACACAACAGGA---AACGATTTGCCAAGGAGTAGA
Ornithorhynchus_anatinus|14328      ------------------------------------------------------------
Spermophilus_tridecemlineatus|15987 GAAGAA---CTTCTGGAAAACCAGAACATATCCGGA---AACAGCTCAATTAGGAGTCGA
Dipodomys_ordii|1002                GATGAAAGCATTCTTGAAAACCAGAATGCATCAGGA---AACAACTCGATAAGGAGTAGA
Tupaia_belangeri|9820               ------------------------------------------------------------
Pteropus_vampyrus|13310             GAAGAAGACCTCCATGAATACCAGAACACATCAGGAAACAACAACTCGCTAAGAAGTAGA
Sus_scrofa|2512                     ------------GTTGAAAGCCAGAACACATCAGGAAACGACAACTCATTAAGGAGCAGA
Bos_taurus|25488                    GATGAAGATGGCTTTGAAAACCAGAACCCATCAGGAAATGACCACTCACTAAGGAATAGA
Sorex_araneus|14769                 GAAGAAGACGTTCATGAAAACCAGAATACATCAAGA---TACAGCTCGCTAAGAGGCAGA
Equus_caballus|15106                ------------------------------------------------------------
Equus_caballus|15108                ---------------GAAAACCAGAACACATCAGGAAACGACAGCTCACTGAGGAGCAGA
Mus_musculus|11155                  GAAGAC------CTTGAACGGCAGAACACTCCAGGA---AACAGCACAGTCAGGAACAGA
Rattus_norvegicus|14768             GAAGAC------CTGGAAGAGCAGAACGCTCCAGGA---AACAGCACAGTCAGGAGCAGA
Loxodonta_africana|22574            GAAGATGGCTTTCTTAAAAACGGAAACACATCAGGA---AAGGACTCGCTAAGGAGTAGA
Canis_familiaris|612                GACGAAGACCTTGATGAAAACCAGAACACATCAGGAAACAACAATTCGCTAAGGTGTAGA
Felis_catus|45683                   GAAGATGACTTCGATGAAAAACAGAACACATCAGGAAACAACAACTCACTAAGGTGTAGA
Cavia_porcellus|2593                GATGAGAAT---CTTGAAAACCAGAATATGTCAGGA---AACAACTTGGTAAGGAGTAGA
Ochotona_princeps|1261              GAAGAAAATTTTCTGGAAAACCAGAACGTATCAGAAAATAACAACTCCATAAGAAGCGGT
Oryctolagus_cuniculus|21323         GAAGACAATTTCCTGGAAAACCAGAACACGTCAGAAAACAACAGCTCCGTGAGGAATCGA
Microcebus_murinus|10641            GAAGAAAACTGTCTTAAAAACCAGAACACGTCAGAAAACAACAACTCAATTCGGAACAGA
Callithrix_jacchus|43513            GAAGAAAATTTTCTTGAGAATGAGAATACATCAGGAAACAACAACTCGATAAGAAGCGGA
Gorilla_gorilla|5611                GAAGAAAACTTTCTTGAGAACGAGAACACATCAGGA---AACAACTCAATAAGAAGCAGA
Rhesus_macaque|15650                GAAGAAAACTTTCTTGAGAACGAGAACACATCAGGAAACAAGAACTCAGTAAGGAGCAGA
Pongo_abelii|27761                  GAAGAAAACTTTCTTGAGAACGAGAACACATCAGGAAACAACAACTCAATAACGAGCAGA
Homo_sapiens|93736                  GAAGAAAACTTTCTTGAGAACGAGAACACATCAGGA---AACAACTCAATAAGAAGCAGA
Pan_troglodytes|37055               GAAGAAAACTTTCTTGAGAACGAGAACACATCAGGA---AACAACTCAATAAGAAGCAGA
Otolemur_garnettii|2666             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNN
Dasypus_novemcinctus|94             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNN
Oryzias_latipes|21673               ------------------------------------------------------------
Tetraodon_nigroviridis|3766         ------------------------------------------------------------
Fugu_rubripes|5460                  ------------------------------------------------------------
                                                                                                

Caenorhabditis_elegans|24820        ---------------------ATGAAAATTAGTGATGTGGAAGAAAATAGCACTCCCCAA
Macropus_eugenii|618                AATGAATGTAATGGGGAAAGGATAAACTCCCAACAGGAAGAAGAA---CATGTCACTATT
Nematostella_vectensis|19532        ------------------------------------------------------------
Tarsius_syrichta|82                 GTTGTGCAAAGCGGAGAGCATGTAAACACCGGACAGNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|2733            GTTGTGCAAAACAGAGAGCAAGAAAACACCAAGCAGGGAGAAGAATGTACCATTGCCATT
Ornithorhynchus_anatinus|15894      AACTTGTTAAATGGAGAGGACGGAAATGTGACCCAGGAGACAGAG---CACATCACCATT
Vicugna_pacos|7402                  GATGTGCAAAACAGAGAGCCTGAGAACAGCGAGCAGNNNNNNNNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|2950             ------------------------------------------------------------
Anolis_carolinensis|1480            ------------------------------------------------------------
Gallus_gallus|22892                 ------------------------------------------------------------
Taeniopygia_guttata|18881           ------------------------------------------------------------
Monodelphis_domestica|26362         ------------------------------------------------------------
Myotis_lucifugus|6147               GTTGTGCAAAACAGCAAACATGTAAATGCCAAACAGGGTGAAGAG---CAAGTCCCCATT
Erinaceus_europaeus|9218            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTCGAAGAA---CAAGTTGTCATT
Procavia_capensis|16587             GCTGTGCACAAGGGAGAACGTGTCGACAGCAAACAGAGAGAAGAA---TGTGTCAGTGTT
Ornithorhynchus_anatinus|14328      ------------------------------------------------------------
Spermophilus_tridecemlineatus|15987 GTTGTACAAAGCCGGGAACAAGGAAACACCAAACAGGGTGAAGAG---TTGGTCAACATT
Dipodomys_ordii|1002                GCTGTGCAAAGCAGGGAACAAGGAAACACCGAACAGGGGGAAGAAGCGCAGGTTACCATA
Tupaia_belangeri|9820               ------------------------------------------GAA---AAAGTCTCTATT
Pteropus_vampyrus|13310             GATGCGCAAAACAGAGAACACGTAAATGCCAAACAGAGTGAAGAG---CAGGTCACCATT
Sus_scrofa|2512                     GTTGTGCAAAACAGAGAGGATGAAAATGGAAAACAGGATGAAGAG---CAAGTCACCATT
Bos_taurus|25488                    GTTGTGCAAAACAGAGAGCATGAAAATGGCAAACAGGTAGAAGAG---CACATCACCATC
Sorex_araneus|14769                 GTTGTGCAAAACAAAGCGCCGGGAAATAGCAATCAGGATGAAGAA---CAGGTAACAATT
Equus_caballus|15106                ------------------------------------------------------------
Equus_caballus|15108                GCTGTGCAGAGCAGAGGGCACGGAAAGGCCAAACAGGATGAAGAG---CAGGTCACCATT
Mus_musculus|11155                  GTTGTACAAAGCGGGGAACAAGGACACGCCAAACAGGACGACAGG---CAGATCACGATT
Rattus_norvegicus|14768             GTTGTACAGAGTGGGGAGCAAGGACGGGCCAAACAGGACGACAGG---CAGATCACGATT
Loxodonta_africana|22574            GCTGTGCAAAAGGGAGAGCCTGTCAACACCAAACAGGGGGAAGAG---TGTGTCAGCATT
Canis_familiaris|612                GTTTCAAAAGGCAGAGAACACGAAAACGCCAAGCAGGATGAAGAG---CAGATCACCATT
Felis_catus|45683                   GCTGTGCAA---------------AACACCCAGCAGGACGAAGAG---CAGGTCACCATT
Cavia_porcellus|2593                GTTGTGCAAAACGGAGAGCAAGGAACCCCTAAACAGGGGGAAGAG---CACATCACCATT
Ochotona_princeps|1261              GCTGTACAAAGTGGGGAACAAATGAACAGCAAACAGGACGAAGAA---CAAGTCACGATC
Oryctolagus_cuniculus|21323         GCTGTACCAAGTGGGGAGCAAGGGAACACCAAGCAGGGTGAAGAA---CAAGTCATTATT
Microcebus_murinus|10641            GCCGTGCAAAGCGGGGAGCACGGAAACACCAAACAGGGTGAAGAG---CAGGTTACCATT
Callithrix_jacchus|43513            GCTGCGCAAAGAGGCGAGCACACAAACACCAAACAGGGCGAGGAA---CAGGTCACAGTT
Gorilla_gorilla|5611                GCTGTGCAAAGCAGGGAGCACACAAACACCAAACAGGATGAAGAA---CAGGTCACAGTT
Rhesus_macaque|15650                GCTGTGCAAAGCAGGGAGCACACAGACACCAAACAGGATGAAGAA---CAGGGCACAGTT
Pongo_abelii|27761                  GCTGTGCAAAGCAGGGAGCACGCAAACACCAAACAGGATGAAGAA---CAGGTCACAGTT
Homo_sapiens|93736                  GCTGTGCAAAGCAGGGAGCACACAAACACCAAACAGGATGAAGAA---CAGGTCACAGTT
Pan_troglodytes|37055               GCTGTGCAAAGCAGGGAGCACACAAACACCAAACAGGATGAAGAA---CAGATCACAGTT
Otolemur_garnettii|2666             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTGAAGAC---CATGTCACCATC
Dasypus_novemcinctus|94             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAGAAGAG---TGTATCACCATT
Oryzias_latipes|21673               ------------------------------------------------------------
Tetraodon_nigroviridis|3766         ------------------------------------------------------------
Fugu_rubripes|5460                  ------------------------------------------------CAGATGCAAATG
                                                                                                

Caenorhabditis_elegans|24820        AAAGAAAATGTGTTGCAAAGGAGTTGTTCTTTAACCTCCAAA------------------
Macropus_eugenii|618                GAGCAAGATCTCCCCAAACGGAAAGAGAGCATAGAAGAAAGT------------GAATCG
Nematostella_vectensis|19532        ------------------------------------------------------------
Tarsius_syrichta|82                 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------NNNNNN
Choloepus_hoffmanni|2733            GAGCAGGAACCTCCAAAAAATAGAGAAGACACGGAGGACGAC------------CAAGAC
Ornithorhynchus_anatinus|15894      GAAGTTGATACACTTGACAACAAACTCGACGAAGAGACTGAT---------GAGACTGAG
Vicugna_pacos|7402                  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------------NNNNNN
Xenopus_tropicalis|2950             ------------------------------------------------------------
Anolis_carolinensis|1480            ------------------------------------------------------------
Gallus_gallus|22892                 ------------------------------------------------------------
Taeniopygia_guttata|18881           ------------------------------------------------------------
Monodelphis_domestica|26362         ------------------------------------------------------------
Myotis_lucifugus|6147               GAGCAGGATTCTCTAAGAAACGAAGAAGATGAGGAGGATGAT------------CAAGTG
Erinaceus_europaeus|9218            GAGCAGGATTCTCCGGAATACAAAGAAGACGTGGAAAATGAN---------------NNN
Procavia_capensis|16587             GAGCAGGATTTTCAAGAAAACACAGGAGACATGGAAGACGAT------------GAAGAC
Ornithorhynchus_anatinus|14328      ------------------------------------------------------------
Spermophilus_tridecemlineatus|15987 GAGCAGGATTCTCTAAGGAAAGAAGAAGAAGAAGACATGGAG------------GATGAC
Dipodomys_ordii|1002                GAACAGGATGCCCTAAGAAATAAAGAAGACACAGAGGAGGAC------------------
Tupaia_belangeri|9820               GAGCAGGGCTCGCCAGGAATCAAAAAAGACATGAATGATGAT------------CAAGAG
Pteropus_vampyrus|13310             GAGCAGGATTCTCCAAGAAACAAGGACAATGAGGACGGTGAT------------CAAGAG
Sus_scrofa|2512                     GAGGAGGATTCTCCAAGGAAGGAGGAAGAGGAGGAAGAT---------------CAAGAG
Bos_taurus|25488                    GGGCAGGATTCTCTAAGAAAGGATGAAGAAGAGGAGGATGAT------------CAAGAA
Sorex_araneus|14769                 GAA---------------------GACAACTTGGAGGATGAT------------CAAGAG
Equus_caballus|15106                ------------------------------------------------------------
Equus_caballus|15108                GAGCTGGATTCTCCAAGAAACAAAGAAGATGCAAAGGATGAC------------CAAGAG
Mus_musculus|11155                  GAACAGGAGCCTCTAGGAAACAAAGAAGACCCAGAGGATGAT---------AGCGAAGAT
Rattus_norvegicus|14768             GAGCAGGAGCCTCTAGGACCCAAAGAAGGCACAGAGGAAGAG---------AGCGAAGAT
Loxodonta_africana|22574            GAGCAGGATTCTCCTAAAAACACAGAAGACATGGAAGACAGT------------GAAGAC
Canis_familiaris|612                GAGCAGGATTCTTTAAGAAACAAAGAAGATATGGAGGATGAT------------CCAGAG
Felis_catus|45683                   GAGCAGGATTCTTTAAGAAACAAAGAAGATGTGGAGGATGAT------------CCAGAG
Cavia_porcellus|2593                GAGCAGGATTCCCTAGGAAACAAAGATGAAGATGAGGATGAC------------CAAGAC
Ochotona_princeps|1261              CAGCAGGATTCCCCAAGAAACAAAGACAACGACAGTGATGTG---------GATGAAGAG
Oryctolagus_cuniculus|21323         GAACAGGATCCTGCAAGAAACAAAGATGACGATGACGATGACAATGAGGTGGATGAAGAA
Microcebus_murinus|10641            GAGCAGGATTCTCCAAGAAACAAAGATGACGTGGAGGATGAC------------CAAGAG
Callithrix_jacchus|43513            GAACCGGATTCTCCAAGAAACAAAGAAGACATGGAGGATGAT---------GACGAGGAG
Gorilla_gorilla|5611                GAGCAGGATTCTCCAAGAAACAAAGAAGACATGGAGGATGAT---------GATGAGGAG
Rhesus_macaque|15650                GAGCAGGATTCTCCAAGAAACAAAGAAGACATGGAGGATGAT---------GAAGAGGAG
Pongo_abelii|27761                  GACCAGGATTCTCCAAGAAACAAAGAAGGCACGGAGGATGAT---------GAGGAGGAG
Homo_sapiens|93736                  GAGCAGGATTCTCCAAGAAACAGAGAACACATGGAGGATGAT---------GATGAGGAG
Pan_troglodytes|37055               GAGCAGGATTCTCCAAGAAACAGAGAACACATGGAGGATGAT---------GATGAGGAG
Otolemur_garnettii|2666             GAGCGGGATTCTCCAAGAAACAAAGATGATGTGGAGGATGAC------------CAAGAG
Dasypus_novemcinctus|94             GAGCAGGATCCTCCAAAAGACACAGACAACATAGAGGACGGC------------CAAGAC
Oryzias_latipes|21673               ------------------------------------------------------------
Tetraodon_nigroviridis|3766         ------------------------------------------------------------
Fugu_rubripes|5460                  AATAATGACGGTGTTTGTGGGAAAGAAACGGGTGAAGAAAAT------------AGCAAG
                                                                                                

Caenorhabditis_elegans|24820        ---------------------AGTCTGCAAAACAATTTGAACATAATCGAAAAGTTCGGT
Macropus_eugenii|618                ACACACCAGAAAGGN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Nematostella_vectensis|19532        ------------------------------------------------------------
Tarsius_syrichta|82                 NNNNNNNNNNNNNNG------TATTTGGAAAGGAAGTATGATACAGTTTGTGATTTTTAT
Choloepus_hoffmanni|2733            ACACATCAAAAGGGA------TACCTGGAAAAGAAGTACGATGAGGTTTGTGATTTTTTT
Ornithorhynchus_anatinus|15894      ACTGTCAATAAAGGG------TTCCTGGAGACCAAGTACGATGAAGGTTGTGCGTTTTAT
Vicugna_pacos|7402                  NNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|2950             ------------------------ATCGAAAGGAAATATGATAATGTGTGCTCTTTCTGT
Anolis_carolinensis|1480            ---------------------TACCTTGAAAAGAAATATGATACGGTCCTTCACTTTTTC
Gallus_gallus|22892                 ---------------------CTTTTAGAAAAGAAATATCATAAAGCCTGCAATTTTTGC
Taeniopygia_guttata|18881           ------------------------------------------------------------
Monodelphis_domestica|26362         ---------------------TACCTGGAAAAGAAATATGATGCGACTTGTGACTTCTTA
Myotis_lucifugus|6147               ATGCATCCAAATGGN------NNNNNNNNNNNNNNNNNNNNNNCAGTTTGTGATTTTCGT
Erinaceus_europaeus|9218            NNNNNNNNNNNNNNNNNNNNGTACCTGGCAAGAAAATATGGTGCTGTTTGCGATTTTTGT
Procavia_capensis|16587             ATGCAGCCGAAAGGG------TATCTGGAAAAGAAATATGATGCAGTCTGTGGTATTTAT
Ornithorhynchus_anatinus|14328      ------------------------------------------------------------
Spermophilus_tridecemlineatus|15987 CAG------------------TATTTGGAAAGGAAGTACGATACAGTTTATGATTTTTAT
Dipodomys_ordii|1002                ---ATGCCAAAAGGN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|9820               ATACATCAAAAG---------TGTTTGGAAAAGAAGTATGACCTCATTTGTGACTTTTGT
Pteropus_vampyrus|13310             ACACATCAGAAAGGN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Sus_scrofa|2512                     ACACATCAAAAAGGGTACAGGTGCCTGGAAAACAAGTGCGGCACAGTTTATGATTTTTAC
Bos_taurus|25488                    ACACATCGAAAAGGGTACAGGTGCCTGGAAAGGATGTGTGGGAGGATGTCTGATTTTTGT
Sorex_araneus|14769                 ATACATGAAGAAGGG------TTTCTGGAAAAGAAATGTAGCAGAATTTGTAATTTTTGT
Equus_caballus|15106                ---------------------TATCTGGAAAGGAATTATGGTACAGTTCGGGATTTTTGT
Equus_caballus|15108                ACACATCCAAAAGGG------TATCTGGAAAGGAAGTATGGTATGATTCGGGATTTTTAT
Mus_musculus|11155                  GAGCATCAGAAAGGG------TTCTTGGAGAGGAAGTATGATACAATTTGTGAGTTTTGT
Rattus_norvegicus|14768             GAACGTCAGAAAGGG------TTCTTGGAAAGGAAGTATGATACGGTTTGTGAGTTTTGT
Loxodonta_africana|22574            ATGCACCCGAAAGGG------TATCTGGAAAAGAAATATGATGCAGTTTGTGATATTTGT
Canis_familiaris|612                ACACATCAAAAAGGGTACAGGTATCTGGAAAGGAAATATGATACAGTTTGTGATTTTTAT
Felis_catus|45683                   GCACATCAAAAAGGG------TATCTGGAAAGGAAGTATGATACAGTTTGTGATTTTTAT
Cavia_porcellus|2593                ACACTCCCGAAAGGA------TGTTTGGAAAGGAAATATAATAAAATTCGTGACTTTTGT
Ochotona_princeps|1261              AATCATCCAAAAGGG------TGCTTGGAAAGGAAGTACGATACAATCCTAGATTTTTGC
Oryctolagus_cuniculus|21323         ATGCACGCCAAAGGG------TGCTTGGCAAGGAAGTATGATAGAGTCTGCGATTTTTGC
Microcebus_murinus|10641            ATGCACGAAAAAGGG------TGTTTGGAAAGGAAGTACAATACAGTTTGCGATTTTTGT
Callithrix_jacchus|43513            ATGCAGCCAAAAGGG------TGTTTGGAAAGGAGGTATGACACAGTATGTGGTTTCTGT
Gorilla_gorilla|5611                ATGCAACAAAAAGGG------TGTTTGGAAAGGAGGTATGACACGGTATGTGGTTTCTGT
Rhesus_macaque|15650                GTGCAACAAAAAGGG------TGTTTGGAAAGGAGATATGACACAGTATGTGGTTTCTGT
Pongo_abelii|27761                  ATGCAACAAAAAGGG------TGTTTGGAAAGGAGATATGACACGGTATGTGGTTTCTGT
Homo_sapiens|93736                  ATGCAACAAAAAGGG------TGTTTGGAAAGGAGGTATGACACAGTATGTGGTTTCTGT
Pan_troglodytes|37055               ATGCAACAAAAAGGG------TGTTTGGAAAGGAGGTATGACACGGTATGTGGTTTCTGT
Otolemur_garnettii|2666             ATGCATGAGAAAGGG------TGTTTGGAAAGGAAATACGATATAGTTTGTGATTTTTGT
Dasypus_novemcinctus|94             ACACGTCAAAAGGGA------TACCTGGGAAAGAAGTACGATACAGTTTGTGGTTTTTAT
Oryzias_latipes|21673               ---------------------TTCCTTGAGAAGAAACTTAAAGGACTTCAGAGCTTTTGG
Tetraodon_nigroviridis|3766         ------------------------------AGGCAAATGGAGGTTTTTCAGGACTACTGG
Fugu_rubripes|5460                  GCAGGCCATCATGACAAAAGcataCTGGAGAAGAAAATGACGGCTTTTCAGGATTATTTG
                                                                                                

Caenorhabditis_elegans|24820        CAACAAATAAGGCCGTATTTTGGAATTGGATCACTTTTGATATTTTTGGTGGTCTATCAT
Macropus_eugenii|618                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCTTTTTG
Nematostella_vectensis|19532        ------------------------ATGGTCATCCTTACCACCCTTCTCCTCATTTAT---
Tarsius_syrichta|82                 AGGAAGCACAAAACCATGGTTCGATACATCATCTGGGGTATTTTATTAGCAGGTTATCTG
Choloepus_hoffmanni|2733            AGGAAACATAAAACCACCCTTCGGTATATCATCTGGGGCATTTTATTAGCAGGCTACCTG
Ornithorhynchus_anatinus|15894      AGGAAACATGAAACCGTGATTCGCTACGTGATCATTGGCCTTTTATCAGCAGGTTTTCTT
Vicugna_pacos|7402                  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|2950             CAGAAACACAGAAGATTAATCAAGCATATAATCTATGGCATTTTGCTGGCTGGTTTCCTA
Anolis_carolinensis|1480            AAGAAACATAAAACCATAATTCGACAGGTTGTTTATGGAATATTGGCAGCAGCTTATCTG
Gallus_gallus|22892                 AAGAAACATAGAACCAGGATTAACTATGTGATGTACAGAATTTTAATAACAGTTTACTTG
Taeniopygia_guttata|18881           ---------aagaccAACCTAACTGACATGCATATTCTTCTTTCTGTAACAGCATACTTG
Monodelphis_domestica|26362         AGGAAGCATAAAGTTGTGGTCCAATATATCATCTATGGCGTTTTATTAGCAGGCTATTTG
Myotis_lucifugus|6147               AGAAAACACAGAACCACCATTCGGTATATCATCTGGGGCATCTTATTAGCAGGCTACCTG
Erinaceus_europaeus|9218            AGGAGACACAAAACCACCCTTCGTTACATCCTCTGGGGAGTTTTGTTAATAGGTTACCTG
Procavia_capensis|16587             CAGAAATACAAGACCACCCTTAAGTACATCCTCTGGGGCATTTTGTCAGCAGGTTACCTC
Ornithorhynchus_anatinus|14328      ------------------------------------------------------------
Spermophilus_tridecemlineatus|15987 AAAAAACACAAAACCACTATTCGATACATCATTTGGGGCATTTTACTGGCAGGTTACCTG
Dipodomys_ordii|1002                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|9820               AAAAAACACAAAACCATTCTTCGGTACATCATCTGGGGCATTTTAATAGCAGNNNNNNNN
Pteropus_vampyrus|13310             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTACTTG
Sus_scrofa|2512                     AGGGAACACAAAACAACCCTTCAGTATATCCTCAGGGGCATTTTACTAGCAGGGTACCTG
Bos_taurus|25488                    AGGGAACACAAAACAACCCTTCGGTACATCATCTGGGGCATTTTAATAGCAGGTTACCTG
Sorex_araneus|14769                 AAGAGACACAAAATCATTTTTCACTACATCTTCTGGGGTGTTTTATTAGCAGGTTATCTT
Equus_caballus|15106                CAAAAACACAAAACCACCCTTCGGTACATCCTCTGGGGCACCTTATTAGCTGGTTACCTG
Equus_caballus|15108                CAAAAACACAAAACCACCTTTCGGTACATCTTCTGGGGCATCTTATTAGCAGGTTACCTG
Mus_musculus|11155                  AGAAAGCACAGAGTTGTTCTCCGAAGCACCATCTGGGCCGTTTTACTGACAGGTTTCCTG
Rattus_norvegicus|14768             AGAAAGCACAGAGTCATTCTCCAGCACACCATCTGGGCAGTTTTACTGACAGGTTTCCTG
Loxodonta_africana|22574            AGGAAACACAAAACCACCCTTAAGTACATCATCTGGGGCATTTTATTAGCAGGTTACCTG
Canis_familiaris|612                AAGAAACACAAGACCATCTTTCAGTACATCATCTGGGGCATCTTAATACTAGGTTATCTG
Felis_catus|45683                   AAGAAACACAAAACCACCCTTCAGTACATCCTCTGGGGCATCTTAATAGTAGGTTACCTG
Cavia_porcellus|2593                ACAAAACACAAAGTCATTCTTCGATATATCATCTGGGGCATTTTATTAGTTGGTTATCTG
Ochotona_princeps|1261              AGGAAACACAAAACCACGCTTCAGTATATCACCTGGGGCATTTTATTAACCGGCTATCTG
Oryctolagus_cuniculus|21323         AGGAAACACAAAACCACCCTTCGCTATATCATCTGGGGCATTTTATTAGCAGGGTATCTG
Microcebus_murinus|10641            AGGAAACACAAAACCATTCTTCGGTACATCATCTGGGGCATTTTGTTAGCAGGTTATCTG
Callithrix_jacchus|43513            AGGAAACACAAAACGACTCTTCGACACATCATCTGGGGCATGTTATTAGCAGGTTATCTG
Gorilla_gorilla|5611                AGGAAACACAAAACCACTCTTCGGCACATCATCTGGGGCATTTTATTAGCAGGTTATCTG
Rhesus_macaque|15650                AGGAAACACAAAATCTCTCTTCGGCACATCATCTGGGGCATTTTATTAGCAGGTTATCTG
Pongo_abelii|27761                  AGGAAACACAAAACCATTCTTTGGCACATCATCTGGGGCATTTTATTAGCAGGTTATCTG
Homo_sapiens|93736                  AGGAAACACAAAACAACTCTTCGGCACATCATCTGGGGCATTTTATTAGCAGGTTATCTG
Pan_troglodytes|37055               AGGAAACACAAAACAACTCTTCGGCACATCATCTGGGGCATTTTATTAGCAGGTTATCTG
Otolemur_garnettii|2666             AGGAAACACAAAACTATTCTTCGGTACATCATCTGGGGCATTTTGTTAGCAGGTTACCTG
Dasypus_novemcinctus|94             AGGAAACACAAAACCATCTTTTGGCATATCATCTGGGGCATCTTATTAGCAGCCTACCTG
Oryzias_latipes|21673               GCAAGGCACAAAAGCCAGGTTCGACTGATCATGAACCTGGTTTTAGCAGCAGGCTTTGTT
Tetraodon_nigroviridis|3766         AACCAGCACAGAGATCTGATCTGCCTGGTAGCCAAGATAGTTTTAGCAGCAGtGTTCATT
Fugu_rubripes|5460                  CACCAGCACAGTGATCAGATCAGCCTGGTAGCCAAAATAGTTTTAGTAACAGcatttttt
                                                                                                

Caenorhabditis_elegans|24820        GGTTTTTTGGTTGCCGCGGGTATTCATAACTACCAGAAAGCTGCTCCATTAATTTATGTA
Macropus_eugenii|618                ACTCTAGTGACTGCAGCTTGTGTGGTGAACTTTCATAGAGCTCTCCCACTTTTTGTCCTC
Nematostella_vectensis|19532        ---AGCATTGTAGCCATTATCATCAGTGGGTTTGAAAAAGTCAAGATCCTCTTTGCCATC
Tarsius_syrichta|82                 GTTGTGGTGATTGCAGCCTGTGTGCTGAACTTCCACAGAGCTCTTCCTCTTTTTGTGATC
Choloepus_hoffmanni|2733            AGTGTGGTGATTGCAGCTTGTGTGCTGGACTTCCACAGAGCCCTTCCTCTTTTTGTGATC
Ornithorhynchus_anatinus|15894      GCTATGGTCATCGCAGCTTGCGTCCTGAATTTTAAACGAGCCCTCCCTCTTTTCCTGTTT
Vicugna_pacos|7402                  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|2950             GCAATGGTGATCGCAGCCTGTGTTTTGAACTTCAGAAGGGCTCTGGCGTTGTTTGTATTG
Anolis_carolinensis|1480            GCAATGGTAATTGCAGCCTGTACCTTGAATTTTCACAGAGCTTTGCCTCTCTTTGTGCTG
Gallus_gallus|22892                 GCAGTGGTTATTGCAGCCTGCAGCTTGAATTTTCAGAGAGCCTTGCCACTCTTCATCATT
Taeniopygia_guttata|18881           GCAGTAGTCATTGCAGCCTGCAGTTTGAATTTTCAGAGAGCTTTGCCACTCTTTGTCATC
Monodelphis_domestica|26362         GCTCTAGTGATTGCAGCCTGTGTGGTAAACTTTTATAGAGCCCTCCCACTTTTTGTCCTC
Myotis_lucifugus|6147               GCCATGGTGATTGCAGCCTGTGTGCTGAATTTTCACAGAGCCCTTCCTCTTTTCGTGATC
Erinaceus_europaeus|9218            GCTATTGTGATTGCCGCTTGTGTGCTCAACTTCCAGAGAGCCCTCCCTCTTTTTGTGATC
Procavia_capensis|16587             GCCTTGGTGATCACAGCTTGTGTGCTGAACTTCCGCAGAGCCTTTCCTCTTTTTGTGATC
Ornithorhynchus_anatinus|14328      ------------------------------------------------------------
Spermophilus_tridecemlineatus|15987 GCTTTGGTGATTGCAGCCTGTGTGCTGAATTTTCACAGAGCGCTTCCTCTTTTTGGGATC
Dipodomys_ordii|1002                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|9820               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Pteropus_vampyrus|13310             GCAATGGTGATTGCAGCTTGTGTGCTGGACTTTCACAGAGCCCTTCCTCTTTTCGTGATC
Sus_scrofa|2512                     GCCCTGGTGATTGCAGCCTGCGTGCTGAACTTCCACAGAGCCCTTCCTCTTTTCGTGATC
Bos_taurus|25488                    GCCCTGGTGATTGCAGCCTGTGTGATGAACTTTCACAGAGCCCTTCCTCTTTTCGTGATC
Sorex_araneus|14769                 GCTGCGGTGATTGCAGCATGTGTGATCAACTTTCACAGAGCCCTCCCTCTCTTTGTGTTA
Equus_caballus|15106                GCTATGGTGATCGCCGCGTGTGGGCTCAACTTTCACCGAGCCCTTCCTCTCTTCGTGATC
Equus_caballus|15108                GCTGTGGTGATCGCCGCGTGTGCCCTCAACTTTCACCGAGCCCTTCCTCTCTTCGTGATC
Mus_musculus|11155                  GCCCTGGTGATTGCAGCCTGTGCGATAAACTTCCACAGAGCCCTTCCTCTTTTTGTGATC
Rattus_norvegicus|14768             GCCCTGGTGATTGCAGCCTGTGCACTAAACTTCCACCGAGCCCTTCCCCTTTTTGTGATC
Loxodonta_africana|22574            GCTATGGTGATTGCAGCTTGTGTGCTGAACTTTCGCAGAGCCCTTCCTCTTTTTGTGATC
Canis_familiaris|612                GCGATGGTGATTGCAGCTTGTGTGTTGAACTTCCAGAGAGCTCTTGCCCTTTTTGTGATC
Felis_catus|45683                   GCAATGGTGATTGCAGCTTGTGCGCTGAACTTTCATAGAGCCCTTCCCCTTTTCGTGATC
Cavia_porcellus|2593                GCCATGGTGATCGCAGCCTGTGTGCTGAACTTTCGCAGAGCCCTTCCTCTCTTCGTGATC
Ochotona_princeps|1261              CTGCTGGTGATCACAGCCTGCGTGCTGAACTTCCACAGAGCCCTTCCTCTTTTTGTCATC
Oryctolagus_cuniculus|21323         GTGCTGGTGACCACAGCCTGCGTGCTGAACTTCCACAGAGCCCTTCCTCTTTTTGTGATC
Microcebus_murinus|10641            GCTCTGGTGATCGCAGCCTGTGTGCTGAACTTTCACAGAGCCCTTCCTCTGTTTGTGATC
Callithrix_jacchus|43513            GTTATGGTGATTGTGGCCTGTGTGCTGAACTTTCACAGAGCCCTTCCTCTTTTTGTGATT
Gorilla_gorilla|5611                GTTATGGTGATTTCGGCCTGTGTGCTGAATTTTCACAGAGCCCTTCCTCTTTTTGTGATC
Rhesus_macaque|15650                GTTATGGTGATTGCGGCCTGTGTGCTGAACTTTCACAGAGCCCTTCCTCTTTTTGGGATC
Pongo_abelii|27761                  GTTATGGTGATTTCGGCCTGTGTGCTGAACTTTCACAGAGCCCTTCCTCTTTTTGTGATC
Homo_sapiens|93736                  GTTATGGTGATTTCGGCCTGTGTGCTGAACTTTCACAGAGCCCTTCCTCTTTTTGTGATC
Pan_troglodytes|37055               GTTATGGTGATTTCGGCCTGTGTGCTGAACTTTCACAGAGCCCTTCCTCTTTTTGTGATC
Otolemur_garnettii|2666             GCGATGGTGATTGCAGCCTGCGTGCTGAACTTTCAGAGAGCCCTTCCTCTTTTTGTGATC
Dasypus_novemcinctus|94             TGTGTGGTGATTGCAGCTTGTGTGCTGGACTTCCACAGAGCCCTTCCTCTTTTTGTGATC
Oryzias_latipes|21673               GCCATGGTTACTGCAGCATGTATTGTGAAGTTTCATCGTGCTGTGGGGCTGCTGGTCATC
Tetraodon_nigroviridis|3766         GCGCTGGTGATAGTAGCGTGCATTATAGACCTCCACCGGGCTCTCGGGCTGCTGGTCTTC
Fugu_rubripes|5460                  gTGATGGTAATAATCGCGTGTGTTCTGAACCTCCAACGGGCTCTCGGGCTGCTGATCCTC
                                                                                                

Caenorhabditis_elegans|24820        ACATTATTTTTCTGGATATGCTATTTATTAAATTTAATCGTTGGAACCAAAACATTTAGA
Macropus_eugenii|618                ACTGTTGCTACCATATTCTTTGTTATTTGGGACTACTTGATAGGCAAATATGAAAGTCAG
Nematostella_vectensis|19532        ACCATGTTTCTGTGGTTCTGTCTCATCTACATGTTCATCTCTGCCCACTGGGGCTCAGCC
Tarsius_syrichta|82                 ACTGTGGCTGCCATCTTCTTTGTCATCTGGGATCGCTTGATGGCCAAATACGAACACCGA
Choloepus_hoffmanni|2733            ACCATGATTATCATCTTCTTTGTTATCTGGGATTACCTGATGGCCAAATATGAAGACCGA
Ornithorhynchus_anatinus|15894      TTGGTGGCTGTCATTCTATTTGTGTCCTGGGATTATCTGATGCCCAGATATGAAGAGAAA
Vicugna_pacos|7402                  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|2950             ACATTACTGGGCATTTTCTTTGTATTCTGGGATTTATTTATGGACAGATATGAAGGCAAG
Anolis_carolinensis|1480            ACTATCCTTGCCATCTTTTTCATCTGCTGGGACTTTTTGATGGCCAAATATGAGAACAGA
Gallus_gallus|22892                 ACTGTTCTAGCCATCTTCTTCATCTGCTGGGATTTCTTAGTAGCGAAGTATGAAGACAGA
Taeniopygia_guttata|18881           ACTATCTTAGCCATCTTCTTcatctgctgggattttttgaTAGCTAAGTATGAAGACAGA
Monodelphis_domestica|26362         ACGGTTGTTGCCATTTCCTTTGTTATTTGGGACTACGTGATAGCCAAATGTGAAGGTCAT
Myotis_lucifugus|6147               ACCGTGGTTGCCATCTTCTTTGTGATCTGGGATCACTTTATGGCCAAATATGAACATCAA
Erinaceus_europaeus|9218            ACTGTGGCTATCGTCTTCTTTGTGGCCTGGGATTTTTTTATGGCCAAATATGAACATCGA
Procavia_capensis|16587             CCTGTGGCTGTCATCTTCTTTCTTGTCTGGGATTACTTGATGGCTAAATATGAAGAACAA
Ornithorhynchus_anatinus|14328      ------------------------------------------------------------
Spermophilus_tridecemlineatus|15987 ACCGTGGCTGCCATCTTCTTTGTTGTCTGGGATCACTTGATGGCCAAATATGAACATCGA
Dipodomys_ordii|1002                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|9820               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Pteropus_vampyrus|13310             ACCGTGGCTGCCAGCTTCTTTGTGGTCTGGGATCACTTAATGGCCAAATATGAACATCGA
Sus_scrofa|2512                     ACAGTGGTCGTCATCTTCTTTGTGGTCTGGGATCGCTTCATGGCCAAATATGAGTCGCAG
Bos_taurus|25488                    ACCGTGGTTGCCATCTTCTTTGTGGTCTGGGATCACCTCATGGCCAAATATGAGTCTCAG
Sorex_araneus|14769                 ACTGTGGCTGTCATCTTCTTTGTAACCTGGGATCACTTAATGGCCAAATATGAACCGCGA
Equus_caballus|15106                ACTGTGGCTGCCATCTTCTTTGTGGTCTGGGATCACTTTATGGCCAAATATGATCATCGA
Equus_caballus|15108                ACCGTGGCTGCCATCTTCTTTGTGGTCTGGGATCACTTTATGGCCAAATATGAGCATCGA
Mus_musculus|11155                  ACCTTGGTGACCATCTTCTTTGTCATCTGGGATCACTTGATGGCCAAATATGAACAGCGA
Rattus_norvegicus|14768             ACCTTGGTGACCATCTTCTTCGTCGTCTGGGATCGCTTGATGGCCAAATACGAACAGCGA
Loxodonta_africana|22574            ACTGTGGCTGTCATCTTCTTTCTTGTCTGGGATTACTTGATGGCTAAATACGAAGATCGA
Canis_familiaris|612                ACTGTTGCTGCCATCTTCTTTGTTATCTGGGATTACTTTATGGCCAAATATGAGCATCAA
Felis_catus|45683                   ACCGTGGCTGTCATCTTCTTTGTTGTCTGGGATTACTTTATGGCCAAATATGAGCATCGA
Cavia_porcellus|2593                ACTGTGGCTGCCATCTTCTTTGTCATCTGGGATCACTTGATGGCTAAATATGAAAGTCGA
Ochotona_princeps|1261              ACCATGGCGGCCATCTTCTTTGTCATCTGGGATCATCTGATGGCCAGATACGAGCATCGG
Oryctolagus_cuniculus|21323         ACCGTGGCTGCCATCTTCTTTGTCATCTGGGACCGCCTGATGGTCAAATACGAACGTCGG
Microcebus_murinus|10641            ACCGTGACTGCCATCTTCTTCGTTGTCTGGGATCGCCTGATGGCTAGATATGAACATCGA
Callithrix_jacchus|43513            ACTGTGGTTGCCATCTTCTTCGTTGTCTGGGATCACCTGATGGCCAAATATGAACATCAA
Gorilla_gorilla|5611                ACTGTGGCTGCCATCTTCTTTGTTGTCTGGGATCACCTGATGGCCAAATACGAACATCGA
Rhesus_macaque|15650                ACCGTGGCTGCCATCTTCTTTGTTGTCTGGGATCACCTGATGGCCAAATACGAACAGCGA
Pongo_abelii|27761                  ACCGTGGCTGCCATCTTCTTTGTTGTCTGGGATCACCTGATGGCCAAATACGAACATCGA
Homo_sapiens|93736                  ACCGTGGCTGCCATCTTCTTTGTTGTCTGGGATCACCTGATGGCCAAATACGAACATCGA
Pan_troglodytes|37055               ACCGTGGCTGCCATCTTCTTTGTTGTCTGGGATCACCTGATGGCCAAATACGAACATCGA
Otolemur_garnettii|2666             ACTGTGACTGCCATCTTCTTTGTTATCTGGGATCACCTGACGGCCAGATATGAACCTCGA
Dasypus_novemcinctus|94             ACCGTGGTTGTCATCTTCTTTGTTGTCTGGGATTACTTGATAGCCAAATATGAAGATCGA
Oryzias_latipes|21673               TCCTTGGTAACCATATTCTTCCTGGTTTGGGATTGGATGATGGAGCGGTATGGCGACCAG
Tetraodon_nigroviridis|3766         ACGTTGCTGGCTATATTTTTCTACTTCTGGGACCGGTTGGTGGAGCGTTATGGCAGTTGG
Fugu_rubripes|5460                  ACGTTACTGGCTGTATTCTTCTACGTCTGGGACTGGCTCATGAAGCGTTATGGCAGTTGG
                                                                                                

Caenorhabditis_elegans|24820        GCTGTCTATGATGATGTGGGGCGTAAATTAGAGGAAATTACAGAGCAGAAGAAATTTGTG
Macropus_eugenii|618                ATTGCT---GAGTTCTTGTCTCCTGCTGGCAGATTCCTGAACAAACATTGGTTCTGGTTG
Nematostella_vectensis|19532        ATCTACAGAGCTCTTTTCAAGCCGATTGCCAGAGTAATCCAGGGACAGTGGTATTGGTTG
Tarsius_syrichta|82                 ATTGAT---GAGATCCTGTCTCCTGGCAGAAATCTTCTGAGCAGTCATTGGTTCTGGCTG
Choloepus_hoffmanni|2733            ATTGAT---GCATTCCTGTCGCCCAGTAAAAGGCTTCTTGACGGCCATTGGTTCTGGCTA
Ornithorhynchus_anatinus|15894      ATTGCT---GGGCTCTTCTCTCGGGGCCATGGATTCTTGAACAAGCAGTGGTTCTGGCTG
Vicugna_pacos|7402                  NNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|2950             ATTGTT---AAATTGTTCTCCCCCATTGGAACCTTTACAAAGAAACACTGGTTTTGGATG
Anolis_carolinensis|1480            ATTGCa---aaatctctttctccttttgGAAAGTTTCTGAATAAACAGTGGTTTTGGCTG
Gallus_gallus|22892                 ATTGCT---GCATTTTTTTCCCCTGGAGAACGATATTTGGAGAAACAGTGGTTTTGGCTG
Taeniopygia_guttata|18881           ATTGCT---GCATTCTTTTCCCCTGGAGACCGTTATCTGAAAAAACAGTGGTTTTGGCTG
Monodelphis_domestica|26362         ATTGCA---GGGTTCTTGTCTCCTGGTGGCAGAGTCCTAAACAAACATTGGTTCTGGTTG
Myotis_lucifugus|6147               ATTGAT---GAGTTCCTATCTCCTGGCAGAAGACTTCTGGACAGCCATTGGTTCTGGCTG
Erinaceus_europaeus|9218            GTCATT---GAGTTCCTGTCCCCTGGCAGAAGGCTGCTGAACAGACATTGGTTCTGGCTG
Procavia_capensis|16587             ATTGAT---GAGTTCCTGTCTCCTGGAAGAAGACGTCTGTACAGCCAGTGGTTCTGGCTG
Ornithorhynchus_anatinus|14328      ---------------------------------------------------------CTT
Spermophilus_tridecemlineatus|15987 ATTGAT---GAGATCATATCTCCAGGCAAAATGCTGCTGAACAGCCACTGGTTCTGGCTG
Dipodomys_ordii|1002                NNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|9820               NNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCCATTGGTTCTGGCTA
Pteropus_vampyrus|13310             GTTGAT---GAGTTCCTATCTCCTGGCAGAAGGCTTCTGGACAGCCATTGGTTCTGGCTG
Sus_scrofa|2512                     ATCGAT---AAGTTCCTGTCTCCTGGCAGAAAGCTTCTGGACAGCCACTGGTTCTGGCTG
Bos_taurus|25488                    ATAGCC---AGGTTCCTGTCTCCAGGCCAAAGGCTACTGGACAGCCATTGGTTCTGGTTG
Sorex_araneus|14769                 GTTATT---GAGTGCCTATCCCCTGGGCGAAGATTGGTGGACAACCACTGGTTCTGGCTG
Equus_caballus|15106                ATTGAA---GAGCTCCTGTCTCCTGGCAGAAGGTTTCTGGACAGCCATTGGTTCTGGCTG
Equus_caballus|15108                ATCGAA---GAGCTCCTGTCTCCTGGCAGAAGGTTTCTGGACAGCCATTGGTTCTGTCTG
Mus_musculus|11155                  ATAGAT---GATTTCCTGTCTCCTGGCAGAAGGCTTCTCGACAGGCATTGGTTCTGGCTG
Rattus_norvegicus|14768             ATCGAT---GATGTCCTGTCTCCCGGCAAAAGGCTGCTTGAGAGGCATTGGTTCTGGCTG
Loxodonta_africana|22574            ATTGAT---GAGCTCCTGTCTCCTGGAAGAAGCCTTCTGAACAGGCATTGGTTCTGGCTA
Canis_familiaris|612                ATCGAT---GAGTGTCTGTCTCCTGCCAAAGGGCTCCTAAACAGCCATTGGTTCTGGATG
Felis_catus|45683                   ATCAAT---GAGTGCCTATCTCCTGGCAAAAGGCTCCTAAACAGCCATTGGTTCTGGATG
Cavia_porcellus|2593                ATTGAT---GAGATCCTGTCTCCAGGCAGACGGCTTCTGGACAGTCATTGGTTCTGGATA
Ochotona_princeps|1261              CTTGAT---GACCTTCTCTCCCCCGGTCGAAGGCTTCTGAATCACCACTGGTTCTGGCTG
Oryctolagus_cuniculus|21323         ATGGAC---GAGATCCTCTCTCCTGGGAGGGGGCTTCTGAACCGCCACTGGTTCTGGCTC
Microcebus_murinus|10641            GTTGAC---GAGATCCTGGCTCCCGGCAGAAGGCTTCTGAACGGCCATTGGTTCTGGCTG
Callithrix_jacchus|43513            ATTGAT---GAGATGCTGTCTCCTGGAAGAAAGTTTCTGAGCGGCCATTGGTTCTGGCTG
Gorilla_gorilla|5611                ATTGAT---GAGATGCTGTCTCCTGGCAGAAGGCTTCTAAACAGCCATTGGTTCTGGCTG
Rhesus_macaque|15650                ATTTAT---GAGATGCTGTCTCCTGGCAGAAGGCTTCTAAACGGCCATTGGTTCTGGCTG
Pongo_abelii|27761                  ATTTAT---GAGATGCTGTCTCCTGGCAGAAGGCTTCTAAACAGCCATTGGTTCTGGCTG
Homo_sapiens|93736                  ATTGAT---GAGATGCTGTCTCCTGGCAGAAGGCTTCTAAACAGCCATTGGTTCTGGCTG
Pan_troglodytes|37055               ATTGAT---GAGATGCTGTCTCCTGGCAGAAGGCTTCTAAACAGCCATTGGTTCTGGCTG
Otolemur_garnettii|2666             ATTGAT---GAGCTTCTATCTCCTGGCAGGAGGTTTCTGGACAGCCACTGGTTCTGGCTG
Dasypus_novemcinctus|94             ATTGCT---GCATTCCTGTCTCCCGGGAGAAGGCTTCTGGACAGCCATTGGTTCTGGCTG
Oryzias_latipes|21673               GTGTGG---GAGGTTCTTGCTCCAGTCAAAAACATTCTCAAAAGAAATTGGGTTTGGTTC
Tetraodon_nigroviridis|3766         ATGTGG---GAGGCCAGCTCTCCCATCAGATGTCTTCTCAGCAGGAACTGGTTTTGGATG
Fugu_rubripes|5460                  ATGTGG---GAGGCGAGCTCCCCCATCAGATGCCTTCTCAGCAGgagctgggtttggatg
                                                                                              . 

Caenorhabditis_elegans|24820        CCCTTAAGTCTCAAAATTGCATTTATTTTTGCTCTTTTAGCATTCACTATTATTGACTCA
Macropus_eugenii|618                AAGTGGCTGATGTGGATCTTGCTGATTTGGGGAGTCATTTGCTGGCTAATTTTTGACACA
Nematostella_vectensis|19532        AAATGGGTTTGTATTGTGGTTATCTTGGCTCTCCTTGCCTTGTTTCTTGGATTGGATAAT
Tarsius_syrichta|82                 AAGTGGGTAATCTGGAGCTCCCTGATCCTAGTGGTTATTTTCTGGCTGATCTTCGACACT
Choloepus_hoffmanni|2733            AAGTGGGTGATTTGGATCTCACTAATCCTGTGGGTTATTCTCTGGCTGATCCTTGACACG
Ornithorhynchus_anatinus|15894      AAGTGGGTTCTGTGGAGCTCCCTGATAATAGGGGTCATTTTCTGGCTCATCTTTGATACA
Vicugna_pacos|7402                  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|2950             AAATGGGTGATTTGGATAAGCCTTGTAGCTGGTGTTATATGCTGGCTAATTTTTGATACA
Anolis_carolinensis|1480            AAATGGGTGGTGTGGATCTCTCTAATAACTGCCATTGTGTGCTGGCTTATCTTTGACACT
Gallus_gallus|22892                 AAATGGGTACTATGTGCAGCTCTTATTGTAGCTATCATTTTCTGGCTCATCTTTGACACA
Taeniopygia_guttata|18881           AAATGgGTCTTGTGTGCAGCTCTTATTATAATGATCATCTGCTGGCTCATCTTCGACACA
Monodelphis_domestica|26362         AGGTGGTTAATGTGGATCTTGCTGATTATAGCAGTCATTTGTTGGCTAATTTTTGACACA
Myotis_lucifugus|6147               AAGTGGGTGATTTGGAGCTCGCTGATCCTGGGGGTTATTTTCTGGCTGATCTTTGACACT
Erinaceus_europaeus|9218            AAGTGGGTGATTTGGAGTTCACTGGTCCTGGGGTCTTTATTCTGGCTGATCTTTGACACT
Procavia_capensis|16587             AAGTGGGTGCTCTGGAGTTCACTGATCCTGGCTGTGATTTTCTGGCTGATCTTCGACACA
Ornithorhynchus_anatinus|14328      AAATTTTTCCTTTGG---------------------------------------------
Spermophilus_tridecemlineatus|15987 AAGTGGGTGATTTGGAGCTTATTGATCCTAGGGATCATCTTCTGGCTGATCTTCGACACG
Dipodomys_ordii|1002                NNNNNGGTGATCTGGAGCTTACTGATCCTAGGGGTTATCTTCTGGCTGATTCTGGACACT
Tupaia_belangeri|9820               AAGTGGGTGATTTGGAGCTTACTGATTCTGGGAGTTATTTTCTGGCTGATCTTCGACACC
Pteropus_vampyrus|13310             AAGTGGGTGATTTGGAGCTCACTGATCCTGGGGATCATTTTCTGGCTGGTCTTTGACACC
Sus_scrofa|2512                     AAGTGGGTGACTTGGGGCTCCCTGATCCTGGGAGTTATTTTGTGGCTGATCTTTGACACC
Bos_taurus|25488                    AAGTGGGTGATATGGGGCTGCCTAATCCTGGGAGTTATTCTCTGGCTGGTCTTTGACACT
Sorex_araneus|14769                 AAGTGGGTTATTTGGAGTGCACTGATCCTTGTTGTTATTTTATGGCTAGCCTTGGACACT
Equus_caballus|15106                AAGTGGGTGATTTGGAGCTCTCTGATCCTGGGAGTTGTTTTCTGGCTGATCTTTGACACC
Equus_caballus|15108                AAGTGGGTGATTTGGAGCTCTCTGATCCTGGGAGTTATTTTCTGGCTGATCTTTGACACC
Mus_musculus|11155                  AAATGGGTGGTCTGGAGTTCATTGATCCTGGCGATTATTCTCTGGCTGTCTCTTGACACT
Rattus_norvegicus|14768             AAGTGGGTGGTCTGGTGCTCACTGATCTTGGCGGTCATTCTCTGGCTGGCTCTGGACACG
Loxodonta_africana|22574            AAGTGGGTACTGTGGAGTTCGCTGATCCTGGGGGTGATTTTCTGGCTGATCTTCGACACA
Canis_familiaris|612                AAGTGGGTGGTTTGGAGCTTACTGATCCTGGGAGTTATTCTCTGGCTGATCTTTGATACT
Felis_catus|45683                   AAGTGGGTGATTTGGAGCTTACTGATTCTGGGTGTTATATTCTGGCTCATCTTGGACACC
Cavia_porcellus|2593                AAATGGGTCATGTGGAGCTTGTTGATCCTGGGCATTATTTTCTGGCTGATCCTCGACACC
Ochotona_princeps|1261              AAGTGGGTGATCTGGAGTTTGCTCATCCTAGCAGTAATGTTCTGGCTGATCCTCGACACT
Oryctolagus_cuniculus|21323         AAGTGGGTGATTTGGAGCTCACTGATCCTGGCGGTTATGTGCTGGCTGATCCTCGATACT
Microcebus_murinus|10641            AAGTGGGTGATTTGGAGCTGCCTGAGCCTGGGGGTTATTTTCTGGCTGGTCTTGGACACT
Callithrix_jacchus|43513            AAGTGGGTGATCTGGAGCTCCCTGGTCCTAGCAGTTATTTTCTGGCTGGCCTTTGACACC
Gorilla_gorilla|5611                AAGTGGGTGATCTGGAGCTCCCTGGTCCTAGCAGTTATTTTCTGGTTGGCCTTTGACACT
Rhesus_macaque|15650                AAGTGGGTGATCTGGAGCTCCCTGGTCCTAGCAGTTATTTTCTGGCTGGCCTTTGACACT
Pongo_abelii|27761                  AAGTGGGTGATCTGGAGCTCCCTGGTCCTAGCAGTTATTTTCTGGTTGGCCTTTGACACT
Homo_sapiens|93736                  AAGTGGGTGATCTGGAGCTCCCTGGTCCTAGCAGTTATTTTCTGGTTGGCCTTTGACACT
Pan_troglodytes|37055               AAGTGGGTGATCTGGAGCTCCCTGGTCCTAGCAGTTATTTTCTGGTTGGCCTTTGACACT
Otolemur_garnettii|2666             AAATGGGTGATTTGGAGCTCCCTGATCCTGGCCACTATCTTCTGGCTGATCTTGGACACG
Dasypus_novemcinctus|94             ---TGGGTGATTTGGATCATGCTTATCCTGGGGGTTATTTTCTGGCTGATCCTTGACACT
Oryzias_latipes|21673               AGATGGATCCTGTATGTGTTGCTTCTGGCAGCTGTGGTTTGTTGGCTCGTCCTTGACACG
Tetraodon_nigroviridis|3766         CGATGTGTTCTTTACGCATCTCTGCTGGTGCTAACGGTTTTGTGGTTAGTCCTGGACACA
Fugu_rubripes|5460                  agatGGGTTGCACTCGTGTCCCTGCTGGTTTTCGTGGTTTTGTGGTTAGTCCTGGACACA
                                       .                                                        

Caenorhabditis_elegans|24820        ATTCAT---GATTTGACCCGTTTGACCGGATTTTTTGCATACGTTTTCTATATTCTATTC
Macropus_eugenii|618                GCCAAACAGGGAACTCAGTCACTG---TCCTTTGGTGGNNNNNNNNNNNNNNNNNNNNNN
Nematostella_vectensis|19532        CACGAT---GAACCTGAGCGCTTGATATCTCTTGCTGGCCTCTGTGTTAATATTCTAGTC
Tarsius_syrichta|82                 GCCAAATTGGGTCAACGGCAGCTGGTGTCCTTTGGTGGGCTTATCATGTACATCGTCCTG
Choloepus_hoffmanni|2733            GCCAAATTGGGCCAACAGCAGCTGGTGTCGTTTGGTGGGCTTATAATGTACATTGTCCTG
Ornithorhynchus_anatinus|15894      GCTAAACTGGGGAAGCAGAACCTGGTATCCTTTGGTGGGCTCATAGTGTTCATTGTTCTG
Vicugna_pacos|7402                  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|2950             GCAAAAATGGGAGCCAATCAACTGATATCATTTGGTGGACTTGTGATGTATGTGCTCTTA
Anolis_carolinensis|1480            GCCAAACAAGGAGCCAAACAGCTCATATCCTTTGCTGGACTAGTCGTGTATGTTCTCTTG
Gallus_gallus|22892                 GCAAAACAGGGATCCCACCAGCTGATCTCCTTTGGTGGGCTTGTGATGTATATTCTCTTG
Taeniopygia_guttata|18881           ACAAAACGAGGATCCAGTCAGCTAATCTCTTTTGGTGGGCTTGTGATGTACATTGTCTTG
Monodelphis_domestica|26362         GCCAAACAGGGAACCCAGCCTTTGGTGTCCTTTGGTGGCCTTGTGTTCTATGTTCTCCTG
Myotis_lucifugus|6147               GCCAAGCTGGGCCAGCAGCAGCTGGTGTCCTTCGGGGGGCTCAACATATACATTATCCTG
Erinaceus_europaeus|9218            GCCGCACTGGGAAGCCAGCAACTGATCTCATTTGGTGGACTCATCATGTACATGACACTA
Procavia_capensis|16587             GCCAAACTGGGCCGACAACAGCTGGTGTCCTTTGGTGGCCTTGTAATGTTCCTTCTCCTG
Ornithorhynchus_anatinus|14328      ------------------------------------------------------------
Spermophilus_tridecemlineatus|15987 GCCAAATTGGGCCAACAGCAGCTGGTGTCCTTTGGTGGACTCATAATGTACATTATCCTT
Dipodomys_ordii|1002                GCCAAATTGGGTAAACAGCAGCTGGTGTCCTTTGGTGGCCTCATCACGTACATTATCCTG
Tupaia_belangeri|9820               GCCAGGTTGGGCCAACAGCAACTGATATCCTTCGGTGGGCTCATAATGTACATCGTCCTG
Pteropus_vampyrus|13310             GCCAAACTGGGCCAACAGCAGCTGGTGTCCTTTGGCGGGATTATCATGTACATTATCCTG
Sus_scrofa|2512                     GCCAAACTGGGCCAACAGCAGCTCGTGTCCTTCGGTGGACTCATAATGTACATCAGCCTG
Bos_taurus|25488                    GCCAAACTGGGCCAACAGCAGCTGGTGTCTTTTGGAGGACTCATAATATACACTTCCCTA
Sorex_araneus|14769                 GCCAAATTGGGCCAACAGCAGCTGGTGTCATTTGGGGGACTTATAATGTATATTGTTCTG
Equus_caballus|15106                GCCAAATTGGGGAAATGGCAGCTGGTGTCCTTCGGTGGACTCATAGTGTACGTTATCCTG
Equus_caballus|15108                GCCAAACTGGGCCAACGGCAGCTGGTGTCCTTTGGTGGGCTCATAATGTACGTTATCCTG
Mus_musculus|11155                  GCCAAACTGGGCCAACAAAACTTGGTATCCTTTGGCGGACTCATCATGTACCTTATCCTG
Rattus_norvegicus|14768             GCCAGGCTGGGCCAACAGCAGCTGATATCCTTTGGTGGGCTCGTCATGTATATTGTTCTG
Loxodonta_africana|22574            GCCAAATTGGGCCGACAGCAGCTGGTATCGTTTGCTGGCCTTGTAATGTTCCTTCTCCTG
Canis_familiaris|612                GCCAAATTGGGCCAACAGCAGCTGATATCCTTTGGTGGGCTCGTAATGTACATTATCCTG
Felis_catus|45683                   GCCAAACTGGGCCAACAGCAGCTGGTGTCCTTTGGTGGGCTCATAATGTACATTATCCTG
Cavia_porcellus|2593                GCCAAGTTGGGACAGCAGCAACTAGTGTCCTTCGGTGGGCTCGTGATGTATATTCTCCTG
Ochotona_princeps|1261              GCCAAACTGGGTCAACAGCAGCTGGTGTCCTTTGGTGGGCTCATAATGTATGTCATCCTG
Oryctolagus_cuniculus|21323         GCCAAGCTGGGCCAACAGCAGCTGGTGTCCTTTGGCGGGCTCCTAATGTATGTCACCCTG
Microcebus_murinus|10641            GCCAGGATGGGCCGACAGCACCTGGTGTCCTTCGGTGGGCTCATAATGTACATCACCCTG
Callithrix_jacchus|43513            GCCAAATTGGGCCAACAGCAGCTGGTGTCCTTCGGTGGGCTCATAATGTACATTGTCCTG
Gorilla_gorilla|5611                GCCAAATTGGGTCAACAGCAGCTGGTGTCCTTCGGTGGGCTCATAATGTACATTGTCCTG
Rhesus_macaque|15650                GCCAAATTGGGTCAACAGCAGCTGGTGTCCTTTGGTGGGCTCGTAACGTACATTGTCCTG
Pongo_abelii|27761                  GCCAAATTGGGTCAACAGCAGCTGGTGTCCTTCGGTGGGCTCATAACGTACATTGTCCTG
Homo_sapiens|93736                  GCCAAATTGGGTCAACAGCAGCTGGTGTCCTTCGGTGGGCTCATAATGTACATTGTCCTG
Pan_troglodytes|37055               GCCAAATTGGGTCAACAGCAGCTGGTGTCCTTCGGTGGGCTCATAATGTACATTGTCCTG
Otolemur_garnettii|2666             GCCAAGAGGGGCCAACAGAATCTAGTGTCCTTCGGGGGACTCATAATGTACCTAGTCCTG
Dasypus_novemcinctus|94             GCCAAATTGGGCCAACAGCAGCTGATATCCTTCGGTGGGCTTGTAATGTACATTATCCTG
Oryzias_latipes|21673               GCCCAGCGGGGCACCAGACAGTTGTTGTCCTTTGGTGGTTTGCTGTTTCTTGTCTTTTCA
Tetraodon_nigroviridis|3766         GCTAAGCAAGGGACCAGGCAGATTGTGTCTTTCTTCGGTTtgctcctcttcgtcctcttg
Fugu_rubripes|5460                  GCTCAGAGAGGGCCCAGGCAGATGGTGTCTTTCCTCGGTTTGCTCCTTTTAATCTTCTTG
                                                                                                

Caenorhabditis_elegans|24820        ATGTTTGTATTTTCCAATAACAGAATGAAGATCAACTGGTCCGTTGTATCCAGCGCCTTA
Macropus_eugenii|618                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTGTTCTGGAGACCTGTCTTTTGGGGAATT
Nematostella_vectensis|19532        TGTTGGCTCTTTTCCAAGAACCGCAGAAAGATCCGCTGGCGTCCAGTGTTCTGGGGTCTT
Tarsius_syrichta|82                 TTACTTCTATTTTCCAAATACCCAACTAGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|2733            GTATTTCTATTTTCCAAGCATCCAACCAGAGTTTACTGGAGACCTATCTTTTGGGGAATT
Ornithorhynchus_anatinus|15894      ATGCTTATATTTTCCAAATACCCAACCAAAGTA---------------------------
Vicugna_pacos|7402                  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTTACTGGAGGCCTGTCTTTTGGGGAATT
Xenopus_tropicalis|2950             ATGTTCATCTTTTCAAAGCATCCTACCAAGGTTCGTTGGAGGCAAGTATTTTGGGGTATT
Anolis_carolinensis|1480            ATGCTGATTTTTTCTAAATATCCAACTAAGGTTGTATGGAGGCCAGTATTCTGGGGGATA
Gallus_gallus|22892                 ATGTTTATATTCTCCAAATATCCAACAAGAGTTGCTTGGAGACCAGTGTTTTCAGGAATA
Taeniopygia_guttata|18881           atgcttctcttttccaaatatccaaccCAAGTTGCTTGGAGACCAGTATTTTCAGGAATA
Monodelphis_domestica|26362         ATGTTTATATTTTCTAAGCATCCAACTAGAGTTTTCTGGAGACCTGTCTTTTGGGGAATT
Myotis_lucifugus|6147               CTATTTCTATTTTCCAAATACCCAACCAAAGTTTACTGGAGGCCTGTCTTTTGGGGAATT
Erinaceus_europaeus|9218            TTATTTCTGTTTTCCAAGTATCCGACCAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Procavia_capensis|16587             ACATTTCTGTTTTCCAAACACCCAACCAAAGTTTACTGGAGACCTGTCTTTTGGGGAATT
Ornithorhynchus_anatinus|14328      ------------------------------------------------------------
Spermophilus_tridecemlineatus|15987 TTGTTTATATTTTCTAAGTACCCAACCAGAGTTTACTGGAGACTTGTCTTTTGGGGAATT
Dipodomys_ordii|1002                CTATTTCTGTTTTCTAAGCACCCAACCAGAGTTCACTGGAGGCCTGTCTTTTGGGGAATT
Tupaia_belangeri|9820               GCATTCGTGTTTTCCAAGCACCCAACCAAAGTTTACTGGAGACCTGTCTTTTGGGGAATT
Pteropus_vampyrus|13310             CTATTTCTATTTTCCAAGTACCCAACCAAAGTTTACTGGAGGCCTGTCTTTTGGGGAATT
Sus_scrofa|2512                     ACATTTCTGTTTTCCAAGCACCCAACCAAAGTTTCCTGGAGACCCGTCTTTTGGGGAATT
Bos_taurus|25488                    ACATTTCTATTTTCCAAGCACCCAACCAAAGTTTACTGGAGGCCTGTCTTTTGGGGAATT
Sorex_araneus|14769                 GTATTTCTATTTTCCAAGCACCCAACCAAAGTGTACTGGAGGCCTGTCTTTTGGGGAATT
Equus_caballus|15106                CTATTTCTATTTTCCAAGCACCCAACCAAAGTACACTGGAGGCCTGTCTTTTGGGGAATT
Equus_caballus|15108                ATGTTTCTATTTTCCAAGCACCCAACCAAAGTTCGCTGGAGGCCTGTCTTTTGGGGAATT
Mus_musculus|11155                  TTATTTCTGTTTTCCAAACATCCCACCAGAGTTTACTGGAGGCCTGTCTTTTGGGGAATT
Rattus_norvegicus|14768             CTATTCCTGTTTTCCAAGCATCCGACCAGAGTTTACTGGAGGCCTGTCTTTTGGGGAATT
Loxodonta_africana|22574            ACATTTCTATTTTCCAAGCACCCAACCAAGGTTTACTGGAGACCTGTCTTTTGGGGAATT
Canis_familiaris|612                GTGTTTCTATTTTCTAAGCACCCAACCAAAGTTTACTGGAGGCCTGTCTTTTGGGGAATT
Felis_catus|45683                   GTATTTATATTTTCCAAGCACCCAACCAAAGTTTACTGGAGGCCTGTCTTTTGGGGAATT
Cavia_porcellus|2593                TTATTTCTGTTTTCCAAGCATCCAACCAGAGTTTACTGGAGACCTGTCTGCTGGGGAATT
Ochotona_princeps|1261              ATGTTTCTGTTTTCCAAGCATCCGACCAGAGTTTACTGGAGACCCGTCTTTTGGGGAATT
Oryctolagus_cuniculus|21323         ATATTTCTATTTTCCAAGCACCCGACCAGAGTTTACTGGAGACCTGTCTTTTGGGGAATT
Microcebus_murinus|10641            TTATTTCTGTTTTCTAAACACCCAACCAGAGTTTACTGGAGACCTGTCTTTTGGGGAATT
Callithrix_jacchus|43513            TTATTTCTATTTTCCAAGTACCCAACCAGAGTTTACTGGAGACCTGTCTTATGGGGAATT
Gorilla_gorilla|5611                TTATTTCTCTTTTCCAAGTACCCAACCAGAGTTTACTGGAGACCTGTCTTATGGGGAATC
Rhesus_macaque|15650                TTATTTCTATTTTCCAAGTACCCAACCAGAGTTTACTGGAGACCTGTCTTATGGGGAATC
Pongo_abelii|27761                  TTATTTCTATTTTCCAAGTACCCAACCAGGGTTTACTGGAGACCTGTCTTATGGGGAATC
Homo_sapiens|93736                  TTATTTCTATTTTCCAAGTACCCAACCAGAGTTTACTGGAGACCTGTCTTATGGGGAATC
Pan_troglodytes|37055               TTATTTCTATTTTCCAAGTACCCAACCAGAGTTTACTGGAGACCTGTCTTATGGGGAATC
Otolemur_garnettii|2666             TTATTTCTGTTTTCTAAGCACCCAACCAGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dasypus_novemcinctus|94             GTATTTCTATTTTCCAAGCACCCAACCAGAGTTTACTGGAGACCTGTCTTTTGGGGAATT
Oryzias_latipes|21673               ATGATGGTTTTCTCCAAACACCCATTCAAGTGGTCGTGGCGAACTTTGCTCAGTGGGATT
Tetraodon_nigroviridis|3766         ATGCTCGTGTTCTCCAAACACCCGTTCCACTGGTCTTGGCAAGCTCTGATCTCGGGGACT
Fugu_rubripes|5460                  ATGCTCCTGTTCTCCAAACATCCATTCAAGTGGTCTTGGCGGGTTTTGGTGTCGGGGATT
                                                                                                

Caenorhabditis_elegans|24820        ATCATGCATTACTGTGTAGCACTCATCATCCTAAAATGGTCGACAGGACAGTGGTTCTTC
Macropus_eugenii|618                GGACTGCAGTTTCTTCTTGGTATTCTCATTCTAAGAACTACACCTGGATTTGAGGCATTC
Nematostella_vectensis|19532        GCCCTCCAGTTTATCTTTGGCCTGCTCATTCTACGTACCCCGCAAGGGTTCTCTGTCTTC
Tarsius_syrichta|82                 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|2733            GGTTTACAGTTTCTTTTCGGGCTCTTAATTCTGAGGACTAAACTTGGATTTATGGCTTTC
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  GGGATACAGTTTCTTCTTGGGCTTTTGATCCTAAGGACTAAACCTGGATTTATGGCTTTT
Xenopus_tropicalis|2950             GGCCTGCAGTTTCTTTTGGGACTTCTAATTTTAAGAACAAAGCCAGGATTTGATGCCTTT
Anolis_carolinensis|1480            GGACTGCAATTTGTCCTCGGACTAATAACATTAAGAACAAAAGTAGGATTTGATGCATTC
Gallus_gallus|22892                 GTAATGCAGTTTATTCTTGGGCTTCTTATCCTGAGGACAAAAGTAGGGTTTGATGTATTT
Taeniopygia_guttata|18881           GGAATGCAGTTTATCCTTGGTATTCTTATTCTGAGGACCAAAGTGGGTTTTGATGTATTT
Monodelphis_domestica|26362         GGATTACAATTTGTTTTTGGTGTTCTTATTCTAAGAACTACATATGGATTTGAAGCTTTC
Myotis_lucifugus|6147               GGGTTACAGTTTCTTCTTGGGCTCTTAATACTAAGGACTAAGCCTGGATATATAGCCTTT
Erinaceus_europaeus|9218            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Procavia_capensis|16587             GGGTTGCAGTTTCTCACT------CTATTAATTTCTAAGAAACCTGCTTTTGTC---TTT
Ornithorhynchus_anatinus|14328      ------------------------------------------------------------
Spermophilus_tridecemlineatus|15987 GGGTTACAATTTCTTCTTGGACTGTTCATTCTAAGGACTAATTCTGGATATATTGCTTTC
Dipodomys_ordii|1002                GGATTACAGTTTCTTCTTGGGCTCTTAATTCTAAGAACTAAACCTGGATTTATTGCTTTT
Tupaia_belangeri|9820               GGGTTACAGTTCCTTCTTGGGCTCTTAATCCTAAGAACTAACCCTGGATTTGTGGCTTTC
Pteropus_vampyrus|13310             GGGTTGCAGTTTCTTCTTGGGCTCTTAATACTAAGGACTGAGGCTGGATTTAAGGCTTTT
Sus_scrofa|2512                     GGGTTACAGTTTCTTCTTGGACTTTTGATACTAAGGACTAAACCTGGATTTATAGCTTTT
Bos_taurus|25488                    GGGTTACAGTTTCTTCTTGGCCTTTTGATACTAAGGACAGAACCTGGATTTATGGCTTTT
Sorex_araneus|14769                 GGGTTACAGTTTTTTCTTGGACTCTTGATTCTAAGGACAAACCCTGGATTTATGGCTTTT
Equus_caballus|15106                GGGTTACAGTTTCTTCTTGGGCTCTTAATACTAAGGACTGGCCCTGGACTTAGGGCTTCT
Equus_caballus|15108                GGGTTACAGTTTCTTCTTGGGCTCATAATACTAAGGACTGGCCCTGGACTTATGGCTTTT
Mus_musculus|11155                  GGACTACAGTTTCTTCTTGGGCTCTTAATTCTAAGAACTAGGCCTGGATTTGTTGCTTTT
Rattus_norvegicus|14768             GGACTGCAGTTTCTTCTTGGGCTCTTAATTCTAAGGACTAGGCCTGGATTTGTTGCTTTT
Loxodonta_africana|22574            GGGTTACAGTTTCTTATTGCACTCTTAATTCTAAGGACAGAACCCGGTTTTGTGGCCTTT
Canis_familiaris|612                GGGTTACAATTTCTTCTTGGGCTCTTAATCCTGAGGACTGATCCTGGATTTATGGCTTTT
Felis_catus|45683                   GGGTTACAGTTTCTTCTTGGGCTCTTAATCCTAAGGACTGAACCTGGATTTATGGCTTTC
Cavia_porcellus|2593                GGGTTACAGTTTCTTCTTGGTCTCCTAATCCTAAGGACTAAGCCTGGATTTATTGCTTTT
Ochotona_princeps|1261              GGATTGCAGTTTCTTCTTGGACTTTTGATTCTAAGAACCAAACCTGGATATATAGCTTTT
Oryctolagus_cuniculus|21323         GGGCTACAGTTTCTTCTTGGGCTCTTAATTCTAAGGACCAAACCCGGATTTATAGCTTTC
Microcebus_murinus|10641            GGGTTACAGTTTCTTCTTGGACTCTTGATTCTAAGGACTGACCCTGGATTTATAGCTTTC
Callithrix_jacchus|43513            GGGTTACAGTTTCTTCTTGGGCTCTTGATTCTAAGGACTGACCCTGGATTTATAGCTTTT
Gorilla_gorilla|5611                GGGCTACAGTTTCTTCTTGGGCTCTTGATTCTAAGGACTGACCCTGGATTTATAGCTTTT
Rhesus_macaque|15650                GGGCTACAGTTTCTTCTTGGCCTCTTGATTCTAAGGACTGACCCTGGATATATAGCTTTT
Pongo_abelii|27761                  GGGCTACAGTTTCTTCTTGGGCTCTTGATTCTAAGGACTGACCCTGGATTTATAGCTTTT
Homo_sapiens|93736                  GGGCTACAGTTTCTTCTTGGGCTCTTGATTCTAAGGACTGACCCTGGATTTATAGCTTTT
Pan_troglodytes|37055               GGGCTACAGTTTCTTCTTGGGCTCTTGATTCTAAGGACTGACCCTGGATTTATAGCTTTT
Otolemur_garnettii|2666             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dasypus_novemcinctus|94             GGTTTACAGTTTCTTCTTGGGCTCTTAATTCTAAGGACCAAACCTGGATTTATGATGTTT
Oryzias_latipes|21673               GGACTACAGTTTATCTTTGGTCTGCTTACCCTTAGGACTGAGTTTGGTTTACAAGCATTA
Tetraodon_nigroviridis|3766         TTGCTCCAGTTCCTCATCGCCCTGCTGATCTTCAGGACCTCATCCGGCGCCTCAGCCGTG
Fugu_rubripes|5460                  TTGATCCAGTTCATCATCGCCCTGCTTATCTTCAGAACCTCGACTGGCGACTCGGCCCTG
                                                                                                

Caenorhabditis_elegans|24820        CAAAAATTTGCTGAACTTATAGTTGGATTTCTGGAATTTGCACAAGTTGGAGCCAAGTTT
Macropus_eugenii|618                AATTGGCTGGGGAACCAAGTTCAGACTTTCTTGGAGTATACAGACACAGGAGCCACATTT
Nematostella_vectensis|19532        AACTTCTTTGGCAGGAACATTCAGGCCTTCCTAGATTTTACAAATGAAGGAGCCAAGTTT
Tarsius_syrichta|82                 NNNNNNNNNNNNNNNNNNNNNNNNACTTTTCTGGAGTACACGGATGCTGGTGCTTCATTT
Choloepus_hoffmanni|2733            GATTGGTTGGGCAGACAAGTTCAGACTTTCCTGGGGTTCACTGATGCTGGCGCTTCATTT
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  GATTGGTTGGGCAAACAAGTTCAGACATTCTTGGCGTATAGTGATGCTGGTGCTTCGTTC
Xenopus_tropicalis|2950             GATTGGCTTGGTATACAAGTACAGGTAAGTCTATGTGTTAACACAAGCAATATGGCTGTG
Anolis_carolinensis|1480            AATTGGCTTGGGGTACAAGTACAGACTTTTTTGGGATACACAGATGCGGGGTCCAAATTT
Gallus_gallus|22892                 AACTGGCTAGGCATTCAGATCCAGACTTTTCTGGAGTACTCTGACACAGGTGCTAAGTTT
Taeniopygia_guttata|18881           AACTGGCTAGGCATTCAGATCCAGACCTTTCTGGAGTACTCTGATGCAGGTGCCAAGTTT
Monodelphis_domestica|26362         AATTGGTTGGGGAAACAAGTACAGACTTTCTTGGGGTATGCTGACTCAGGAGCCAGATTT
Myotis_lucifugus|6147               GATTGGTTGGGCAAACAAGTTCAGACGTTCTTGGAGTTCACAAATGCCGGTGCTTCATTT
Erinaceus_europaeus|9218            NNNNNNNNNNNNNNNNNNNNNNNNACATTCCTGGAGTTCACTAATGCTGGTGCTTCGTTT
Procavia_capensis|16587             GATCTG---------CATCAAGTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|14328      ------------------------------------------------------------
Spermophilus_tridecemlineatus|15987 AATTGGTTGGGCACACAAGTTCAAATTTTTCTGGATTATACTGATGCTGGTGCTAGATTT
Dipodomys_ordii|1002                GATTGGTTGGGTAGACAAGTTCACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|9820               GACTGGTTGGGCAGGCAAGTTCAGACTTTTCTGGCTTACACTGATGCAGGGGCTGTATTT
Pteropus_vampyrus|13310             GATTGGTTGGGCAAACAAGTTCAGATTTTCTTGGAGTATACCAACGCTGGTGCTATATTT
Sus_scrofa|2512                     GATTGGTTGGGCAAACAAGTTCAGACGTTCTTGGAGTACACCGACGCTGGCGCTTTGTTT
Bos_taurus|25488                    GATTGGTTGGGCAAACAAGTTCAGACATTCCTGGGGTACAGTGATGCTGGTGCTTCATTC
Sorex_araneus|14769                 GATTGGTTGGGCACACAGGTCCAGACGTTCTTGGAGTATACTAATGCAGGCTCTTCTTTC
Equus_caballus|15106                CAGTGGTTGGGCAAACAAGTTCACACCTTCTTGGAGCACACTGACGCTGGTGCTTCCTTT
Equus_caballus|15108                CAGTGGTTGGGCAAACAAGTTCAGACCTTCCTGGAGCACACTGACGCTGGTGCTTCCTTT
Mus_musculus|11155                  GATTGGATGGGGAGACAAGTTCAGACTTTCCTGGGGTACACTGATACTGGAGCCAGGTTT
Rattus_norvegicus|14768             GATTGGATGGGGAAACAAGTTCAGACTTTTCTGGGGTACACTGACGCTGGAGCCCAGTTT
Loxodonta_africana|22574            GATTGGTTGGGCAAACAAGTTCAGACTTTCCTGGGGTACACTGACGTTGGCGCTTTGTTT
Canis_familiaris|612                GATTGGTTGGGCCAACAAGTTCAGACCTTCTTGGAATATACTAATGCTGGTGCAGAATTT
Felis_catus|45683                   GATTGGTTGGGTAAACAAGTTCAAACCTTCTTGGAGTATACTAATGCTGGGGCTGAATTT
Cavia_porcellus|2593                GATTGGCTGGGCAGACAAGTTCAGACTTTCCTGGGGTACACTGATGCTGGTGCTGTCTTT
Ochotona_princeps|1261              GATTGGTTGGGAGGACAAGTCCAGATCTTTCTGGAGTACAGTGATGCTGGTGCATCATTT
Oryctolagus_cuniculus|21323         GATTGGCTGGGAAAACAAGTTCAGACTTTTCTGGGGTACACTGATGCTGGCGCGTCGTTT
Microcebus_murinus|10641            AATTGGTTGGGCAAACAAGTTCAGACTTTTCTGGAGTACACTGATGCTGGTGCTTCATTT
Callithrix_jacchus|43513            GATTGGTTGGGCAGACAAGTTCAGACTTTTCTGGAGTACACAGATGCTGGCGCTTCATTC
Gorilla_gorilla|5611                GATTGGTTGGGCAGACAAGTTCAGACTTTTCTGGAGTACACAGATGCTGGTGCTTCATTT
Rhesus_macaque|15650                GATTGGTTGGGCAGGCAAGTTCAGACTTTTCTGGAGTACACAGATGCTGGTGCTTCATTT
Pongo_abelii|27761                  GATTGGTTGGGCAGACAAGTTCAGACTTTTCTGGAGTACACAGATGCTGGTGCTTCATTT
Homo_sapiens|93736                  GATTGGTTGGGCAGACAAGTTCAGACTTTTCTGGAGTACACAGATGCTGGTGCTTCATTT
Pan_troglodytes|37055               GATTGGTTGGGCAGACAAGTTCAGACTTTTCTGGAGTACACAGATGCTGGTGCTTCATTT
Otolemur_garnettii|2666             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dasypus_novemcinctus|94             GATTGGTTGGGCAGACAAGTTCAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Oryzias_latipes|21673               ACTTGGGTTGGAAACAAAGTAGAGATGTTTTTGTCATTCACAGATGTTGGATCACAATTT
Tetraodon_nigroviridis|3766         GAGTGGATTGCACAAAAAGTGGAGATTCTCTTCGGCTTCACAGATGTTGGGTCAAAGTTT
Fugu_rubripes|5460                  AAGTGGGCTGCAAACAAAGTCGAGATTCTCTTCGCCTTCGAAGATGTTGGGTCGAGGTTT
                                                                                                

Caenorhabditis_elegans|24820        GTATTCGGATTCATTGCTGGACCACCAAATATTTGTGATTTGGCGCCCGTCTTTATATTC
Macropus_eugenii|618                GTCTTTGGTGAG---AAGTACACAGACCATTTC------------------TTCGCTTTT
Nematostella_vectensis|19532        GTGTTTGGGGACCCGACGTATCTCGACCATTTC------------------TTCGCCTTC
Tarsius_syrichta|82                 GTCTTTGGTGAG---AAATATAAAGACCACTTC------------------TTTGCATTT
Choloepus_hoffmanni|2733            GTTTTTGGTGAG---AAATACACAGACCACTTC------------------TTTGCATTT
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  GTCTTTGGTGAG---AAATATACAGACCACTTT------------------TTTGCATTT
Xenopus_tropicalis|2950             TCTTATGGGTGG---TCACACATGCAGCATTCA------------------CACCATCTG
Anolis_carolinensis|1480            GTGTTCGGGGAA---AAATACACAGATCATTTC------------------TTTGCCTTC
Gallus_gallus|22892                 GTGTTCGGTGAC---AAATACACAGATCATTTC------------------TTTGCTTTT
Taeniopygia_guttata|18881           GTGTTTGGTGAC---AAATACACAGatcatttc------------------tttgctttt
Monodelphis_domestica|26362         GTCTTTGGCGAG---AAGTACACAGACCATTTC------------------TTTGCTTTT
Myotis_lucifugus|6147               GTCTTTGGTGAG---AAATACACAGACCACTTC------------------TTCGCATTC
Erinaceus_europaeus|9218            GTCTTTGGTGAG---AAATACACAGACCACTTC------------------TTTGCATTT
Procavia_capensis|16587             NNNNNNNNNNNN---NNNNNNNNNNNNNNNNNN------------------NNNNNNNNN
Ornithorhynchus_anatinus|14328      ------------------------------------------------------------
Spermophilus_tridecemlineatus|15987 GTCTTTGGTGAA---AAATACACAGACCACTTC------------------TTTGCATTT
Dipodomys_ordii|1002                NNNNNNNNNNNN---NNNNNNNNNNNNNNNNNN------------------NNNNNNNNN
Tupaia_belangeri|9820               GTCTTCGGTGAG---AAATACACGGACCACTTC------------------TTTGCATTT
Pteropus_vampyrus|13310             GTCTTTGGTGAG---AAATACACAGACCACCTC------------------TTCGCATTT
Sus_scrofa|2512                     GTCTTCGGCGAG---AAATATACAGACCATTTT------------------TTTGCATTT
Bos_taurus|25488                    GTCTTTGGTGAG---AAATATACAGACCACTTT------------------TTTGCATTC
Sorex_araneus|14769                 GTCTTTGGTGAG---AAATACACAGACCACTTC------------------TTCGCATTT
Equus_caballus|15106                GTCTTTGGCGAG---AACTACACAGACCACTAC------------------TTGGCATTT
Equus_caballus|15108                GTCTTTGGTGAG---AAATACACAGACCACTTC------------------TTTGCATTT
Mus_musculus|11155                  GTCTTTGGGGAA---AAGTATACAGACCACTTC------------------TTTGCATTT
Rattus_norvegicus|14768             GTCTTTGGAGAA---AAGTATACAGACCACTTC------------------TTTGCATTT
Loxodonta_africana|22574            GTCTTTGGTGAG---AAGTACACAGACCACTTC------------------TTTGCATTC
Canis_familiaris|612                GTCTTCGGTGAC---ACGTACGCAGACCACTTA------------------TTTGCATTT
Felis_catus|45683                   GTCTTTGGTGAG---ACATATGCAGACCACTTC------------------TTTGCATTT
Cavia_porcellus|2593                GTCTTTGGTGAG---AAATACACAGACCACTTC------------------TTTGCATTT
Ochotona_princeps|1261              GTCTTTGGTGAA---AAATACACTGACCACTTC------------------TTTGCATTT
Oryctolagus_cuniculus|21323         GTCTTTGGTGAG---AAATACACAGACCACTTC------------------TTTGCATTT
Microcebus_murinus|10641            GTCTTTGGTGAG---AAATACAAAGACCACTTC------------------TTTGCATTT
Callithrix_jacchus|43513            GTCTTTGGTGAG---AAATACAAAGACCACTTC------------------TTTGCATTT
Gorilla_gorilla|5611                GTCTTTGGTGAG---AAATACAAAGACCACTTC------------------TTTGCATTT
Rhesus_macaque|15650                GTGTTTGGTGAG---AAATACAAAGACCACTTC------------------TTTGCATTT
Pongo_abelii|27761                  GTCTTTGGTGAG---AAATACAAAGACCACTTC------------------TTTGCATTT
Homo_sapiens|93736                  GTCTTTGGTGAG---AAATACAAAGACCACTTC------------------TTTGCATTT
Pan_troglodytes|37055               GTCTTTGGTGAG---AAATACAAAGACCACTTC------------------TTTGCATTT
Otolemur_garnettii|2666             NNNNNNNNNNNN---NNNNNNNNNNNNNNNNNN------------------NNNNNNNNN
Dasypus_novemcinctus|94             NNNNNNNNNNNN---NNNNNNNNNNNNNNNNNN------------------NNNNNNNNN
Oryzias_latipes|21673               GTCTTTGGTGAC---AATTACACAGACCACTTT------------------TTTGTCTTC
Tetraodon_nigroviridis|3766         ATATTTGGCAAG---AAATACATCGACCATCCA------------------TTTGCCTTC
Fugu_rubripes|5460                  GTATTTGGCGAG---AAATTCACCGACCACCCA------------------TTTGTCTTC
                                                                                                

Caenorhabditis_elegans|24820        ACCTCACTTCAAACTCTCATCTACTTCTCAGCGGTTGTCGCATTGCTCTTCTATTTTGGA
Macropus_eugenii|618                AAGGTTTTGCCAATAGTGGTCTTCTTTAGCACTGTGATATCCATGCTCTACTACCTTGGC
Nematostella_vectensis|19532        AAGGTTCTCCCAGTCATAATCTTCTTCAGTTCTTTCATCTCTGTCTGTTATTACATCGGT
Tarsius_syrichta|82                 AAGATCCTGCCAATCGTGATTTTCTTCAGCACCGTGATGTCTATGCTCTACTACCTTGGA
Choloepus_hoffmanni|2733            AAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  AAGGTCCTGCCCATCGTGGTTTTTTTCAGCACTGTGATGTCCATGTTGTACTACCTCGGA
Xenopus_tropicalis|2950             CAGGTTCTACCAATTGTCATCTTCTTCAGCACAATTATGTCCATGCTTTATTACATGGGC
Anolis_carolinensis|1480            AAGGTGCTGCCTATAGTCATTTTCTTCAGCACAGTGATGTCTGTTCTATACCACGTTGGA
Gallus_gallus|22892                 AAGGTCCTGCCAATTGTGGTTTTCTTCAGCACAGTAATGTCTATGCTTTATCACATTGGA
Taeniopygia_guttata|18881           aagGTTTTGCCAATTGTGGTTTTCTTCAGTACGGTTATGTCTATGCTTTACCATGTTGGA
Monodelphis_domestica|26362         AAGGTCTTGCCAATAGTGGTCTTCTTCAGTACAGTGATATCCATGCTTTACTACCTTGGA
Myotis_lucifugus|6147               AAGATCCTGCCCATCGTGATCTTCTTCAGCACTGTCATGTCCATGCTCTACTACCTCGGA
Erinaceus_europaeus|9218            AAGGTGCTGCCCATTGTGGTTTTCTTCAGTACAGTCATGTCCATGCTCTACTACCTGGGG
Procavia_capensis|16587             NNNATCCTGCCAATTGTCGTCTTCTTCAGCACTGTCATGTCGATGCTTTACTACCTGGGA
Ornithorhynchus_anatinus|14328      ------------------------------------------------------------
Spermophilus_tridecemlineatus|15987 AAGGTCTTGCCAATTGTGGTTTTCTTCAGCACTGTGATGTCCATGTTATACTACATGGGA
Dipodomys_ordii|1002                NNNATCCTGCCCATTGTGGTTTTCTTCAGCACAGTGATGTCCATGCTGTATTACCTGGGA
Tupaia_belangeri|9820               CAGGTTCTGCCCATCGTGGTCTTCTTCAGCACCGTCATGTCCATGCTCTACTACCTGGGG
Pteropus_vampyrus|13310             AAGGTCCTGCCGATCGTGGTTTTCTTCAGCACTGTCACGTCCATGCTCTACTACCTTGGA
Sus_scrofa|2512                     AAGGTCCTGCCAATCGTGGTTTTCTTCAGCACTGTGATGTCCATGCTGTACTACCTCGGA
Bos_taurus|25488                    AAGGTCCTGCCCATTGTGATTTTCTTCAGCACTGTGATGTCCATGTTGTACTACCTCGGA
Sorex_araneus|14769                 AAGGTCCTGCCCATTGTGGTTTTCTTCAGCACTGTGATGTCGATGCTGTACTACCTGGGG
Equus_caballus|15106                AAGTTCCTGCCAATGGTGGTTTTCTTCAGTGCCGTCACGTCCATGCTATACTACCTTGGA
Equus_caballus|15108                AAGGTCCTGCCAATCGTGGTTTTCTTCAGCGCCGCCATCAACTGTCAGTCCTACAGTGAC
Mus_musculus|11155                  AAGATCCTGCCCATCGTGGTTTTCTTCAGCACCGTGATGTCTATGCTTTACTATCTGGGG
Rattus_norvegicus|14768             AAGATCCTTCCCATTGTGGTTTTCTTCAGCACCGTGATGTCTATGCTCTATTATCTGGGA
Loxodonta_africana|22574            AAGATCCTGCCAATCGTGGTTTTCTTCAGCACTGTCATGTCCATGCTCTACTACCTCAGA
Canis_familiaris|612                AAGGTCCTGCCAATCGTGGTTTTCTTCAGCACCGTAATGTCCATGCTTTACTACCTTGGA
Felis_catus|45683                   AAGGTCCTGCCAATCGTGGTTTTCTTCAGCACGGTCATGTCCATGCTCTACTACCTCGGG
Cavia_porcellus|2593                AAGATCCTGCCCATTGTGGTTTTCTTCAGCACTGTGATGTCCATGCTGTACTTCCTGGGA
Ochotona_princeps|1261              AAGGTTCTGCCCATTGTGGGTTTCTTTAGCACCGTGATGTCCATGTTTTACTACCTGGGA
Oryctolagus_cuniculus|21323         AAGGTCCTGCCGATTGTGGTTTTCTTCAGCACTGTGATGTCCATGCTGTATTACCTGGGG
Microcebus_murinus|10641            AAGGTCTTGCCAATCGTGGTTTTCTTCAGCACCGTGATGTCCATGCTGTACTACCTCGGG
Callithrix_jacchus|43513            AAGGTCCTGCCGATCGTGGTTTTCTTCAGCACTGTGATGTCCATGCTGTACTACCTAGGA
Gorilla_gorilla|5611                AAGGTCCTGCCGATCGTGGTTTTCTTCAGCACTGTGATGTCCATGCTGTACTACCTGGGA
Rhesus_macaque|15650                AAGATCCTGCCGATCGTGGTTTTCTTCAGCACGGTGATGTCCATGCTGTACTACCTGGGA
Pongo_abelii|27761                  AAGGTCCTGCCGATCGTGGTTTTCTTCAGCACTGTGATGTCCATGCTGTATTACCTGGGA
Homo_sapiens|93736                  AAGGTCCTGCCGATCGTGGTTTTCTTCAGCACTGTGATGTCCATGCTGTACTACCTGGGA
Pan_troglodytes|37055               AAGGTCCTGCCGATCGTGGTTTTCTTCAGCACTGTGATGTCCATGCTGTACCACCTGGGA
Otolemur_garnettii|2666             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dasypus_novemcinctus|94             NNNGTCCTGCCGATTGTCGTTTTCTTCAGCACTGTAATGTCGATGCTGTACTACCTTGGA
Oryzias_latipes|21673               AGGGTGATGCCCATATTGGTTTTTCTGAGCTCTGTCATTTCCATCCTTTACTATGTTGGC
Tetraodon_nigroviridis|3766         AAGGTGATGcctgttttactttttttgagTTCTATTGTCTCGGTTCTCTACTACGTCGGC
Fugu_rubripes|5460                  AAGGTGATGCCTGTGTTACtttttttAAGTTCCATTATCTCGGTCCTCTACTACATCGGC
                                                                                                

Caenorhabditis_elegans|24820        ATTATT---CAAGTCGTACTACAAAAGAGCCAATGGTTCATGAAAGTGCTCATTGGCACG
Macropus_eugenii|618                TTCATG---CAGTGGCTCATTAGAAAGGTTGGATGGTTAATGCAGGTTACCCTGGGATCA
Nematostella_vectensis|19532        ATCATG---CAAGTCATCATCAAGAAACTGGCATGGCTTATGCAGGTTACCATGGGAACG
Tarsius_syrichta|82                 CTGATG---CAGTGGGTTATTAGAAAGGTTGGATGGCTCATGTTTGTTACTATGGGATCA
Choloepus_hoffmanni|2733            NNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  CTGATG---CAGTGGATCGTTAGAAAGGTTGGATGGATAATGCTAGTGACTATGGGAACA
Xenopus_tropicalis|2950             TTCATG---CAATGGCTCATAAAAAAGGTTGGATGGTTTATGCAGAAAACAATGGGAACA
Anolis_carolinensis|1480            TTCATG---CAATGgcttattaaaaagGTTGGATGGATAATGCAAATTACCTTAGGGACA
Gallus_gallus|22892                 TTCATG---CAGTGGCTCGTTGGAAAGGTTGGATGGATAATGCAAATTTTTATGGGGACA
Taeniopygia_guttata|18881           TTCATG---CAGTGGCTTGTTGGAAAGgTTGGTTGGATAATGCATGTCTTCATGGGAACA
Monodelphis_domestica|26362         TTCATG---CAGTGGCTGATTAGAAAGGTTGGATGGTTAATGCTAGTTACCCTGGGATCA
Myotis_lucifugus|6147               CTGATG---CAGTGGATCGTTAGAAAGGTTGGATGGATAATGCTAGTTACTATGGGATCA
Erinaceus_europaeus|9218            CTGATG---CAGTGGGTCATCAGAAAGGTTGGCTGGGTCATGCTAGTTACTATGGGATCA
Procavia_capensis|16587             TGGATG---CAGTGGATCATTAAAAAGATTGGATGGCTAATGCTAGTTACTATGGGAACA
Ornithorhynchus_anatinus|14328      ------------------------------------------------------------
Spermophilus_tridecemlineatus|15987 TTGATG---CAGTGGATCATCAGAAAGGTCGGATGGATAATGCTTGTTACTATGGGCTCA
Dipodomys_ordii|1002                TTCATG---CAGTGGATCGTCAGAAAGGTCGGATGGGTAATGCTAGTTACTCTGGGCTCA
Tupaia_belangeri|9820               CTGATG---CAGTGGATCATCAGGAAGGTCGGATGGCTAATGCTTATTACTATGGGATCA
Pteropus_vampyrus|13310             TTGATG---CAATGGATCATTAGAAAGATTGGATGGATAATGCTAGTTACTATGGGATCA
Sus_scrofa|2512                     TTGATG---CAGTGGGTCGTTAGAAAGGTGGGATGGGTAATGCTAGTGACTATGGGAACA
Bos_taurus|25488                    TTGATG---CAGTGGATCATTAGAAAGGTTGGATGGGTAATGCTAGTGACTATGGGAACA
Sorex_araneus|14769                 TTGATG---CAATGGGTCATTAGGAAGGTTGGGTGGCTAATGCTTGTTACTATGGGGTCA
Equus_caballus|15106                CTGATG---CAGTGGATCATTAGAAAGATTGGATGGCTCATGCTGGTTACTATGGGATCA
Equus_caballus|15108                ATGTTAGACCAGAAATCTATGAAATGTGTTGGATGGCTCATGCTGGTTACTGTGGGATCA
Mus_musculus|11155                  CTGATG---CAGTGGATCATCAGAAAGGTCGGGTGGCTAATGCTTGTCACGATGGGGTCA
Rattus_norvegicus|14768             CTGATG---CAGTGGATTATCAGAAAGGTTGGGTGGCTAATGCTTGTCACTATGGGGTCA
Loxodonta_africana|22574            CTGATG---CAGTGGGTCATTCGAAAGATTGGATGGCTAATGCTAGTTACTATGGGAACA
Canis_familiaris|612                TTGATG---CAGTGGATCATTAGAAAGGTTGGATGGGTAATGTTAGTTACTATGGGATCA
Felis_catus|45683                   TTGATG---CAGTGGATCATCAGAAAGGTTGGATGGGTAATGCTAGTTACTATGGGATCA
Cavia_porcellus|2593                TTAATG---CAGTGGCTCATTAGAAAGGTTGGATGGACAATGCTTGTTACTATGGGGTCA
Ochotona_princeps|1261              CTGATG---CAGTGGATCATCAGAAAGATTGGATGGGTAATGCTGGTTACCATAGGATCA
Oryctolagus_cuniculus|21323         CTCATG---CAATGGGTCATCAGAAAGGTCGGATGGGTAATGCTGGTTACCATGGGCTCA
Microcebus_murinus|10641            CTGATG---CAGTGGATTATTAGAAAG---------------------------------
Callithrix_jacchus|43513            CTGATG---CAGTGGATTATTAGAAAGGTTGGATGGATCATGCTAGTTACTACGGGATCA
Gorilla_gorilla|5611                CTGATG---CAGTGGATTATTAGAAAGGTTGGATGGATCATGCTAGTTACTATGGGATCA
Rhesus_macaque|15650                CTGATG---CAGTGGATTATTAGAAAGGTTGGATGGATCATGCTAGTTACTACAGGATCA
Pongo_abelii|27761                  CTGATG---CAGTGGATTATTAGAAAGGTTGGATGGATCATGCTAGTTACTACGGGATCA
Homo_sapiens|93736                  CTGATG---CAGTGGATTATTAGAAAGGTTGGATGGATCATGCTAGTTACTACGGGATCA
Pan_troglodytes|37055               CTGATG---CAGTGGATTATTAGAAAGGTTGGATGGATCATGCTAGTTACTACGGGATCA
Otolemur_garnettii|2666             NNNNNN---NNNNNNNNNNNNNNNNNNATTGGATGGGTAATGCTAGTTACTATGGGATCA
Dasypus_novemcinctus|94             CTGATG---CAATGGGTCGTTAGAAAGGTTGGATGGTTAATGCTAGTTACAATGGGATCA
Oryzias_latipes|21673               TTCATG---TCTTGGCTGATTTGCAAGATTGGATTTGTGATGCAGGTTACCATGGGAACG
Tetraodon_nigroviridis|3766         TTTATG---CCCTGGCTCATCTGCAAGATTGGCTACGCAATGCAAATTGTCATGGGAACA
Fugu_rubripes|5460                  TTCATG---CCCTGGCTCATCTGCAAGATTGGCTACGCAATGCAGGTTACCATGGGAACA
                                                                                                

Caenorhabditis_elegans|24820        ACGCCAGTGGAATCTGTAAATGCGTGGGCGTGCACCTTCCTTGGAATGTCTGAAGCGCCA
Macropus_eugenii|618                TCTCCTATTGAATCTGTAGTTACTGCTGGCAACATATTTGTGGGACAGNNNNNNNNNNNN
Nematostella_vectensis|19532        AGTGCTGTTGAGTCTCTGAATGCAGCTGGAAACATCTTTGTGGGCCAGACGGAGGCGCCA
Tarsius_syrichta|82                 TCTCCTATTGAATCTATCGTTGCTTCTGGCAATATATTTGTCGGACAANNNNNNNNNNNN
Choloepus_hoffmanni|2733            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  TCTCCTGTTGAATCTGTAGTTGCTTCTGGCAATATATTTGTCGGGCAGNNNNNNNNNNNN
Xenopus_tropicalis|2950             TCTCCAACAGAGTCACTTGTTGCAGCTGGAAACATATTTGTTGGTCAGACAGAATCTCCT
Anolis_carolinensis|1480            ACCCCTGTTGAATCCTTAGTTGCAGCCGGCAATATATTTGTGGGACAGTCAGAATCTCCA
Gallus_gallus|22892                 ACTCCCGTTGAGTCTCTTGTAGCTGCTGGTAACATATTTGTGGGACAGACAGAGTCTCCT
Taeniopygia_guttata|18881           ACTCCTGTTGAGTCTCTGGTAGCTGCGGGTAACATATTTGTGGGACAGACAGAGTCTCCT
Monodelphis_domestica|26362         TCTCCGATTGAATCTGTGGTTGCTGCTGGTAACATATTTGTGGGACAGACCGAGTCTCCG
Myotis_lucifugus|6147               TCTCCTATTGAATCTGTAGTTGCTGCTGGCAATATATTTGTCGGACAGTCAGAGTCCCCA
Erinaceus_europaeus|9218            TCTCCAATCGAATCTGTAGTTGCTGCTGGTAATATATTCATTGGACAGACAGAATCTCCA
Procavia_capensis|16587             TCTCCTATTGAATCTGTAGTTGCTTCTGGCAATATATTTGTTGGACAGACCGAGTCTCCA
Ornithorhynchus_anatinus|14328      ------------------------------------------------------------
Spermophilus_tridecemlineatus|15987 TCTCCTGTTGAGTCTCTAGTTGCTGCTGGCAATATATTTGTTGGACAAACAGACTCTCCA
Dipodomys_ordii|1002                TCTCCTATAGAATCTGTAGTTGCTGCTGGTAATATATTTGTTGGACAAACAGAGTCTCCA
Tupaia_belangeri|9820               TCTCCTATCGAATCTGTAGTTGCTGCTGGCAATATATTTGTAGGACAAACAGAATCTCCA
Pteropus_vampyrus|13310             TCTCCTGTTGAATCTGTGGTTGCTGCCGGCAATATATTTGTTGGACAGTCCGAGTCTCCA
Sus_scrofa|2512                     TCTCCTACTGAATCTGTAGTTGCTTCTGGCAATATATTTATTGGACAGACAGAGTCTCCA
Bos_taurus|25488                    TCTCCTGTTGAATCTGTAGTAGCTTCTGGCAATATATTTATTGGACAAACCGAGTCTCCT
Sorex_araneus|14769                 TCCCCAGTTGAGTCTGTTGTTGCAGCTGGCAATATATTCATTGGACAGACAGAATCTCCA
Equus_caballus|15106                TCTCCTGTTGAATCTGTAGTTGCTGCTGGCAATATATTCGTCGGATATACGGAGTCTCCA
Equus_caballus|15108                TCTCCTATTGAATCTGTGGTTGCTGCTGGCAATATATTCATCGGGCAAACGGAGTCTCCA
Mus_musculus|11155                  TCTCCCATTGAGTCTGTAGTTGCTGCTGGCAACATATTTATTGGGCAAACAGAGTCTCCA
Rattus_norvegicus|14768             TCTCCCATTGAGTCCGTAGTTGCTGCTGGCAACATATTTGTTGGGCAAACAGAGTCTCCA
Loxodonta_africana|22574            TCTCCTGTTGAATCTGTAGTTGCTTCTGGCAATGTATTTGTTGGACAGACAGAGTCTCCA
Canis_familiaris|612                TCTCCTATTGAATCTGTAGTGGCTGCTGGCAATATATTCGTTGGACAGACAGAGTCTCCA
Felis_catus|45683                   TCTCCTATTGAATCTGTAGTTGCCGCTGGCAACATATTTGTTGGACAGACGGAGTCTCCA
Cavia_porcellus|2593                TCTCCTATTGAGTCTGTAGTTGCTGCTGGCAATATATTTGTTGGACAAACAGAGTCTCCT
Ochotona_princeps|1261              TCTCCTATTGAATCTGTGGTTGCTTCTGGCAATATATTTGTTGGACAAACAGAGTCTCCA
Oryctolagus_cuniculus|21323         TCTCCTATTGAATCTGTAGTTGCTTCTGGCAATATATTTGTTGGACAAACAGAGTCTCCA
Microcebus_murinus|10641            ------------------------------------------------ACAGAGTCTCCG
Callithrix_jacchus|43513            TCTCCTATTGAATCTGTAGTTGCTTCTGGCAATATATTTGTTGGACAAACAGAGTCTCCA
Gorilla_gorilla|5611                TCTCCTATTGAATCTGTAGTTGCTTCTGGCAATATATTTGTTGGACAAACGGAGTCTCCA
Rhesus_macaque|15650                TCTCCTATTGAATCTGTAGTTGCTTCTGGCAATATATTTGTTGGACAAACGGAGTCTCCA
Pongo_abelii|27761                  TCTCCTATTGAATCTGTAGTTGCTTCTGGCAACATATTTGTTGGACAAACGGAGTCTCCA
Homo_sapiens|93736                  TCTCCTATTGAATCTGTAGTTGCTTCTGGCAATATATTTGTTGGACAAACGGAGTCTCCA
Pan_troglodytes|37055               TCTCCTATTGAATCTGTAGTTGCTTCTGGCAATATATTTGTTGGACAAACAGAGTCTCCA
Otolemur_garnettii|2666             TCTCCTATTGAATCTGTAGTTGCTTCTGGCAATGTGTTTGTTGGACAANNNNNNNNNNNN
Dasypus_novemcinctus|94             TCTCCTATTGAATCTGTGGTTGCTGCTGGCAATATATTTATTGGACAGNNNNNNNNNNNN
Oryzias_latipes|21673               TCTCCAACAGAGTCAATGGCCGCAGCTGGAAACATATTTCTGGGGCTGACGGACTCGCCT
Tetraodon_nigroviridis|3766         ACGTCAGTGGAATCGGTGGTGGCAGCTGGAACTATATTTCTAGGGCAGaCGGAGTCTCTG
Fugu_rubripes|5460                  ACGCCGGTGGAATCAGTGGTTGCAGCTGGAACTATATTTCTGGGCCAGGCGGAGTCTCTG
                                                                                                

Caenorhabditis_elegans|24820        TTGATGGTGGCTCCCTACATCGAGAAGCTCACAGATTCGGAAATTTTTGCGATAGTTACC
Macropus_eugenii|618                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Nematostella_vectensis|19532        CTGCTTGTACGCCCATTCTTAAGCCATGTTACCATGTCCGAACTCCATGCTATTATGACC
Tarsius_syrichta|82                 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|2733            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Xenopus_tropicalis|2950             CTTTTGATCAGACCATATTTAGAACTTCTAACAAGGTCTGAAATCCATGCGATTATGACG
Anolis_carolinensis|1480            CTTTTAGTGAAACCCTATTTGCCGTATGTTACAAAGTCAGAACTCCATGCCATCATGACA
Gallus_gallus|22892                 CTCCTGGTACGGCCATACTTACCATACATCACCAAATCTGAACTCCACGCAGTCATGACA
Taeniopygia_guttata|18881           CTCCTGGTACGGCCCTACTTACCATATATCACCAAATCTGAACTCCATGCAGTCATGACA
Monodelphis_domestica|26362         CTTCTGGTCCGACCCTATTTATCACATCTCACCAAGTCTGAGCTCCATGCAGTCATGACT
Myotis_lucifugus|6147               CTGCTGGTCCGACCGTACTTACCATACATCACCAAGTCCGAACTCCACGCAATTATGACC
Erinaceus_europaeus|9218            CTGCTCGTGCGGCCGTATTTACCATACGTCACCAAGTCTGAACTCCATGCAATCATGACT
Procavia_capensis|16587             CTGCTGGTTCGACCATATCTACCGTATGTCACCAAGTCCGAGCTCCATGCAATCATGACT
Ornithorhynchus_anatinus|14328      ------------------------------------------------------------
Spermophilus_tridecemlineatus|15987 CTGCTGGTCCGACCATATTTACCATATATCACCAGGTCAGAACTCCATGCCATCATGACT
Dipodomys_ordii|1002                CTATTGGTCCGACCATATCTACCACACGTGACCAAGTCAGAACTCCATGCCGTCATGACG
Tupaia_belangeri|9820               CTACTGGTTCGACCATACTTACCTCACGTCACCAAGTCAGAACTCCATGCCATCATGACA
Pteropus_vampyrus|13310             CTGCTGGTCCGACCGTATTTACCCTACATCACCAGATCCGAACTCCACGCGATCATGACC
Sus_scrofa|2512                     CTGCTGGTCCGACCATATTTACCCTATGTCACCAGGTCTGAACTCCACGCAGTCATGACT
Bos_taurus|25488                    CTGCTGGTCCGACCGTATTTACCATACGTCACCAAGTCTGAACTCCACGCGATCATGACC
Sorex_araneus|14769                 CTTATGGTCCGACCGTATTTACCACATATCACCAAGTCTGAACTTCATGCGATCATGACT
Equus_caballus|15106                CTGCTGGTCCAACCGTATATACAACATGCCACCAGGTCTGAACTCCATGCAATCATGACT
Equus_caballus|15108                CTGCTGGTCCGGCCGTATTTACCACACGTCACCAGGTCCGAACTGCATGCAATCATGACT
Mus_musculus|11155                  CTACTGGTCCAACCATATTTACCACACGTCACCAAGTCGGAACTCCATACCATCATGACA
Rattus_norvegicus|14768             CTACTGGTTCAACCATATCTACCACACGTCACCAAGTCAGAACTGCACACCATCATGACA
Loxodonta_africana|22574            CTGCTGGTTCGGCCATATCTACCATACGTCACCAAGTCCGAGCTCCATGCAATGATGACT
Canis_familiaris|612                CTGCTGGTCCGACCGTACTTACCACACATCACCAAGTCTGAACTCCATGCAATCATGACA
Felis_catus|45683                   CTGCTGGTCCGACCCTACTTACCACACATCACCAAGTCTGAACTCCATGCAGTCATGACC
Cavia_porcellus|2593                CTGCTGGTCCAGCCATATTTACCATATGTCACCCGATCAGAACTCCACGCCATTATGACA
Ochotona_princeps|1261              CTGCTGGTCCGCCCGTATTTACCCTACATCACCAAGTCCGAACTCCACGCCATCATGACC
Oryctolagus_cuniculus|21323         CTGCTGGTCCGCCCGTATCTACCGCACGTCACCAGGTCTGAACTGCACGCCATCATGACT
Microcebus_murinus|10641            CTGCTGGTTCGACCATATCTGCCACATGTCACCAGGTCCGAACTCCACGCCATCATGACA
Callithrix_jacchus|43513            CTGCTGGTCCGACCATATTTACCATACATCACCAAGTCTGAACTCCACGCCATTATGACC
Gorilla_gorilla|5611                CTGCTGGTCCGACCATATTTACCTTACATCACCAAGTCTGAACTCCACGCCATCATGACC
Rhesus_macaque|15650                CTGCTGGTCCGACCATATTTACCCTACATCACCAAGTCTGAACTCCACGCCATCATGACC
Pongo_abelii|27761                  CTGCTGGTCCGACCATATTTACCTTACATCACCAAGTCTGAACTCCACGCCATCATGACT
Homo_sapiens|93736                  CTGCTGGTCCGACCATATTTACCTTACATCACCAAGTCTGAACTCCACGCCATCATGACC
Pan_troglodytes|37055               CTGCTGGTCCGACCATATTTACCTTACATCACCAAGTCTGAACTCCACGCCATCATGACC
Otolemur_garnettii|2666             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dasypus_novemcinctus|94             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Oryzias_latipes|21673               CTCCTGATTCGCCCGTATATCAGTGAACTGACTGTCTCAGAGATTCATGCTGTGATGACT
Tetraodon_nigroviridis|3766         ATTCTGGTCCGGCCGTATATCAGCAAGTTAACGCTCTCAGAGATCCACGCGTTAATTACA
Fugu_rubripes|5460                  ATTCTGGTCCATCCGTACATCAGCAGGTTAACGCTCTCAGAGATCCACACGTTGATGACA
                                                                                                

Caenorhabditis_elegans|24820        AGTGGATTCGCTTGTGTTGCTGGAACTGTATTCACAGCGTATGTTGCTCTTGGAGCATGC
Macropus_eugenii|618                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Nematostella_vectensis|19532        GGTGGCTTTGCTACTATTGCGGGCGGTGTGTTGGCGGCGTATATCGAGTTTGGCGTTTCT
Tarsius_syrichta|82                 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|2733            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATCTCA
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTTCA
Xenopus_tropicalis|2950             GCAGGCTTTGCTACAATTGCAGGAAGTGTATTAGGTGCCTATATCTCATTTGGGGTTTCT
Anolis_carolinensis|1480            GCGGGGTTTGCCACCATCGCTGGAAGTGTCTTAGGAGCATATATTTCCTTTGGGGTTTCA
Gallus_gallus|22892                 GCAGGATTCTCAACCATTGCTGGAAGTGTCTTAGGAGCATATATTTCTTTTGGGGTTTCT
Taeniopygia_guttata|18881           GCAGGATTCTCAACTATAGCTGGAAGTGTCTTAGGAGCATATATTTCTTTTGGGGTTTCC
Monodelphis_domestica|26362         GCAGGATTTGCAACCATTGCTGGAAGTGTCTTGGGTGCATATATTTCTTTTGGAGTTTCA
Myotis_lucifugus|6147               GCCGGGTACGCTACCATTGCCGGAAGTGTCTTGGGCGCATACATTTCTTTCGGGGTTTCA
Erinaceus_europaeus|9218            GCAGGCTTCGCTACCATTGCTGGAAGTGTCCTAGGTGCATACATTTCCTTTGGGGTCTCA
Procavia_capensis|16587             GCCGGGTTCTCCACCATTGCTGGAAGTGTATTAGGCGCATACATTTCTTTTGGGGTTTCG
Ornithorhynchus_anatinus|14328      ---------------------------------------------GAATTCCAGGTTCCA
Spermophilus_tridecemlineatus|15987 GCTGGCTTCGCTACAATTGCTGGAAGCGTCTTGGGTGCATATATTTCTTTTGGANNNNNN
Dipodomys_ordii|1002                GCTGGCTTCGCCACAATAGCTGGAAGTGTCTTGGGTGCATATATCTCTTTTGGGGTGTCA
Tupaia_belangeri|9820               GCCGGGTTCTCTACAATTGCTGGAAGCGTCCTAGGTGCATACATATCTTTTGGGGTTTCA
Pteropus_vampyrus|13310             GCTGGGTTCTCTACCATTGCTGGAAGTGTCTTAGGCGCATACATTTCTTTTGGGGTTTCA
Sus_scrofa|2512                     ACTGGGTTCGCTACCATTGCCGGAAGCGTCTTAGGTGCATACATTTCTTTTGGGATTTCA
Bos_taurus|25488                    GCTGGGTTCTCTACCATTGCTGGAAGTGTCTTAGGTGCATACATCTCTTTTGGGGTTTCA
Sorex_araneus|14769                 GCCGGGTTCTCAACCATTGCTGGAAGCGTCTTAGGCGCATACATTTCTTTTGGGGTCTCC
Equus_caballus|15106                GCTGGGTTCGCTACCATCGCTGGAAATGTCTTAGGCCCATACATTTCTTTTGGGATTTCA
Equus_caballus|15108                GCTGGGTTCTCTACCATCGCTGGAAGTGTCTTAGGCGCATACATTTCTTTTGGGATTTCA
Mus_musculus|11155                  GCTGGCTTTGCCACGATTGCTGGAAGTGTATTGGGCGCATATATCTCTTTTGGGGTGTCG
Rattus_norvegicus|14768             GCTGGTTTTGCCACGATTGCTGGGAGCGTGTTGGGCGCGTACATCTCTTTTGGGGTGTCA
Loxodonta_africana|22574            GCTGGGTTTGCCACCATTGCTGGAAGCGTCTTAGGCGCATACATTTCTTTTGGGGTTTCG
Canis_familiaris|612                GCTGGGTTCTCCACCATTGCTGGAAGTGTCTTGGGTGCATACATTTCTTTTGGGGTTTCA
Felis_catus|45683                   GCTGGGTTCTCTACCATTGCTGGAAGTGTGTTAGGTGCATACATTTCTTTCGGGGTTTCA
Cavia_porcellus|2593                GCTGGCTTCGCTACAATTGCTGGAAGTGTCCTGGGCGCGTACATCTCTTTTGGGGTGTCA
Ochotona_princeps|1261              GCTGGCTTCTCCACAATTGCAGGAAGCGTCTTAGGCGCGTACATCTCTTTTGGGATTCCC
Oryctolagus_cuniculus|21323         GCTGGCTTCTCCACCATCGCAGGAAGTGTCCTAGGCGCGTACATTTCTTTCGGGATTCCT
Microcebus_murinus|10641            GCCGGCTTCTCTACAATCGCTGGAAGCGTCTTAGGCGCATACATCTCTTTTGGGATTCCG
Callithrix_jacchus|43513            GCTGGGTTCTCTACAATTGCTGGAAGCGTCTTAGGTGCATACATTTCTTTTGGGGTTCCA
Gorilla_gorilla|5611                GCCGGGTTCTCTACCATTGCTGGAAGCGTCCTAGGTGCATACATTTCTTTTGGGGTTCCA
Rhesus_macaque|15650                GCCGGGTTCTCTACAATTGCTGGAAGCGTCTTAGGTGCATACATTTCTTTTGGGGTTCCG
Pongo_abelii|27761                  GCTGGGTTCTCTACCATTGCTGGAAGCGTCCTAGGTGCATACATTTCTTTTGGGGTTCCA
Homo_sapiens|93736                  GCCGGGTTCTCTACCATTGCTGGAAGCGTGCTAGGTGCATACATTTCTTTTGGGGTTCCA
Pan_troglodytes|37055               GCCGGGTTCTCTACCATTGCTGGAAGCGTCCTAGGTGCATACATTTCTTTTGGGGTTCCA
Otolemur_garnettii|2666             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTCCA
Dasypus_novemcinctus|94             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCTCA
Oryzias_latipes|21673               GGAGGCTTTGCCAGCATCTCCGGCACCATTTTGGGAGCTTATATCTCATTGGGGGTTGAT
Tetraodon_nigroviridis|3766         GTGGGCTTGGCTGGCATCTCTGGGACCATGTTTGCTGCGTACATCGCCCTCGGGGTTAAA
Fugu_rubripes|5460                  GTAGGCTTGGCTGGCATCTCCGGCACCATGCTTGCAGCGTACATCTCCCTCGGGGTGAAG
                                                                                                

Caenorhabditis_elegans|24820        CCAATTTACTTGCTCACTGCAAGTTTGTTG---TCGGCTCCAATGAGCTTGGCCTGCTCG
Macropus_eugenii|618                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNN
Nematostella_vectensis|19532        GCTTCTCACCTGCTGAGTGCATCGGTAATG---TCTGCTCCTGCTGCGCTAGCCATCTCC
Tarsius_syrichta|82                 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|2733            GCTTCCCACTTGTTAACCGCCTCAGTTATG---TCAGCACCTGCATCCCTGGCTATTGCT
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  TCCTCTCACTTGTTAACTGCGTCCGTCATG---TCAGCACCTGCGGCGTTGGCTATTTCT
Xenopus_tropicalis|2950             TCTTCACATTTACTAACTGCTTCTGTGATG---TCTGCCCCAGCTGCACTGGCTGTATCC
Anolis_carolinensis|1480            GCCACCCACTTATTAACTGCTTCTGTGATG---TCAGCTCCAGCAGCTTTGGCTATTGCC
Gallus_gallus|22892                 GCCTCCCACCTACTGACTGCTTCTGTCATG---TCTGCACCAGCATCATTAGCAACCTCC
Taeniopygia_guttata|18881           TCCTCCCACCTGCTGACTGCTTCTGTTATG---TCAGCACCAGCATCATTAGCTGCCTCC
Monodelphis_domestica|26362         GCCTCACATTTGTTAACTGCTTCGGTGATG---TCTGCCCCCGCCTCTCTGGCTTGTGCT
Myotis_lucifugus|6147               CCCACCCATCTGTTGACAGCTTCAGTTATG---TCAGCACCTGCATCACTGGCT---GCT
Erinaceus_europaeus|9218            TCCTCCCACTTGCTAACTGCTTCAGTTATG---TCAGCACCTGCAGCACTGGCTGTTGCT
Procavia_capensis|16587             CCCTCTCACTTGCTAAGTGCTTCTGTTATG---TCAGCACCCGCATCCCTGGCTGTTGCT
Ornithorhynchus_anatinus|14328      GCCTCACATTTGTTAACTGCTTCAGTAATG---TCTGCCCCTGCATCGCTGGCAATTGCT
Spermophilus_tridecemlineatus|15987 NNNNCCCACTTATTAACAGCTTCAGTTATG---TCAGCACCTGCATCATTGGCTGTTGCT
Dipodomys_ordii|1002                TCTACCCACTTGTTGACAGCCTCAGTCATG---TCAGCACCTGCGTCACTGGCTGTTGCC
Tupaia_belangeri|9820               TCCTCCCACTTGCTCACAGCTTCAGTTATG---TCAGCCCCTGCATCGTTGGCTGTTGCT
Pteropus_vampyrus|13310             TCCACCCACTTGTTAACTGCATCAGTTATG---TCAGCACCCGCATCACTGGCTGTTGCT
Sus_scrofa|2512                     TCCTCTCACTTGATAACTTCTTCAGTTATG---GCAGCACCTGCAGCACTGGCTATTTCT
Bos_taurus|25488                    TCCTCTCACTTGTTAACTGCTTCAGTTATG---TCTGCACCTGCGGCATTGGCTATTTCT
Sorex_araneus|14769                 TCCTCTCACTTGTTAACTGCTTCAGTTATG---TCTGCACCTGCCTCACTGGCTGTGGCT
Equus_caballus|15106                CCTGCCCACTTATTAACTGCTTCAGTTATG---TCAGCGCCTGCGTCATTGGCTGTGGCT
Equus_caballus|15108                CCCACCCACTTATTAACTGCTTCAGTTATG---TCAGCGCCTGCGTCATTGGCTATGGCT
Mus_musculus|11155                  TCCACGCATTTGCTAACTGCCTCGGTCATG---TCCGCACCTGCAGCCCTGGCTGTGGCC
Rattus_norvegicus|14768             TCTACACACTTGCTCACCGCTTCTGTCATG---TCGGCGCCTGCAGCCCTGGCTGTGGCC
Loxodonta_africana|22574            TCCTCTCACTTGCTAACTGCTTCCGTTATG---TCAGCACCTGCATCACTGGCTATTGCT
Canis_familiaris|612                CCCTCCCACCTTTTAACTGCGTCAGTGATG---TCCGCACCTGCATCATTGGCTGTGGCT
Felis_catus|45683                   GCCTCCCACCTGTTAACTGCCTCAGTCATG---TCCGCACCTGCATCATTGGCTGTGGCT
Cavia_porcellus|2593                TCCACCCACCTGTTAACAGCATCAGTCATG---TCAGCACCTGCATCCCTGGCTGTTGCT
Ochotona_princeps|1261              TCAGCCCATTTGCTGACAGCCTCAGTGATG---TCAGCACCTGCATCGCTGGCTGTTGCT
Oryctolagus_cuniculus|21323         TCCACCCATTTGTTGACGGCTTCAGTCATG---TCAGCGCCTGCGTCATTGGCTGTAGCA
Microcebus_murinus|10641            TCCGCCCACTTGCTGACGGCCTCGGTTATG---TCGGCGCCGGCGTCGCTGGCGGCTGCC
Callithrix_jacchus|43513            TCCTCCCATTTGTTAACAGCGTCAGTTATG---TCGGCACCTGCTTCATTGGCTGCTGCT
Gorilla_gorilla|5611                TCCTCCCACTTGTTAACAGCATCAGTTATG---TCAGCACCTGCGTCATTGGCTGCTGCT
Rhesus_macaque|15650                TCCTCCCACTTGTTAACAGCCTCGGTTATG---TCGGCACCTGCGTCATTGGCTGCTGCT
Pongo_abelii|27761                  TCCTCCCACTTGTTAACAGCGTCAGTTATG---TCAGCACCTGCGTCATTGGCTGCTGCT
Homo_sapiens|93736                  TCCTCCCACTTGTTAACAGCGTCAGTTATG---TCAGCACCTGCGTCATTGGCTGCTGCT
Pan_troglodytes|37055               TCCTCCCACTTGTTAACAGCGTCAGTTATG---TCAGCACCTGCATCATTGGCTGCTGCT
Otolemur_garnettii|2666             TCCTCCCACTTGTTAACGGCTTCTGTTATAGTGCGAGCACCTGCATCACTGGCTGCTGCT
Dasypus_novemcinctus|94             TCCTCCCACTTGCTAACCGCCTCGGTTATG---TCAGCACCCGCGTCCCTGGCTGTTGCT
Oryzias_latipes|21673               GCAACACATTTGTTGACCGCATCTCTCATG---TCTGCTCCAGCCTCTTTGGCTATTGCC
Tetraodon_nigroviridis|3766         GCAGAACATGTGCTGACGTCGACGGTCATG---TCCGCTCCAGCTTCCCTGGCCATCGCT
Fugu_rubripes|5460                  GCAACATACGTGCTGACAGCAACAGTCATG---ACCGCTCCAGCCTCCCTGGCTGTTGGC
                                                                                                

Caenorhabditis_elegans|24820        AAGATTATGTTTCCAGAA------------------------------------------
Macropus_eugenii|618                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Nematostella_vectensis|19532        AAGCTGCTTTACCCAGAAACTGAGACACCGGAG---ACTATAGAAGAAGCCATTGACCTC
Tarsius_syrichta|82                 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|2733            AAACTCTTTTGGCCTGAGACAGAAACTCCTAAAATAACTGTCAAGAATGCCATGAAAATG
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  AAACTTTTTTGGCCCGAGACAGAAACACCTAAAATAACCCTCAAGAATGCCATGAAAATG
Xenopus_tropicalis|2950             AAGCTTTTTTGGCCAGAAACAGAACCTATAAAGGTCAACATGAAACATGGGATGAAACTA
Anolis_carolinensis|1480            AAGCTCTTTTGGCCTGAAACTGAGCAACCCCGAATAACCGTACAGCGGAGCACGAACCTC
Gallus_gallus|22892                 AAACTGTTCTGGCCTGAAACTGAAAAGCCTAAAGTAACTTTGAAGAGTGGCCTAAAAATG
Taeniopygia_guttata|18881           AAATTATTCTGGCCTGAAACTGAAAAGCCTCTGGTAACTCTGAGGAGTGGCATACAAATG
Monodelphis_domestica|26362         AAATTATTTTGGCCTGAGACTGAAATTCCTAAAATAACTCTCAAGACTGCCTTGAAAATG
Myotis_lucifugus|6147               AAACTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Erinaceus_europaeus|9218            AAACTCTTTTGGCCCGAGACCGAAACACCTAAAATAACCCTCAAGAATGCCATGAAGATG
Procavia_capensis|16587             AAACTCTTTTGGCCTGAGACAGAAACACCTAAAATAACCCTCAAGAATGCCATGAAAATG
Ornithorhynchus_anatinus|14328      AAGTTGTTTTGGCCTGAGACCAAGAAGCCTAAAATAATCTTCAAGGATTCCATGAAGATA
Spermophilus_tridecemlineatus|15987 AAACTATTTTGGCCTGAGACAGAAAAATCTAAAATAACCCTCAAGAATGCCATGAAAATG
Dipodomys_ordii|1002                AAACTCTTTTGGCCTGAGACTGAGAAACCCAAAATAACCCTCAAGAATGCCATGAAAATG
Tupaia_belangeri|9820               AAACTCTTTTGGCCTGAGACAGAAAAACCTAAAATAACCCTCAAAAATGCCATGGAAATG
Pteropus_vampyrus|13310             AAACTCTTTTGGCCTGAGACAGAAACACCTAAAATAACCCTCAAGAATGCCATGGAAATG
Sus_scrofa|2512                     AAACTTTTTTGGCCTGAGACAGAAAAACCTAAAATAACCCTCAAGAATGCCATGAAAATG
Bos_taurus|25488                    AAACTTTTTTGGCCTGAGACAGAAACACCTAAAATAAACCTCAAGAATGCCATGAAAATG
Sorex_araneus|14769                 AAACTCTTTTGGCCTGAGACAGAAAAACCTAAAATAACTCTCAAGAATGCCATGAAAATG
Equus_caballus|15106                AAACTCTTTTGGCCTGAGACAGAAACACCTAAAACAACCCTGAAGGATGCCATGAAAATG
Equus_caballus|15108                AAACTCCTTTGGCCTGAGACAGAAACACCTAAAATAACCCTGAAGAATGCCATGGAAATG
Mus_musculus|11155                  AAACTCTTTTGGCCTGAGACAGAGAAACCCAAAATAACCCTCAAGAGTGCCATGAAGATG
Rattus_norvegicus|14768             AAACTCTTTTGGCCTGAAACAGAGAAACCCAAAATAACCCTCAAGAATGCCATGAAAATG
Loxodonta_africana|22574            AAACTCTTTTGGCCTGAGACAGAAACACCTAAAATAACCCTCAAGAATGCCATGAAAATG
Canis_familiaris|612                AAACTCTTCTGGCCTGAGACAGAAACACCTAAAATAACCCTCAAGAATGCCATGAAAATG
Felis_catus|45683                   AAACTCTTTTGGCCTGAGAGAGAAACACCTAAAATAACCCTCCAGAACGCCATGAAAATG
Cavia_porcellus|2593                AAACTCTTCTGGCCTGAGACAGAGAAACCTAAAGTAACTCTTAAGAGTGCCATGAAGATG
Ochotona_princeps|1261              AAACTCTTTTGGCCTGAGACAGAAAAATCTAAAGTCACCCTCAAGAACGCCATGCAAATG
Oryctolagus_cuniculus|21323         AAACTCTTTTGGCCTGAGACAGAAAAGCCTAAAATAACCCTCAAGAATGCCATGAAAATG
Microcebus_murinus|10641            AAACTCTTTTGGCCTGAGACAGAAAAACCTAAAATAACCCTCAAGAATGCCATGAAAATG
Callithrix_jacchus|43513            AAACTCTTTTGGCCTGAGACAGAAAAACCTAAAATAACCCTCAAGAATGCCATGAAAATG
Gorilla_gorilla|5611                AAACTCTTTTGGCCTGAGACAGAAAAACCTAAAATAACCCTCAAGAATGCCATGAAAATG
Rhesus_macaque|15650                AAACTCTTTTGGCCTGAAACAGAAAAACCTAAAATAACCCTCAAGAATGCCATGAAAATG
Pongo_abelii|27761                  AAACTCTTTTGGCCTGAGACAGAAAAACCTAAAATAACCCTCAAGAATGCCATGAAAATG
Homo_sapiens|93736                  AAACTCTTTTGGCCTGAGACAGAAAAACCTAAAATAACCCTCAAGAATGCCATGAAAATG
Pan_troglodytes|37055               AAACTCTTTTGGCCTGAGACAGAAAAACCTAAAATAACCCTCAAGAATGCCATGAAAATG
Otolemur_garnettii|2666             AAACTCTTTTGGCCTGAGACAGAAAAACCTAAAATAACCCTCAAGAATGCCATGAAAATG
Dasypus_novemcinctus|94             AAACTCTTCTGGCCTGAAACAGAAACTCCTAAAATAACCCTCAAGAATGCCATGAAAATG
Oryzias_latipes|21673               AAGACATTCTGGCCTGAAAGAAACAAGACTGTTTTGATTTCTATCAAGGACCTCAAACTC
Tetraodon_nigroviridis|3766         AAGACTTTCTGGCCCGAAACCGAGACCTCTAGTGTCAAGGACGAAAGCGGCATCAAAATA
Fugu_rubripes|5460                  AAGATCTTCTGGCCTGAAACGGAGACCTCTCAAGTCAAAGATGAAGAGGACATCAAAACG
                                                                                                

Caenorhabditis_elegans|24820        ------------------------TTTTTCGACACTCTGTGCTCAGCAGGAGTTGCGTTG
Macropus_eugenii|618                NNNNNNNNG---GACTCAAGAAATATCCTGGAAGCAGCAAGCCATGGAGCCTCTTCTTCC
Nematostella_vectensis|19532        CCAGAAGGT---GGTGAACGTAATGTCATCGAAGCTGCAGCCAAGGGCGCCAGTACAGCC
Tarsius_syrichta|82                 NNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|2733            GAAAATGGT---GATTCAAGAAATCTCCTAGAAGCTGCAACGCAGGGAGCGTCTTCATCC
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  GAAAGTGGT---GATTCAAGGAATCTCCTAGAAGCCGCAACGCAGGGAGCATCCTCATCC
Xenopus_tropicalis|2950             GAGAAAGGG---GAAGCTAGAAATATATTAGAAGCTGCAAGTCAAGGTGCCTCTGCTTCG
Anolis_carolinensis|1480            GGGAAAGGG---GATTCCCAAAATCTGTTGGAAGCAGCCAGCCAAGGTGCCTCTTCCTCC
Gallus_gallus|22892                 GCAAAGGGT---GAATCAAATAACCTGCTGGAGGCAGCCAGTCAAGGTGCATCCAGCTCT
Taeniopygia_guttata|18881           GCAAAAAGT---GAATCAAAGAATCTGCTGGAAGCAGCCAGTCAGGGTGCTTCTACCTCC
Monodelphis_domestica|26362         GAAAAAGGG---GACTCAAGAAATCTCCTGGAAGCAGCAAGCCATGGAGCCTCCTCTTCC
Myotis_lucifugus|6147               NNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Erinaceus_europaeus|9218            GAAAATGGT---GATTCCAGGAACCTCCTAGAAGCTGCATCTCAGGGTGCATCCTCATCC
Procavia_capensis|16587             GAAAATGGN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|14328      GAGAAAGGG---GACGCGATCAACCTCCTGGAAGCAGCCAGTCAGGGCGCCTCCTCTTCT
Spermophilus_tridecemlineatus|15987 GAAATTGGT---GATTCAAGGAATCTCCTAGAAGCTGCAACACAGGGAGCATCCTCATCT
Dipodomys_ordii|1002                GAAAATGGT---GACTCCAGGAACCTCCTAGAAGCTGCAACGCAGGGAGCGTCCTCATCC
Tupaia_belangeri|9820               GAAAATGGA---GATTCAAGGAATCTCCTAGAAGCTGCAACGCAGGGAGCGTCCTCCTCC
Pteropus_vampyrus|13310             GAAAATGGT---GATTCGAGGAATCTCCTAGAAGCTGCAACACAGGGAGCGTCCTCATCC
Sus_scrofa|2512                     GAAAATGGT---GATTCAAGGAATCTCCTCGAAGCTGCAACTAATGGAGCATCCTCATCC
Bos_taurus|25488                    GAAAGTGGT---GATTCAAGGAATCTCCTAGAAGCTGCAACACAGGGAGCATCCTCATCC
Sorex_araneus|14769                 GAACATGGT---GACTCTAGGAATATTCTTGAAGCAGCTTCCCAAGGAGCATCATCATCC
Equus_caballus|15106                GAAATGGGT---GATTCGAGGAATCTCCTAGAAGCTGCATCATATGGAACATCGTCATCC
Equus_caballus|15108                GAAATGGGT---GATTCAAGGAATCTCCTAGAAGCAGCATCACAGGGAGCATCCGCATCC
Mus_musculus|11155                  GAAAATGGT---GATTCAAGGAATCTCCTGGAGGCAGCCTCTCAGGGCGCATCCTCGTCC
Rattus_norvegicus|14768             GAAAATGGT---GATTCCCGGAATCTCCTGGAGGCGGCCACGCAGGGTGCATCTTCGTCC
Loxodonta_africana|22574            GAAAGTGGT---GAGTCGAGAAATCTCCTGGAAGCAGCGACACAGGGCGCATCCTCATCC
Canis_familiaris|612                GAAACTGGT---GATTCAAGGAACCTCCTAGAAGCCGCAACACAGGGAGCATCCTCATCC
Felis_catus|45683                   GAAAGTGGT---GATTCAAGGAACCTCCTAGAAGCCGCAACGCAGGGAGCATCCTCATCC
Cavia_porcellus|2593                AAAAATGGC---GATTCAAGGAATCTCCTAGAAGCTGCAACACAGGGAGCCTCCTCCTCA
Ochotona_princeps|1261              CAAAGTGGT---GATTCGAGGAATCTGTTGGAAGCTGCAACCCAGGGAGCATCCTCATCC
Oryctolagus_cuniculus|21323         GAACATGGAAGCGATTCGAGGAACCTGCTGGAAGCTGCGACCCAGGGAGCATCCTCCTCC
Microcebus_murinus|10641            GAAAATGGT---GATTCAAGGAATCTCCTAGAAGCTGCGACACAGGGAGCGTCCTCGTCC
Callithrix_jacchus|43513            GAAAGTGGC---GATTCAGGGAATCTTCTAGAAGCTGCATCGCAGGGAGCATCCTCCTCC
Gorilla_gorilla|5611                GAAAGTGGT---GATTCAGGGAATCTTCTAGAAGCTGCAACACAGGGAGCATCCTCCTCC
Rhesus_macaque|15650                GAAAGTGGC---GATTCAGGGAATCTTCTAGAAGCTGCAACACAAGGAGCTTCCTCCTCC
Pongo_abelii|27761                  GAAAGTGGT---GATTCAGGGAATCTTCTAGAAGCTGCAACACAGGGAGCATCCTCCTCC
Homo_sapiens|93736                  GAAAGTGGT---GATTCAGGGAATCTTCTAGAAGCTGCAACACAGGGAGCATCCTCCTCC
Pan_troglodytes|37055               GAAAGTGGT---GATTCAGGGAATCTTCTAGAAGCTGCAACACAGGGAGCATCCTCCTCC
Otolemur_garnettii|2666             GAAAGTGGT---GACTCGAGGAATCTCCTAGAAGCTGCGACGCAGGGAGCATCCTCGTCT
Dasypus_novemcinctus|94             GAAAATCGG---GATTCAAGGAACCTGCTGGAAGCCGCATCACAGGGAGCATCCTCATCT
Oryzias_latipes|21673               ATTAATGGA---GAGAACAAAAACTTGTTAGAAGCAGCGTCTCAAGGTGCATCTCGTACT
Tetraodon_nigroviridis|3766         CCCGTAGAT---GACAACACCAATGTGTTTGAGGCGGCCTCCAGGGGGGCAACTTCGGCT
Fugu_rubripes|5460                  AACATAGAG---ACCAACACCACTGTGTTTGAGGCAGCATCCACCGGTGCGACCTCTGCT
                                                                                                

Caenorhabditis_elegans|24820        GTCCCTACGGTTTTTGCAATTGGTGCAACGTTGGTGGTTATCATGTCACTTTTAGCATTT
Macropus_eugenii|618                ATTTCTTTGGTGGCAAACATCGCGGTGAACATGATCGCCTTCTTGGCTCTCCTGGCTTTT
Nematostella_vectensis|19532        ATCGCCCTGGTAGCTAATGTTGCTGCAAACCTGATTGCCTTTTTGGCCTTCCTGGCATTC
Tarsius_syrichta|82                 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|2733            ATTGGCCTGGTGGCAAACATCGCTGTGAATCTGATTGCCTTCCTGGCTCTGCTGTCTTTT
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  ATTGCCCTGGTGGCGAACATCGCTGTGAACCTGATTGCCTTCCTGGCCCTGCTGTCCTTT
Xenopus_tropicalis|2950             ATTCCTTTGGTAGCCAACATTGCGGTGAACTTGATGGCGTTTCTGTCGCTACTGGCTTTC
Anolis_carolinensis|1480            ATCTTCCTGGTGGCAAACATCGCTGCGACTCTGATTGCTTTCCTTGCTGTGTTGGCTTTC
Gallus_gallus|22892                 ATCCTGTTGGTGGCAAACATCGCTGTGAATCTCATCTCATTCCTTGCCCTGCTGGCTTTC
Taeniopygia_guttata|18881           ATCGGGCTGGTAGCAAACATTGCTGTGAATGTGATCTCCTTCCTTGCCCTGCTAAGCTTC
Monodelphis_domestica|26362         GTCTCCCTGGTGGCAAACATCACTGTGAACATGATTTCCTTCCTGGCCCTCCTGGCTTTT
Myotis_lucifugus|6147               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Erinaceus_europaeus|9218            ATCTCCCTGGTGGCAAACATCGCTGCCAATCTGATTGCTTTCCTGGCCCTGTTGTCGTTT
Procavia_capensis|16587             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|14328      ATCTCCCTGGTGGCGAACATCACAGTAAACCTGATTGCATTCCTGTCCCTGTTGGCTTTC
Spermophilus_tridecemlineatus|15987 ATCCCTCTGGTGGCAAACATCACTGTGAATCTGATTGCCTTCTTGGCCCTGTTGTCTTTT
Dipodomys_ordii|1002                ATCCCTCTGGTGGCAAACATCGCTGTCAATCTGATTGCCTTCCTGGCCCTCTTGTCTTTC
Tupaia_belangeri|9820               ATCTCGCTGGTGGCAAACATCGCTGTGAATCTGATTGCCTTCCTGGCCCTGTTGTCTTTT
Pteropus_vampyrus|13310             ATCTCTCTGGTGGCAAATATCGCTGTA---CTGATTGCCTTCATTGCCTTATTATCTTTT
Sus_scrofa|2512                     ATTTCCCTGGTGGCAAATATCGCTGTGAATCTGATTGCCTTCCTGGCCCTGTTGTCTTTT
Bos_taurus|25488                    ATTTCCCTGGTGGCGAACATTGCCGTGAATTTGATTGCCTTCCTAGCTCTGCTGTCTTTT
Sorex_araneus|14769                 ATCTCCTTGGTGGCAAACATCGCTGTGAATCTGATCGCCTTCCTGGCCCTGTTGTCATTT
Equus_caballus|15106                ATCTCCCTGGTGGCAAACATCGCTGTGAATATGATTGCCTTCCTGGCCCTGTTGTCTTTT
Equus_caballus|15108                ATCTCCCTGGTGGCAAACATCGCTGTGAATCTGATTGCCTTCCTGGCCCTGTTGTCTTTT
Mus_musculus|11155                  ATCCCTCTGGTGGCAAACATTGCTGCGAATCTGATCGCCTTCCTGGCCTTGCTCTCCTTT
Rattus_norvegicus|14768             ATCCCCCTGGTGGCAAACATCGCTGCAAATCTGATCGCCTTCCTGGCCTTGCTTTCCTTT
Loxodonta_africana|22574            ATCTCCCTGGTGGCAAATATCGCCGTGAACCTGATCGCCTTCCTGGCCCTGTTGTCTTTT
Canis_familiaris|612                ATCTCCCTTGTGGCAAATATAGCTGTGAATCTGATTGCCTTCCTGGCCCTGTTGTCTTTT
Felis_catus|45683                   ATCTCCCTAGTGGCAAACATAGCTGTGAACTTGATTGCCTTCCTGGCCCTGTTGTCTTTT
Cavia_porcellus|2593                ATCCCTCTGGTGGCGAGCATCGCTGCGAATCTCATCGCCTTCCTGGCCCTGTTGTCCTTT
Ochotona_princeps|1261              ATCTCTCTGGTGGCCAACATCACCGTGAATCTCATCGCCTTCCTGGCCCTGCTGTCTTTC
Oryctolagus_cuniculus|21323         ATCGCTCTGGTGGCCAACATCACTGTGAATCTGATTGCCTTCCTGGCCCTGCTGTCTTTT
Microcebus_murinus|10641            ATCCCTCTGGTGGCAAACATCGCTGTGAATCTGATTGCCTTCCTGGCCCTGTTGTCTTTT
Callithrix_jacchus|43513            ATCTCTCTGGTGGCCAACATCGCTGTGAATCTGATCGCCTTCCTGGCCCTGCTGTCTTTT
Gorilla_gorilla|5611                ATCTCCCTGGTGGCCAACATCGCTGTGAATCTGATTGCCTTCCTGGCCCTGCTGTCTTTT
Rhesus_macaque|15650                ATCTCCCTGGTGGCCAACATTGCTGTGAATTTGATTGCCTTCCTGGCCCTGCTGTCTTTT
Pongo_abelii|27761                  ATCTCCCTGGTGGCCAACATCGCTGTGAATCTGATTGCCTTTCTGGCCCTGCTGTCTTTT
Homo_sapiens|93736                  ATCTCCCTGGTGGCCAACATCGCTGTGAATCTGATTGCCTTCCTGGCCCTGCTGTCTTTT
Pan_troglodytes|37055               ATCTCCCTGGTGGCCAACATCGCTGTGAATCTGATTGCCTTCCTGGCCCTGCTGTCTTTT
Otolemur_garnettii|2666             ATTGTTCTGGTGGCGAACATCGCTGTGAATCTGATTGCCTTCCTGGCCCTGTTGTCTTTT
Dasypus_novemcinctus|94             ATCGGCCTGGTGGCAAACATCGCTGTGAATCTGATTGCCTTCCTGGCTCTGTTGTCTTTT
Oryzias_latipes|21673               GTTCGTTTGGTAGGGAGCATCATAACAAACATCATTGCCTTCCTGGCACTGCTGGCCTTT
Tetraodon_nigroviridis|3766         GTGGGCCTCGTGGTAACCATTGTCGTGAACCTCATGGTCTTCATATCCCTGATGACCTTC
Fugu_rubripes|5460                  GTGGGCCTGGCGGTAACCATTGTGGTCAACCTCATGGTCTTCATATCCTTGATGTCTTTC
                                                                                                

Caenorhabditis_elegans|24820        TTGGATGCAGTTATGGAGTATATCGGAGACCTCATTGGGTACGATGGTTGGACATTTCAA
Macropus_eugenii|618                ATGAATTCTGCCCTTTCCTGGTTAGGGAACATGTTTGACTACCCACAACTGAATTTTGAG
Nematostella_vectensis|19532        TTTAATGCCATGCTTTCCTGGCTTGGCTCCATGGTTGGACACCCTGAGCTAAGCTTTGAG
Tarsius_syrichta|82                 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|2733            GTCAATTCAGCCCTGTCCTGGTTTGGCAGCATGTTTGACTACCCACAGCTGAGTTTTGAG
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  GTGAATTCAGCCCTGTCCTGGTTTGGAAACATGTTTGACTACCCACAACTGAGTTTTGAG
Xenopus_tropicalis|2950             TTCAATGCAGCTCTTTCATGGCTGGGCAATATGTTTGACTACCCACAGCTGAGCTTTGAG
Anolis_carolinensis|1480            TGTAATGCAGCCTTGTCATGGCTGGGGAACATGTTTGACTATCCGCAGCTCGACTTTGAG
Gallus_gallus|22892                 ATCGATTCAGCCCTCTCTTGGGTGGGCAATCTGTTTGACTATCCACAGCTCAATTTTGAG
Taeniopygia_guttata|18881           CTCGACTCAGCCCTTTCTTGGGTGGGCAACTTGTTTGACTATCCACAGCTGACCTTTGAG
Monodelphis_domestica|26362         GTGGATTCATCCCTTTCCTGGCTAGGGAACATGTTCGACTATCCTGAGCTGAGTTTTGAG
Myotis_lucifugus|6147               NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Erinaceus_europaeus|9218            GTGAATTCAGCCCTGTCCTGGTTTGGAAACATGTTTGACTACCCACAACTGAGTTTTGAG
Procavia_capensis|16587             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|14328      GTAGACTCTGCACTCTCCTGGCTGGGGAACATGTACAACTATCCCCAGCTGAGTTTTAAG
Spermophilus_tridecemlineatus|15987 ATGAATTCAGCCCTGTCCTGGTTTGGAAACATGTTTGACTACCCACAGCTGAGTTTCGAG
Dipodomys_ordii|1002                ATGAATTCAGCCCTGTCCTGGTTTGGAAACATGTTTGACTACCCACAGCTGAGTTTTGAG
Tupaia_belangeri|9820               GTGAATTCAGCCCTGTCCTGGTTTGGAAACATGTTTGACTACCCACAACTGAGTTTTGAG
Pteropus_vampyrus|13310             ATGAATTCAGCCCTGTCCTGGTTCGGAAACATGCTTGACTACCCACAACTGAGTTTTGAG
Sus_scrofa|2512                     GTGAATTCAGCCCTGTCCTGGTTTGGAAACATGTTTGACTACCCACAGCTGAGTTTTGAG
Bos_taurus|25488                    ATGAATTCAGCCCTGTCCTGGTTGGGAAACATGTTTGACTACCCACAACTGAGTTTTGAG
Sorex_araneus|14769                 GTGAACTCAGCTCTATCCTGGTTTGGAAACATGTTTGACTACCCACAACTGAGCTTTGAG
Equus_caballus|15106                GTCAATGCAGCTCTGTCCTGGTTTGGAAACATGTTTGACTATCCACAACTGAGTTTTGAG
Equus_caballus|15108                GCGAATGCAGCCCTGTCCTGGTTTGGAAACATGTTTGACTACCCACAGCTGAGTTTCGAG
Mus_musculus|11155                  GTGAACTCTGCCCTGTCTTGGTTTGGAAGCATGTTCAACTACCCAGAGCTGAGTTTTGAG
Rattus_norvegicus|14768             GTGAACTCCGCTCTGTCTTGGTTTGGAAGCATGTTCGACTACCCACAGCTGAGTTTCGAG
Loxodonta_africana|22574            CTGAATTCAGCCCTGTCCTGGTTTGGAAACATGTTTGACTACCCGCAGCTGAGTTTTGAG
Canis_familiaris|612                GTGAATGCAGCCTTGTCCTGGCTTGGAAACATGTTTGACTACCCACAACTAAGTTTTGAG
Felis_catus|45683                   TTGAATGCAGCCCTGTCCTGGTTTGGAAACATGTTTGACTACCCACAACTGAGTTTTGAG
Cavia_porcellus|2593                GTGAATTCAGCGCTGTCCTGGCTCGGAAACATGTTTGACTACCCACAGCTCAGTTTTGAG
Ochotona_princeps|1261              GTGAACTCAGCCCTGTCCTGGTTTGGAAGCATGTTCGACTACCCACAGCTGAGTTTTGAG
Oryctolagus_cuniculus|21323         GTGAACTCAGCCCTGTCCTGGTTTGGAAACATGTTTGACTACCCACAGCTGAGCTTCGAG
Microcebus_murinus|10641            GTGAACTCAGCCCTGTCCTGGTTTGGAAACATGTTTGACTACCCGCAGCTAAGTTTTGAG
Callithrix_jacchus|43513            ATGAATTCAGCCCTGTCCTGGTTCGGAAACATGTTTGATTACCCACAGCTGAGTTTTGAG
Gorilla_gorilla|5611                ATGAATTCAGCCCTGTCCTGGTTTGGAAACATGTTTGACTACCCACAGCTGAGTTTTGAG
Rhesus_macaque|15650                ATGAATTCAGCCTTGTCCTGGTTTGGAAATATGTTTGACTACCCACAGCTGAGTTTTGAG
Pongo_abelii|27761                  ATGAATTCAGCCCTGTCCTGGTTTGGAAACATGTTTGACTACCCACAGCTGAGTTTTGAG
Homo_sapiens|93736                  ATGAATTCAGCCCTGTCCTGGTTTGGAAACATGTTTGACTACCCACAGCTGAGTTTTGAG
Pan_troglodytes|37055               ATGAATTCAGCCCTGTCCTGGTTTGGAAACATGTTTGACTACCCACAGCTGAGTTTTGAG
Otolemur_garnettii|2666             GTGAATTCTGCCCTGTCCTGGTTTGGAAACATGTTTGACTACCCGCAGCTGAGTTTTGAG
Dasypus_novemcinctus|94             GTAAATTCAGCCCTGTCCTGGTTTGGAAACATGCTTGGCTACCCACAACTGAGTTTTGAG
Oryzias_latipes|21673               TTAGACTGCATCCTTTCCTGGCTGGGTGGGTTGTTCGATTATCCTCAGCTCAGCTTCTCG
Tetraodon_nigroviridis|3766         CTCGACAGCATCCTCTCCTGGTTCGGATCACTGTTCGACTGTCCCCAGCTCAGCTTCGCG
Fugu_rubripes|5460                  CTCGATGGCGTTCTCTCCTGGTTTGGAGGATTGTTTGACTTCCCGCAGCTCAGCTTCTCG
                                                                                                

Caenorhabditis_elegans|24820        ATGCTGTTTGGTTACGCGTTCTTTCCATTGGCCTATATGATGGGTGTCAATGATAATTCA
Macropus_eugenii|618                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNNNNN
Nematostella_vectensis|19532        TTCATCTGTTCCTATGTCTTGCGTCCTGTTGCCTACTTGATGGGTGTT------CAGTGG
Tarsius_syrichta|82                 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNNNNN
Choloepus_hoffmanni|2733            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNNNNN
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  ATAATATGCTCCTACATCTTCATGCCCTTTTCCTTCATGATGGGAGTA------GACTGG
Xenopus_tropicalis|2950             GTAATATGTTCCTATGTCTTCATGCCATTTTCTTTCATGATGGGTGTG------GACTGG
Anolis_carolinensis|1480            ATAATTTGTGCCTATGTCTTCATGCCATTTTCTTTCATCATGGGAGTC------GACTGG
Gallus_gallus|22892                 AACATTTGTGCATATGTCTTTATGCCATTCTCCTTTATGATGGGAGTA------GACTGG
Taeniopygia_guttata|18881           AACATTTGTGCTTATGTCTTCATGCCATTCTCTTTCATGATGGGAGTA------GACTGG
Monodelphis_domestica|26362         GTGATTTGCTCCTATGTTTTCATGCCTTTTTCTTTCATGATGGGAGTT------GACTGG
Myotis_lucifugus|6147               CTAATATGCTCCTACATCTTCATGCCCTTCTCCTTCATGATGGGAGTG------GACTGG
Erinaceus_europaeus|9218            ATAATATGCTCCTACATCTTCATGCCCTTTTCCTTCATGATGGGAGTG------GACTGG
Procavia_capensis|16587             GTGCTGTGCTCATACATCTTCATGCCCTTTTCGTTCATGATGGGCATT------GACTGG
Ornithorhynchus_anatinus|14328      ATAATCTGTTCCTATGTCTTCATGCCCTTATCCTTTTTGATGGGGATT------GACTGG
Spermophilus_tridecemlineatus|15987 CTAATATGCTCCTACATCTTCATGCCCTTT---TTCATGATNNNNNNN------NNNTGG
Dipodomys_ordii|1002                CTCATCTGTTCCTACCTCTTCATGCCCTTTTCCTTCGTGATGGGAGTT------GACTGG
Tupaia_belangeri|9820               CTAATATGCTCCTACATCTTCATGCCCTTTTCCTTCATGATGGGAGTA------GACTGG
Pteropus_vampyrus|13310             CTAATATGCTCCTACATCTTCATGCCCTTTTCCTTCATGATGGGCGTG------GACTGG
Sus_scrofa|2512                     ATAATATGCTCCTATGTCTTCATGCCCTTTTCCTTCATGATGGGAGTA------GACTGG
Bos_taurus|25488                    GTAATATGCTCCTACGTCTTCATGCCCTTTGCCTTCATGATGGGAGTA------GACTGG
Sorex_araneus|14769                 ATAATATGCTCCTACATTTTTATGCCCTTTTCATTCATGATGGGAGTC------GACTGG
Equus_caballus|15106                CTAATATGTTCCTACATCTTCATGCCGTTTTCCTTCATGATGGGCGTA------GACTGG
Equus_caballus|15108                ATAATATGCTCCTACATCTTCATGCCCTTTTCCTTCATGATGGGAGTG------GACTGG
Mus_musculus|11155                  CTCATTTGTTCCTACATCTTCATGCCCTTCTCTTTCATGATGGGAGTC------GACTGG
Rattus_norvegicus|14768             CTCATTTGTTCTTACATCTTCATGCCTTTCTCCTTCATGATGGGAGTC------GACTGG
Loxodonta_africana|22574            ATAATATGCTCATACATCTTCATGCCCTTTTCATTCATGATGGGGGTT------GACTGG
Canis_familiaris|612                ATAATATGCTCCTATGTCTTCATGCCCCTTTCCTTCATGATGGGAGTG------GAATGG
Felis_catus|45683                   ATAATATGCTCCTACATCTTCATGCCCTTTTCCTTCATGATGGGAGTG------GACTGG
Cavia_porcellus|2593                CTGATATGCTCCTACATCTTCATGCCCTTTTCCTTCATGATGGGAGTG------GACTGG
Ochotona_princeps|1261              CTCATCTGCTCCTACATCTTCATGCCTTTTTCCTTCATGATGGGAGTA------GACTGG
Oryctolagus_cuniculus|21323         CTCATATGCTCCTACATCTTCATGCCTTTTTCCTTCATGATGGGAGTG------GACTGG
Microcebus_murinus|10641            TTAATATGCTCCTACATCTTCATGCCCTTCTCCTTCATGATGGGAGTG------GACTGG
Callithrix_jacchus|43513            CTAATCTGCTCCTACATCTTCATGCCCTTTTCCTTCATGATGGGAGTG------GAATGG
Gorilla_gorilla|5611                CTAATCTGCTCCTACATCTTCATGCCCTTTTCCTTCATGATGGGAGTG------GAATGG
Rhesus_macaque|15650                CTAATCTGCTCCTACATCTTCATGCCCTTTTCCTTCATAATGGGAGTG------GAATGG
Pongo_abelii|27761                  CTAATCTGCTCCTACATCTTCATGCCCTTTTCCTTCATGATGGGAGTG------GAATGG
Homo_sapiens|93736                  CTAATCTGCTCCTACATCTTCATGCCCTTTTCCTTCATGATGGGAGTG------GAATGG
Pan_troglodytes|37055               CTAATCTGCTCCTACATCTTCATGCCCTTTTCCTTCATGATGGGAATG------GAATGG
Otolemur_garnettii|2666             CTGATGTGCTCCTACATCTTCATGCCCCTGTCCTTCATGATGGGAGTG------GACTGG
Dasypus_novemcinctus|94             CTAATATGCTCCTACATCTTCATGCCCTTTTCGTTCATGATGGGAGTA------GACTGG
Oryzias_latipes|21673               CTCATCTGCTCCTATGTGTTCATGCCCTTGTCCTTCATGATGGGTGTT------TCCTGG
Tetraodon_nigroviridis|3766         CTTATTTTCTCCTATGTGTTCAGACCTCTAGCTTTCATGATGGGTGTC------TCCTGG
Fugu_rubripes|5460                  CTTATTTTCTCCTACTTGTTCATGCCTCTGGCCTTCATGATGGGCGTT------TCCTAT
                                                                                                

Caenorhabditis_elegans|24820        GATCAAACTTTATTAGTTGCACAGCTAATGGGTACCAAGACCGCGGTCAACGAATTTGTG
Macropus_eugenii|618                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Nematostella_vectensis|19532        AAAGATTGTGATGTGGTAGCAGAGCTTCTTGGCATCAAGACGTTCTTGAATGAGTTTGTT
Tarsius_syrichta|82                 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|2733            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  CAAGACAGCTTTATGGTTGCCAAACTCATAGGATATAAGACATTCTTCAATGAATTTGTG
Xenopus_tropicalis|2950             GAAGACAGTTTCATAGTTGGAAAACTTATTGGATACAAGACATTTTTCAATGAGTTTGTT
Anolis_carolinensis|1480            GAAGACAGTTTTATTGTCGGTGGACTTCTAGGTTATAAGACTTTCTTCAATGAATTTGTG
Gallus_gallus|22892                 GAAGACAGTTTTATTGTTGGTGGACTCCTAGGTTACAAAACTTTCTTCAATGAATTTGTG
Taeniopygia_guttata|18881           GAAGACAGTTTTATTGTTGGTGGACTGCTAGGTTACAAAACTTTCTTCAATGAATTTTTG
Monodelphis_domestica|26362         GAAGACAGCTTTATGGTTGGAGGACTAATAGGATATAAAACTTTCTTCAATGAATTCGTA
Myotis_lucifugus|6147               CAGGACAGCTTTATGGTTGCCAAACTCTTAGGTTATAAGACATTCTTCAATGAATTTGTG
Erinaceus_europaeus|9218            CAAGACAGCTTTATGATCGCCAAACTCATAGGTTACAAGACGTTCTTCAATGAATTTGTG
Procavia_capensis|16587             CAGGACAGCTTCCTGGTTGCCAAACTCATAGGCTATAAGACATTTTTCAATGAGTTTGTG
Ornithorhynchus_anatinus|14328      CAAGACAGTTTCATGGTTGGTGAGCTCCTCGGCTACAAGACTTTCTTCAATGAATTTGTA
Spermophilus_tridecemlineatus|15987 CAAGACAGCTTTATGGTTGGCAGACTCATAGGTTATAAGACATTCTTCAATGAATTTGTG
Dipodomys_ordii|1002                CAAGACAGCTTTATGCTTGCCAAGCTCCTTGGCTATAAGACATTCTTCAATGAATTTGTG
Tupaia_belangeri|9820               CAAGACAGCTTTATGGTTGCCAAACTCATAGGGTATAAGACATTCTTCAATGAATTTGTG
Pteropus_vampyrus|13310             CAAGATAGTTTTATGGTTGCCAAACTCATAGGTTATAAGACATTCTTCAATGAATTTGTG
Sus_scrofa|2512                     CAAGACACTTTTATGGTTGCCAAACTCATGGGTTATAAGACATTCTTCAACGAATTTGTG
Bos_taurus|25488                    CAAGATAGCTTTATGGTTGCCAAACTCATAGGTTATAAGACATTCTTCAATGAATTTGTG
Sorex_araneus|14769                 CATGACAGCTTTATGGTCGCTAAACTCATAGGTTATAAGACATTCTTCAATGAATTTGTG
Equus_caballus|15106                CAAGACAGTTTTATGGTTGCCAAACTCATAGGTTATAAGACATTCTTCACTGAATTTGTG
Equus_caballus|15108                CAAGACAGCTTTATGGTTGCCAAACTCATAGGTTATAAGACTTTCTTCAATGAATTTGTG
Mus_musculus|11155                  CAAGACAGCTTTATGGTCGCCAAACTCATAGGTTACAAGACATTCTTCAATGAATTTGTG
Rattus_norvegicus|14768             CAAGACAGCTTTATGGTCGCCAAACTCATAGGCTACAAGACGTTCTTCAATGAATTTGTG
Loxodonta_africana|22574            CAAGACAGCTTTATGGTTGCCAAACTGATAGGTTATAAGACATTCTTCAATGAATTTGTG
Canis_familiaris|612                CAAGACAGCTTCATGGTGGCCAAACTCATAGGCTATAAGACATTTTTCAATGAATTTGTC
Felis_catus|45683                   CAAGACAGCTTTATGGTTGCCAAGCTCATAGGCTATAAGACATTTTTCAATGAATTTGTG
Cavia_porcellus|2593                CAAGATAGCTTCATGGTTGCCAAGCTGATAGGTTATAAGACTTTCTTCAATGAATTTGTG
Ochotona_princeps|1261              CAAGACAGCTTCATGGTTGCCAAACTCATAGGCTATAAGACGTTCTTCAACGAGTTTGTG
Oryctolagus_cuniculus|21323         CAAGACAGCTTCATGGTTGCCAAGCTCATAGGCTATAAGACGTTCTTCAATGAGTTTGTG
Microcebus_murinus|10641            CAGGACAGCTTTATGGTTGCCAAACTCATAGGATACAAGACATTCTTCAATGAATTTGTG
Callithrix_jacchus|43513            CAGGACAGCTTTATGGTAGCCAGACTCATAGGTTATAAGACCTTCTTCAATGAATTTGTG
Gorilla_gorilla|5611                CAGGACAGCTTTATGGTTGCCAGACTCATAGGTTATAAGACCTTCTTCAATGAATTTGTG
Rhesus_macaque|15650                CAGGACAGCTTTATGGTTGCCAGACTCATAGGTTATAAGACCTTCTTCAATGAATTTGTG
Pongo_abelii|27761                  CAGGACAGCTTTATGGTTGCCAGGCTCATAGGTTATAAGACCTTCTTCAATGAATTTGTG
Homo_sapiens|93736                  CAGGACAGCTTTATGGTTGCCAGACTCATAGGTTATAAGACCTTCTTCAATGAATTTGTG
Pan_troglodytes|37055               CAGGACAGCTTTATGGTTGCCAGACTCATAGGTTATAAGACCTTCTTCAATGAATTTGTG
Otolemur_garnettii|2666             CAGGATAGCTTCTTGGTTGCCAAACTCATAGGTTATAAGACATTCTTCAATGAATTTGTG
Dasypus_novemcinctus|94             CAAGACAGCTTTATGGTTGGCAAACTCATAGGCTATAAGACATTCTTCAATGAATTTGTG
Oryzias_latipes|21673               GATGACAGCTTCCTTGTTGCTGAACTGATTGGGTTAAAGACATTCCTCAACGAGTTTGTG
Tetraodon_nigroviridis|3766         GAGGACAGCGGCCTTGTTGCTGAGCTGATTGGCACAAAGACGTTTCTGAACGAGTTATTA
Fugu_rubripes|5460                  GAGGACAGCTTCATTGTTGCTGAGCTGATCGGTATAAAGACAGTTCTGAATGAGTTATTA
                                                                                                

Caenorhabditis_elegans|24820        GCCTACAACAATTTGGGAATTTTACAAAAAGCAGGCAAG---------------------
Macropus_eugenii|618                NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Nematostella_vectensis|19532        GCTTACATCCGGTTGTCTGCTCTGATCAAGAACAGGACACATTTGCAACCAGGTCGCACA
Tarsius_syrichta|82                 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|2733            NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  GCTTATCAGCACCTCTCAAAATTGATCCATTTAAGGCAAGAGGCTGGACCCAAATTTGTG
Xenopus_tropicalis|2950             GCTTATGAATACCTTGCTGGATTGATTAATAAACGAAAGGAAAGCGGACCTATGTATATC
Anolis_carolinensis|1480            GCTTATGAACACCTATCTAAACTGATTCAGCTAAGGAAGAATGGAGGGGAAATGTACAGA
Gallus_gallus|22892                 GCTTATGAACGTCTCTCAAAACTGATCCACAATCGAGAAAAGGGTGGGAGCATGTACGTA
Taeniopygia_guttata|18881           GCTTATGAGCGCCTTTCAAAACTGATTCAAAACCGAGAAAAGGGCGGAAGCATGTACATT
Monodelphis_domestica|26362         GCCTTCCAACAACTTGCAAAAATGATCAAGTTACGAAAACTAGCTGGACCCAAATTTATA
Myotis_lucifugus|6147               GCTTATGAGCATCTCTCAAAATTGATCAATTTAAGGAAAGAGGCTGGACCCAAATTTGTG
Erinaceus_europaeus|9218            GCCTACGAGCACCTCTCAAAATTGATCAATTTAAGGAAAAAGGCTGGACCCAAATTTGTG
Procavia_capensis|16587             GCTTATGAGCACCTTTCAAAAATGATCAACTTGAGGAAACAAGTTGGACCCAAATTTGTC
Ornithorhynchus_anatinus|14328      GCTTATGAACATCTGTCCAAATTGATCAAGTTACGAAAGCAGGCCGGACCAAAGTTTATT
Spermophilus_tridecemlineatus|15987 GCTTATGAGCAACTCTCACAATTGATCAACTTGAGGAAACAGGGTGGACCTAAATTTGTG
Dipodomys_ordii|1002                GCTTATGAGCACCTCTCCAAATTGATCAATTTGAGGAAAGCAGCCGGACCCAAGTTTGTC
Tupaia_belangeri|9820               GCTTATGAGCAGCTCTCGAAATTTATCAATTTGAGGAAAGAAGCTGGACCCAAATTTGTG
Pteropus_vampyrus|13310             GCTTATGAGCACCTCTCAACATTGATCAATTTAAGGAAAGAAGCTGGACCCAAATTTGTA
Sus_scrofa|2512                     GCTTATCAGAAACTCTCGGAATTGATCCATTTAAGGCAAGCAGGTGGACCCAAATTTGTG
Bos_taurus|25488                    GCTTATCAGCAACTCTCAAAGTTGATCTCTTTAAGGCAAGTGGGTGGACCCAAATTTGTG
Sorex_araneus|14769                 GCATATGAGCACCTCTCAAAACTGATCAATTTAAGAAAAAAGGCTGGACCCAAATTTGTG
Equus_caballus|15106                GCCTATGAGCGCCTCTCAAAATTGGTGGATTTAAGGAAAGAGGCTGGACCCAAATTTGTG
Equus_caballus|15108                GCTTATGAGCACCTCTCAAAATTGGTGCATTTAAGGAAAGAGGCTGGACCCAAATTTGTG
Mus_musculus|11155                  GCTTATGACCACCTCTCAAAATTAATCAATTTGAGGAAAGCGGCTGGACCTAAATTTGTG
Rattus_norvegicus|14768             GCTTATGAACACCTCTCAAAATTCATCAATTTGAGGAAAGCGGCTGGACCCAAATTTGTG
Loxodonta_africana|22574            GCTTATGAGCACCTCTCAAAATTAATCAACTTGAGGAAAGAAGCTGGACCCAAATTTGTC
Canis_familiaris|612                GCTTATGAACACCTCTCAAAATTGATCAGTTTAAGAAAGGAGGCCGGACCCCAATTTGTG
Felis_catus|45683                   GCTTATGAACACCTCTCAAAATTGATCAACTTAAGAAAAGAGGCTGGACCCAAATTTGTG
Cavia_porcellus|2593                GCTTATGAACACCTTTCCAAACTGATCAGTTTGAGGAAAGAGGCTGGACCCAAATTTGTG
Ochotona_princeps|1261              GCCTATGAGCACCTCTCCAGACTGATCAATTTGAGGAAAGAGGCAGGACCCAAATTTGTG
Oryctolagus_cuniculus|21323         GCTTACGAGCACCTCTCCAGATTGATCAGTTTGAGAAAAGAGGCTGGACCTAAATTTGTG
Microcebus_murinus|10641            GCTTATGAGCACCTCTCAAAATTGATCGATTTGAGGAAAGAGGCTGGACCCAGATTTGTG
Callithrix_jacchus|43513            GCTTACGAGCACCTCTCAGAATGGATCCACTTGAGGAAAGAAGGTGGACCCAAATTTCTG
Gorilla_gorilla|5611                GCTTATGAGCACCTCTCAAAATGGATCCACTTGAGGAAAGAAGGTGGACCCAAATTTGTA
Rhesus_macaque|15650                GCTTACGAGCACCTCTCAAAATGGATCCACTTGAGGAAAGAAGGTGGACCCAAATTTGTG
Pongo_abelii|27761                  GCTTATGAGCACCTCTCAAAATGGATCTACTTGAGGAAAGAAGGTGGACCCAAATTTGTA
Homo_sapiens|93736                  GCTTATGAGCACCTCTCAAAATGGATCCACTTGAGGAAAGAAGGTGGACCCAAATTTGTA
Pan_troglodytes|37055               GCTTATGAGCACCTCTCAAAATGGATCCACTTGAGGAAAGAAGGTGGACCCAAATTTGTA
Otolemur_garnettii|2666             GCCTATGAGCACCTCTCAAAATTGATCAATTTGAGGAAAGAGGCTGGACCCAAATTTGTG
Dasypus_novemcinctus|94             GCTTATGAGCACCTCTCAAAATTGATCAATTTGAGGGAAGCAGCTGGACCCAAATTTGTG
Oryzias_latipes|21673               GCTTATCAGAGGCTGTCAGAGTTCATAAAGAGGAGGGAGGCAGGCGGGCCGGAATACGTG
Tetraodon_nigroviridis|3766         GCCTATCAGAAAATGTCCAAGTTAATTAAGCTGCGGAAAGCAGGAGGACCTGAGTACGTG
Fugu_rubripes|5460                  GCCTATCAAAAAATGTCCAAGATAATTAAGCTGCGAAATGCGGGAGGACCCGAATACGTG
                                                                                                

Caenorhabditis_elegans|24820        ------------------CTCCAACCAAAATCAGTCGTTATTGCCACATACGCCCTTTGC
Macropus_eugenii|618                NNNNNNNNNNNNNNNNNNNNNNNNGTTCGCTCTGAAATTATTGCTACCTATGCCCTTTGT
Nematostella_vectensis|19532        ATATCTGTAAGTCGT---------ATCCGCTCAGAAATAATAACAACATATGCACTGTGC
Tarsius_syrichta|82                 NNNNNNNNNNNNNNNNNNNNNNNNATTCGTTCCGAGACAATCGCCACCTATGCTCTCTGT
Choloepus_hoffmanni|2733            NNNNNNNNNNNNNNNNNNNNNNNNATTCGTTCTGAGACAATTGCCACGTATGCCCTCTGT
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  AATGGCGTGCAGCAATATATGTCGATACGTTCTGAGACAGTTGCCACTTACGCTCTCTGT
Xenopus_tropicalis|2950             GAAGGAATAAAGCAATATATGTCAATTCGGTCTGAAACAATCGCAACATATGCCTTATGT
Anolis_carolinensis|1480            GATGGTGTGAAACAATATTTGAGTATCCGGTCAGAAACCATTGCCACTTATGCCCTGTGT
Gallus_gallus|22892                 AATGGTGTGAAACAATATATGACTGTCCGTTCTGAAACCATTGCCACCTATGCTCTTTGT
Taeniopygia_guttata|18881           AATGGTGTGAAACAGTATATGACAGTTCGCTCTGAAGTCATTGCCACCTATGCTCTCTGT
Monodelphis_domestica|26362         GATGGTGTGCAACAATACATATCTGTTCGCTCTGAAACTATTGCCACCTATGCCCTTTGT
Myotis_lucifugus|6147               AATGGTGTGCAGCAATATATGTCGATTCGTTCGGAGACCATTGCCACTTATGCTCTCTGT
Erinaceus_europaeus|9218            GATGGTGTGCAACAGTATATGTCAATTCGTTCTGAGATAATTGCCACATATGCGCTCTGT
Procavia_capensis|16587             AATGGGCAGCAGCAATACATGTCGGTTCGTTCTGAGACTATTGCCACATATGCCCTCTGT
Ornithorhynchus_anatinus|14328      GACGGTGTACAGCAATATATGTCTGTCCGCTCCGAAATCATCGCCACCTATGCCCTCTGT
Spermophilus_tridecemlineatus|15987 AATGGCACTCAGCAATATATGTCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Dipodomys_ordii|1002                GATGGTGTGCAGCAATATATGTCGATTCGATCAGAGACGATTGCCACATATGCCCTGTGT
Tupaia_belangeri|9820               AATGGCGTGCAGCAATATATGTCGATTCGTTCTGAGACCATTGCCACTTATGCCCTTTGT
Pteropus_vampyrus|13310             AATGGCGTGCAGCAATATATGTCGATCCGTTCTGAGACAATTGCCACTTATGCTCTCTGT
Sus_scrofa|2512                     GATGGTGTGCAGCAATATATATCAATTCGTTCTGAGACCATTGCCACTTATGCTCTCTGC
Bos_taurus|25488                    GATGGTGTGCAGCAATACATGTCGATGCGTTCTGAGGCAATCTCCACTTATGCTCTCTGT
Sorex_araneus|14769                 AATGATGTGCAGCAATATATGTCGATTCGTTCTGAGACAATTGCCACATATGCCCTCTGT
Equus_caballus|15106                GATGGTGTGCAGCAATATATGTCGATTCGTTCTGAGACAATTGCCACTTACGCTCTCTGT
Equus_caballus|15108                GATGGTGTCCAGCAATATATATCGATTCGTTCTGAGACAATCGCTACTTACGCTCTCTGT
Mus_musculus|11155                  AATGGCGTGCAGCAATATATGTCAATTCGCTCTGAGACCATCGCAACCTATGCCCTCTGT
Rattus_norvegicus|14768             AATGGTGTGCAGCAATATATGTCAATTCGCTCGGAGACCATCGCAACTTACGCCCTCTGT
Loxodonta_africana|22574            AATGGGCAGCAGCAATATATGTCGATTCGTTCTGAGACCATTGCCACGTATGCCCTCTGT
Canis_familiaris|612                AATGGTGTGCAACAATATATGTCGATTCGTTCTGAGACAATTGCCACTTACGCTCTCTGT
Felis_catus|45683                   AATGGTGTGCAGCAATATATGTCAATTCGTTCTGAGACAATTGCCACTTATGCTCTCTGT
Cavia_porcellus|2593                AATGGGGTGCAGCAGTATATGTCGATTCGTTCTGAGACAATCGCCACTTATGCCCTCTGT
Ochotona_princeps|1261              AACGGTGTGCAGCAATATATGTCGATTCGTGCCGAGACCATTGCCACTTACGCCCTCTGT
Oryctolagus_cuniculus|21323         AATGGTGTGCAGCAGTATATGTCGATCCGCGCCGAGACAATTGCCACGTACGCCCTCTGT
Microcebus_murinus|10641            AATGGTGTGCAGCAATACATGTCGATTCGTTCTGAGATAATCGCCACATATGCTCTCTGT
Callithrix_jacchus|43513            AATGGCGTGCAGCAATATCTATCGATTCGTTCTGAGATCATCGCCACTTACGCTCTCTGT
Gorilla_gorilla|5611                AACGGTGTGCAGCAATATATATCAATTCGTTCTGAGATAATTGCCACTTACGCTCTCTGT
Rhesus_macaque|15650                AATGGTGTGCAGCAATATATATCAATTCGTTCTGAGACAATCGCCACTTACGCTCTCTGT
Pongo_abelii|27761                  AATGGTGTGCAACAATATATATCAATTCGTTCTGAGATAATCGCCACTTATGCTCTCTGT
Homo_sapiens|93736                  AACGGTGTGCAGCAATATATATCAATTCGTTCTGAGATAATCGCCACTTACGCTCTCTGT
Pan_troglodytes|37055               AACGGTGTGCAGCAATATATATCAATTCGTTCTGAGATAATCGCCACTTACGCTCTCTGT
Otolemur_garnettii|2666             GACGGTGTGCAGCAATATATGTCGATTCGCTCTGAGATAATCGCCACATATGCTCTCTGT
Dasypus_novemcinctus|94             AATGGTGAGCAACAATATTTATCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Oryzias_latipes|21673               AATAACATTAAGCAGTATATCTCTGTTCACTCAGAAATGATTGCAACCTACGCTTTGTGT
Tetraodon_nigroviridis|3766         GACAATGTAAAGCAGTACATTTCTGCTCACTCTGAAATGATTGCAACCTACGCTTTGTGT
Fugu_rubripes|5460                  GACAATGTAAAGCAGTACATTTCTGTTCACTCTGAAATGATTGCAACCTACGCGTTGTGC
                                                                                                

Caenorhabditis_elegans|24820        GGTTTCTCGAATTTCTCCTCAATGGGAATGTCAATTGAATTTCTTGGCGGTCTGGCTCCA
Macropus_eugenii|618                GGCTTTGCCAATTTTGGGTCTCTGGGAGTAGTGATTGGAGGTCTCACATCTATGGCTCCT
Nematostella_vectensis|19532        GGGTTCGCAAACTTTAGTTCGATTGGCATCCAAATTGGGGGCCTGGGACCGATGGCACCT
Tarsius_syrichta|82                 GGTTTTGCCAATATCGGTTCTCTG---ATAGCGATCGGTGGACTCACATCCATGGCTCCT
Choloepus_hoffmanni|2733            GGTTTTTCCAATTTTGGTTCCCTCGGAATAGTGATCGGCGGACTCACATCCCTGGCTCCT
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  GGTTTTGCCAATATCGGTTCCCTGGGAATAGTGATCGGCGGACTCACATCCATAACTCCT
Xenopus_tropicalis|2950             GGATTCGCAAACTTTGGCTCCTTGGGAATTACTATTGGTGGCCTAAGCTCAATGGCTCCC
Anolis_carolinensis|1480            GGATTTGCCAACTTTGGTTCCTTAGGAGTTGTAATTAGTGCTTTGACTGCCTTAGCTCCC
Gallus_gallus|22892                 GGATTTGCCAACTTTGGCTCCCTGGGAATGGTAATAGGAAGTCTAACAAGCATGGCTCCC
Taeniopygia_guttata|18881           GGATTTGCCAACTTCGGCTCCCTGGGACTGGTAATAGGAGGCCTGACAAGCATTGCTCCC
Monodelphis_domestica|26362         GGCTTTGCCAACCTTGCTTCTCTGGGAGTCGTGATTGGAGGACTCACATCCATGGCTCCT
Myotis_lucifugus|6147               GGCTTTGCCAATATCAGTTCCCTAGGAATAGCAATTGGCGCACTCACATCCATGGCTCCT
Erinaceus_europaeus|9218            GGTTTTGCCAATTTCGGTTCCTTGGGAATAGTGATTGGAGGACTCACTTCCATGGCTCCT
Procavia_capensis|16587             GGCTTTGCCAATTTTGGTTCCCTAGGAATAGTAATCGGCGGACTAACATCCATGGCTCCT
Ornithorhynchus_anatinus|14328      GGCTTTGCCAATTTCGGTTCTCTGGGGATTGTGATCGGAGGACTGTCTTCCATGGCACCT
Spermophilus_tridecemlineatus|15987 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTCTCTAGCGCCT
Dipodomys_ordii|1002                GGTTTTGCCAATATGGGTTCCCTAGGAATCGTAATCGGTGGACTCACATCCATAGCACCT
Tupaia_belangeri|9820               GGTTTTGCCAATTTCGGTTCCCTAGGAATAGTGATCGGCGGACTCACATCCATAGCTCCT
Pteropus_vampyrus|13310             GGCTTTGCCAATATCAGTTCCCTAGGAATAGCGATCGGCGCACTCACATCCATGGCTCCT
Sus_scrofa|2512                     AGCTTTGCCAATATCGGTTCCCTAGGAATAGCGATCGGTGGACTCACATCCATAGCCCCT
Bos_taurus|25488                    GGCTTTGCCAATTTTGGTTCCCTGGGAATAGTGATCGGTGGACTCACTTCCATGGCTCCT
Sorex_araneus|14769                 GGCTTTGCCAATTTTGGCTCCTTAGGAATGGTGATCGGCGGACTCTCATCCATGGCTCCT
Equus_caballus|15106                GGCTTTGGCAGTGTCAGTTCCCTAGGATTAGCAATCAGCACTCTCACATCCATGGCTCCT
Equus_caballus|15108                GGCTTTGCCAATTTCGGTTCCCTAGGAATAGTGATCGGTGGACTAACATCCATGGCTCCT
Mus_musculus|11155                  GGTTTTGCCAATTTTGGTTCCCTAGGAATCGTGATCGGTGGACTTACATCCATAGCACCA
Rattus_norvegicus|14768             GGTTTTGCCAATTTCGGTTCCCTAGGAATAGTGATCGGTGGACTTACGTCCATAGCTCCG
Loxodonta_africana|22574            GGCTTTGCCAACTTTGGTTCCCTAGGAATAGTGATCGGCGGACTAACATCCATAGCTCCT
Canis_familiaris|612                GGCTTTGCGAATATCGGTTCTCTAGGAATAGTGATCGGCGGACTTACATCTATGGCTCCT
Felis_catus|45683                   GGCTTTGCTAATTTCGGTTCCCTAGGAATAGTGATCGGCGGACTCACATCCATGGCTCCT
Cavia_porcellus|2593                GGTTTCGCCAATTTTGGATCCCTAGGAATAGTGATCGGTGGACTCACATCCATGGCTCCT
Ochotona_princeps|1261              GGTTTCTCCAATATCGGTTCACTGGGAATAGTAATTGGTGGACTCACATCCATGGCTCCA
Oryctolagus_cuniculus|21323         GGATTCGCCAATATCGGTTCCCTAGGCATAGTGATTGGTGGACTCACATCCATGGCTCCA
Microcebus_murinus|10641            GGTTTTGCCAATATCGGTTCCCTAGGAATAGTGATCGGCGGACTCACATCCATAACTCCT
Callithrix_jacchus|43513            GGTTTTGCCAATATTGGTTCTCTAGGAATCGTGATCGGTGGACTCACATCCATGGCTCCT
Gorilla_gorilla|5611                GGTTTTGCCAATATCGGGTCCCTAGGAATCGTGATCGGCGGACTCACATCCATGGCTCCT
Rhesus_macaque|15650                GGTTTTGCCAATATCGGGTCCCTAGGAATTGTGATCGGCGGACTCACATCCATGGCCCCT
Pongo_abelii|27761                  GGTTTTGCCAATATCGGGTCCCTAGGAATCGTGATCGGCGGACTCACATCCATGGCTCCT
Homo_sapiens|93736                  GGTTTTGCCAATATCGGGTCCCTAGGAATCGTGATCGGCGGACTCACATCCATGGCTCCT
Pan_troglodytes|37055               GGTTTTGCCAATATCGGGTCCCTAGGAATCGTGATCGGCGGACTCACATCCATGGCTCCT
Otolemur_garnettii|2666             GGTTTTGCCAATATTGGTTCCCTAGGAATAGTGATCGGTGGACTCANNNNNNNNNNNNNN
Dasypus_novemcinctus|94             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATCCATGGCTCCT
Oryzias_latipes|21673               GGATTTTCGAATATTGCTTCCCTTGGGATGTCTATCGGGGCACTGAGGTCAAGCAGGCCG
Tetraodon_nigroviridis|3766         GGATTTTCCAACTTTGCCTCCATGGGCATCGCGTTCGGATCCATGTcaAACTTTGCTccg
Fugu_rubripes|5460                  GGATTTTCCAACTTTGCTTCCATGGGCATCGCGTTTGGATGCATGACAAACCTTGCTCCA
                                                                                                

Caenorhabditis_elegans|24820        AGTAAAAGATCCACAATTTCAAAGCTAGTGCTCCGTGCTCTTTGCGCA---GGGTCCATT
Macropus_eugenii|618                TCCAGGAAGCGGGACATCGCCGCAGGAGCTTTCAGGGCTCTGATCGCT---GGTACTGTA
Nematostella_vectensis|19532        ACCAGGATCCGTGACATGGCCAAGATTGCAATGCGGGCACTGCTGGCT---GGAACAATT
Tarsius_syrichta|82                 TCCAGAAAGCGTGACATCGCCTCAGGAGCAGTGAGAGCTCTGATTGCG---GGAACTGTC
Choloepus_hoffmanni|2733            TCCAGAAAGCGTGACATCGCCTCAGGGGCAATGAGAGCTCTGATTGCG---GGAACCATC
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  TCCAGAAAGCGTGACATCGCCTCTGGGGCAGTGAGAGCTCTGATTGCG---GGGACCATC
Xenopus_tropicalis|2950             AGCAGGAAAGGTGACATAGCAAGTGGTGCCATTAGGGCTATGATCGCT---GGCACAGTT
Anolis_carolinensis|1480            TCCAGGAAGAAAGACATTGCCAACGGGGCCTTCCGAGCCATGGTCGCT---GGCACCGTG
Gallus_gallus|22892                 TCTAAAAAAAAGGAAATCGCTAATGGTGCTTTCAGAGCAATGATTGCT---GGAACTGTT
Taeniopygia_guttata|18881           tcaaaaaagaaggaaatagcTGATGGTGCTTTCAGAGCAATGACTGCA---GGAACTGTG
Monodelphis_domestica|26362         TCCAGGAAGGGGGACATCGCCGGAGGGGCTTTCCGGGCCCTGGTTGCT---GGTAATGTA
Myotis_lucifugus|6147               TCCAGAAAGGATGACATCATCTCAGGGGCAATGAGAGCTCTGATTTCA---GGGACCACA
Erinaceus_europaeus|9218            TCCAGAAAGCGTGACATTGCCTCTGGGGCCATGCGAGCTCTAATCTCG---GGGACCATC
Procavia_capensis|16587             TCCAGAAAGCAGGACATCGCCTCAGGGGCTTTAAGAGCTCTGATTGCG---GGAACCATC
Ornithorhynchus_anatinus|14328      ACCAGAAAGCACGACATCTCCAAAGGTGCCATTAGAGCCCTGATTGCT---GGCACTGTC
Spermophilus_tridecemlineatus|15987 GGCAGAAAGCGGGACATCGTCGCTGGATCTGTAAGAGCTCTGATCGCA---GGGACTGTT
Dipodomys_ordii|1002                TGCAGGAAACGTGACATCGCTTCAGGAGCAGTGAGAGCCCTGATCGCA---GGAACCATC
Tupaia_belangeri|9820               TCCAGAAAGCGTGACATCGCCTCAGGGGCACTGAGAGCTCTGATCGCT---GGGACCATG
Pteropus_vampyrus|13310             TCCAGAAAGCGTGACATCACTTCAGGGGCAGTGAGAGCGCTGATTTCA---GGGACCATA
Sus_scrofa|2512                     TCCAGAAAGCGTGACATCTCCTCAGTGGCAGTGAGAGCTCTGATTGCG---GGGACCATT
Bos_taurus|25488                    TCAAGAAAGCGTGACATCACCGCAGGAGCAATGAGAGCTCTGATTGCG---GGGACCATC
Sorex_araneus|14769                 TCCAGAAAGCGTGACATCGCCTCGGGAGCAATGCGAGCTCTGATCGCT---GGCACCATT
Equus_caballus|15106                TCCAGGAAGCGTGACATCGCCGCAGGGGCAGTGAGAGCTCTGATTGCA---GGGACCATC
Equus_caballus|15108                TCCAGGAAGCGTGACATTGCCTCAGGGGCAGTGAGAGCTCTGATTGCG---GGGACCGTC
Mus_musculus|11155                  TCCAGAAAACGAGACATCGCCTCTGGAGCCATGAGAGCCCTGATTGCT---GGCACCATT
Rattus_norvegicus|14768             TCCAGAAAGCGAGACATTGCCTCGGGAGCCATGAGAGCCCTGATTGCT---GGGACCATT
Loxodonta_africana|22574            TCCAGAAAGCACGACATCACCTCAGGGGCAGTAAGGGCTCTGATTGCG---GGGACCATC
Canis_familiaris|612                TCCAGAAAGCGTGATATCACATCGGGGTCAGTGAGAGCTCTGATTGCA---GGGACTGTC
Felis_catus|45683                   TCCAGAAAGCATGATATCGCCTCAGGGGCAGTGAGAGCTCTGATCGCT---GGGACCGTC
Cavia_porcellus|2593                TCCAGAAAGAGTGACATCGCCTCCGGGGCCATCCGAGCTCTGATCTCA---GGGACCGTA
Ochotona_princeps|1261              TCCAGAAAGCGTGACATCGCTGCAGGGGCAGTGAGAGCTCTGATCGCA---GGAACCATC
Oryctolagus_cuniculus|21323         TCCAGGAAGCGTGACATCGCTGCTGGGGCAGTGAGAGCGCTGATCGCG---GGGACCACC
Microcebus_murinus|10641            TCCAGAAAGCGTGACATCGCCTCAGGGGCAGTGAGAGCTCTGATCGCA---GGGACCGTC
Callithrix_jacchus|43513            TCCAGAAAGCATGACATCGCCTCTGGGGCAGTGAGAGCTCTGATTGCG---GGGACTGTG
Gorilla_gorilla|5611                TCCAGAAAGCGTGATATCGCCTCGGGGGCAGTGAGAGCTCTGATTGCT---GGGACATTG
Rhesus_macaque|15650                TCCAGAAAGCGTGACATCGCCTCGGGAGCAGTGAGAGCTCTGATCGCG---GGGACCGTG
Pongo_abelii|27761                  TCCAGAAAGCATGATATCGCCTCGGGGGCAGTGAGAGCTCTGATTGCG---GGGACCATG
Homo_sapiens|93736                  TCCAGAAAGCGTGATATCGCCTCGGGGGCAGTGAGAGCTCTGATTGCG---GGGACCGTG
Pan_troglodytes|37055               TCCAGAAAGCGTGATATCGCCTCGGGGGCAGTGAGAGCTCTGATTGCG---GGGACCGTG
Otolemur_garnettii|2666             NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNN
Dasypus_novemcinctus|94             TCCAGAAAGCAGGACATTGCCTCAGGGGCAGTGAGAGCTCTGATTGCA---GGGACCATC
Oryzias_latipes|21673               TTTAGGCATCTGTTTGTTTTCTCAGGCACAAAGAAGGAGTTCATTACAAGAGATACAGTG
Tetraodon_nigroviridis|3766         gacagacaggcggacatTGCCAGCTGTGGCTTCAGAGCTTTGATCGCT---GGCAGCGTC
Fugu_rubripes|5460                  GGCAGACAGGCCGACATCGCCAGGTGTGGCATCAGAGCTTTGGTCGCT---GGCAGCGTT
                                                                                                

Caenorhabditis_elegans|24820        GCGTGCTTTATGAATGCCACTGTCGCAGGC---------ATTTTGATCTCATCCCCAGTG
Macropus_eugenii|618                GCCAGTTTCATGACAGCCTGTAAGGCGGGC---------ATGCTCTCCAGCCCTCCCATG
Nematostella_vectensis|19532        GCTTGCTTTATGACAGCTTGCGTAGCTGGT------------------------------
Tarsius_syrichta|82                 GCCTGTTTCATGACAGCCTGTGTCGCAGGC---------ATACTCTCCAGCACTCCTGTG
Choloepus_hoffmanni|2733            GCCTGCTTCATGACAGCCTGCATCGCAGGC---------ATGCTTACCAGCACTCCTGTG
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  GCCTGCTTCATGACAGCCTGCATCGCAGGC---------ATGCTCACCAACAGTCCTGTA
Xenopus_tropicalis|2950             GCTTGCTTTATGACGGCTTGCATTGCAGGG---------TTATTAACCCAACCAGTCGAA
Anolis_carolinensis|1480            GCCTGCTTCATGACCGCTTGCGTTGCAGGT------------------------------
Gallus_gallus|22892                 GCCTGTTTCATGACAGCATGCATTGCAGGA---------ATGCTGGCCGTCCCTGACGTG
Taeniopygia_guttata|18881           GCCTGTTTCATGACAGCCTGTGTCGCAGGA---------ATGCTGACTGTCCCTAGTCCG
Monodelphis_domestica|26362         GCCAGCTTCATGACAGCCTGTATTGCTGGC---------ATACTCTCCAACCTTCCTGGG
Myotis_lucifugus|6147               GCCTGCTTCATGACAGCCTGTGTCGCAGGC---------ATTCTCTCTGGCACACCTGTA
Erinaceus_europaeus|9218            GCCTGCTTCATGACGGCCTGCATTGCAGGC---------ATGCTTTCCAGCACTCCCAAA
Procavia_capensis|16587             GCCTGTTTCATGACGGCCTGTATCGCAGGC---------ATCCTGTCTGGCTCACCTGTT
Ornithorhynchus_anatinus|14328      GCCTGCTTCATGACGGCCTGCATCGCTGGTACATTTCTGTTTTTGCCTTGCACCTCTTTG
Spermophilus_tridecemlineatus|15987 GCTTGCTTCATGACAGCCTGCGTCGCAGGC---------ATACTCTCTGGCACCCCCGAG
Dipodomys_ordii|1002                GCCTGCTTCATGACAGCCTGCATTGCAGGC---------ATGCTCTCTGACACCCCTGTG
Tupaia_belangeri|9820               GCCTGCTTCATGACAGCCTGCATCGCAGGC---------ATTCTTTCCAGCACTCCTGCG
Pteropus_vampyrus|13310             GCCTGCTTCATGACAGCCTGCATCGCAGGC---------CTACTGTCTGGCACCCCTGTA
Sus_scrofa|2512                     GCCAGCTTCATGACAGCCTCCATCGCAGGC---------ATACTCATCAACACTCCTGTA
Bos_taurus|25488                    GCCTGCTTCCTGACAGCCTGCATCGCAGGC---------ATGCTTACCAACACTCCTGTA
Sorex_araneus|14769                 GCCTGCTTCATGACAGCCTGCATCGCAGGC---------ATGCTCTCCAGCACTCCTATA
Equus_caballus|15106                GCCTGCTTCATGACCGCCTGCATCGCAGGC---------ATCCTCTCCAGCACTCCTGTA
Equus_caballus|15108                GCCTGCTTCATGACCGCCTGCATCGCAGGC---------ATCCTCTCCAGCACTCCTGTA
Mus_musculus|11155                  GCCTGCTTCATGACAGCCTGCATCGCAGGC---------ATCCTCTCTGATACCCCGGTG
Rattus_norvegicus|14768             GCCTGCTTCATGACAGCCTGCATCGCTGGC---------ATGCTCTCTGACACCCCGGTG
Loxodonta_africana|22574            GCCTGCTTCCTGACAGCCTGCATCGCAGGC---------ATGCTCTCTGGCTCTCCTGTT
Canis_familiaris|612                GCCTGCTTCATGACAGCCTGTATTGCAGGA---------CTACTCTCCAGCACCCCTGTA
Felis_catus|45683                   GCCTGCTTCATGACAGCCTGCATTGCAGGG---------ATGCTCTCCAGCACCCCAGCA
Cavia_porcellus|2593                GCCTGCTTTATGACAGCGTGCGTCGCAGGC---------TTACTCTCCAGCACCCCCATA
Ochotona_princeps|1261              TCCTGCTTCATGACTGCCTGTGTTGCAGGC---------ATACTGTCTGCCACTCCTGTG
Oryctolagus_cuniculus|21323         GCCTGCTTCATGACTGCCTGCATCGCAGGC---------ATCCTGTCCGCCACTCCCGTA
Microcebus_murinus|10641            GCCTGCTTCATGACAGCCTGCATCGCAGGT---------ATACTCTCCAGCACTCCCGTG
Callithrix_jacchus|43513            GCCTGCTTCATGACAGCCTGCATCGCAGGC---------ATACTCTCCAGCACTCCTGCA
Gorilla_gorilla|5611                GCCTGCTTCATGACAGCCTGCATCGCAGGT---------ACC---GCACCCTGTCCTTTG
Rhesus_macaque|15650                GCCTGCTTCATGACAGCCTGCATCGCAGGC---------ATACTCTCCAGCACTCCTGTG
Pongo_abelii|27761                  GCCTGCTTCATGACAGCCTGCATCGCAGGC---------ATACTCTCCAGCACTCCTGTG
Homo_sapiens|93736                  GCCTGCTTCATGACAGCCTGCATCGCAGGC---------ATACTCTCCAGCACTCCTGTG
Pan_troglodytes|37055               GCCTGCTTCATGACAGCCTGCATCGCAGGC---------ATACTCTCCAGCACGCCTGTG
Otolemur_garnettii|2666             NNNNNNNNNNNNNNNNNNNNNNNNNNNNGT---------ATACTCTCCAGCACTCCCATG
Dasypus_novemcinctus|94             GCCTGCTTCATGACAGCCTGCATCGCAGGC---------ATGCTCTCCAGCACACCTGTG
Oryzias_latipes|21673               TCATTGTTTTCTATAAGCTCTGTTTTAGGT---------ATGTTATACATCCCT------
Tetraodon_nigroviridis|3766         TCCTGTTTCATGACTGCCTGTATTGCAGGT---------GTTTTGTACGTCCCT------
Fugu_rubripes|5460                  TCGTGTTTCATGACCGCCTGTATTGCAGGC---------ATTTTGTACATCCCTGAGGTT
                                                                                                

Caenorhabditis_elegans|24820        ---------------------------------------------------ATTTGCCAG
Macropus_eugenii|618                ---GAGATAGATTGCAACAGTCTTTTAGAAAAAGCCTTCAACTCAACT---TCACCTAGC
Nematostella_vectensis|19532        ---GAG------------------------------------------------------
Tarsius_syrichta|82                 ---GACATCAACTGCCATCACATTTTAGAGAATGCTTTCAACTCCAGC---TTACCTGGA
Choloepus_hoffmanni|2733            ---GAC---AACTGCCATTATGTTTTAGGCACTGCCTTCAACTCCAGT---TTACCTAGA
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  ---GACAGTGGCTGCCATCACATTTTGGAATATGCCTTCAACTCCAGC---TTAGCTGGA
Xenopus_tropicalis|2950             ---CAATTCACATGCAGAGAACTGTTGGAAAGTTCACTTCTCAACACAAGTTCACCAGTC
Anolis_carolinensis|1480            ------------------------------------------------------------
Gallus_gallus|22892                 ---GAAGTTCCCTGCCACATTTTATCACAAAATGCCTTCAACTCTACAAGTTCCCCAGCC
Taeniopygia_guttata|18881           ---GAAGTTCCTTGCCATATCTTATTAGGAAATGCTTCCAACTTCACAGATTTCCCTGAC
Monodelphis_domestica|26362         ---GAGATAGATTGCTACAGTCTTTTAGCAAATGCCTTCAACTCCAGT---TCACCAAGC
Myotis_lucifugus|6147               ---GATGTCAGCTGTCACCACATTTTAGAGAATGTCTTCAACTCCAGT---TTACCTAGA
Erinaceus_europaeus|9218            ---GATGTCAACTGTTATTACATTTTAGAGAATGCCTTCAACACCAGT---TTACCTGCA
Procavia_capensis|16587             ---GACATTAACTGTCATCACATTTTAGAGAATGCCTTCAACTTCAGC---TCACCCAGA
Ornithorhynchus_anatinus|14328      ---GATGTCGAGTGCCATGGCTTACTAGAAAATGCATTCAACTCGAGC---TTACCCAGC
Spermophilus_tridecemlineatus|15987 ---GACATCAACTGCCATCACATTTTAGAGAATGCCTTCAGCTCCAGT---TTACCTGGC
Dipodomys_ordii|1002                ---GACATCAACTGTCACCACATTCTAGAAAGTACCTTCAACTCCAGT---TTCCCTAGC
Tupaia_belangeri|9820               ---GATATCAACTGCCATCACATTTTAGAGAACGCCTTCAACTCCAGT---TTATTGAAA
Pteropus_vampyrus|13310             ---GACATCAACTGCCATCACATTTTAGAGAATGCCTTCAACTCCAGT---TTACCTAGA
Sus_scrofa|2512                     ---GACATCAACTGTCATCACATTTTGGAGAATGCCTTCAACTCC---------------
Bos_taurus|25488                    ---GACATCAACTGCCACCACATTTTGGAGAATGCCTTCAACTCCGGC---TTAGTCAGA
Sorex_araneus|14769                 ---GACAATGACTGCCATCACATTTTCGAACGTGCTTTCAACTCCAGT---TTATCTAGG
Equus_caballus|15106                ---GACATCACCTGCCATCACATTTTCGAGAACACCTTTGCCTCTGGC---TTATCTCAA
Equus_caballus|15108                ---GACATCAACTGCCATCACACATTAGAGAACGCCTTCGCCTCCAGC---TTATCTCAA
Mus_musculus|11155                  ---GATATCAACTGCCATCACGTTCTAGAG---------AACGGCAGA---GTACTCAGC
Rattus_norvegicus|14768             ---GCTATCAACTGCCACCACGTTCTAGAG---------AGCAGCAAA---GTACTCAGC
Loxodonta_africana|22574            ---GACATCAACTGCCATGACATTTTAGAGAATGCCTTCAACTTCAGC---TTACCTAGA
Canis_familiaris|612                ---GACATCAACTGCCATTACATTTTAGAGAATGCCTTCAACTCCAGT---TCACCTACG
Felis_catus|45683                   ---GACATCAACTGCCATCTCATTTTGGAGAATGCCTTCAATTCCAGT---TCGCCTGCA
Cavia_porcellus|2593                ---GATATCAACTGCCATCACATCCTAGAGGATGCCTTCAACTCCACG---TTACCTAGC
Ochotona_princeps|1261              ---GACATCAACTGCCAGCATGTTTTACAGAAGGCCTTCGACTCCAGT---TTAACCAGC
Oryctolagus_cuniculus|21323         ---GACATCAACTGCCAGCACGCTTTAGAGAATGCCTTCAACTCCAGC---TTGCCCAGT
Microcebus_murinus|10641            ---GACATCAACTGCCATCACATTTTAGAGACTGCCTTCAACTCTAGT---TTACCTAGC
Callithrix_jacchus|43513            ---GACATCAACTGCCATCATGTTTTAGAGAACGCCTTCAACTCCAGT---TTCCCTGGA
Gorilla_gorilla|5611                ---TGTCCCAGTGCCCACAGGATG---------------AATGGCAGC---TTTCAGGAC
Rhesus_macaque|15650                ---GACATCAACTGCCATCACGTTTTAGAGAATGCCTTCACCTCCAGT---TTCCCTGGA
Pongo_abelii|27761                  ---GACATCAACTGCCATCACGTTTTAGAGAATGCCTTCAACTCCACT---TTCCCTGGA
Homo_sapiens|93736                  ---GACATCAACTGCCATCACGTTTTAGAGAATGCCTTCAACTCCACT---TTCCCTGGA
Pan_troglodytes|37055               ---GACATCAACTGCCATCTTGTTTTAGAGAATGCCTTCAACTCCACT---TTCCCTGGA
Otolemur_garnettii|2666             ---GACATCAACTGCCATCACATTTTAGAAATTCCCTTCAACTCCAGT---TTACCTAGA
Dasypus_novemcinctus|94             ---GACTTCAACTGCCATAACATTTTAGGCAATGCCTTCAACTCCAGT---GTACCAAAA
Oryzias_latipes|21673               ---------GATTGTCCACTTTTACTGAACACAGAGTTCAACAACACC---AATGTAACC
Tetraodon_nigroviridis|3766         ---GAAGTTCATTGTGCACATTTCCTGAGCACACACTTCAACAACAGT---GTTGTGACA
Fugu_rubripes|5460                  CCTGAAGTTCTGTGTGCAGGTTTCCTGAGCACACACTTCAACAAAAGT---GTTGTGATG
                                                                                                

Caenorhabditis_elegans|24820        TCATCTCAAAAAAGTGATACGTGT------------------------------------
Macropus_eugenii|618                AACACAACTGAGCTAGTTACCTGT---TGCCAAAACATATTTACCAGTATTGTCGCCAGC
Nematostella_vectensis|19532        ------------------------------------------------------------
Tarsius_syrichta|82                 AACACAACCAAAGTGATATCTTGT---TGCCAAAGTCTACTGAGCAGCACTATTGTCAAA
Choloepus_hoffmanni|2733            AACACAACCGAAATAGTGTCTTGC---TGCCAAAGTCTGCTGAGCAGCACTGTTGCCAAG
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  GACACGACCAATGTAGTATCTTGT---TGCCAGAGCCTCCTGAGCAGCACCGTTGCCAAG
Xenopus_tropicalis|2950             AACTCAACAGAGGTAGTGGACTGC---TGCGTGGGACTTTTCAAATGGGTGGTTGCAGAT
Anolis_carolinensis|1480            ------------------------------------------------------------
Gallus_gallus|22892                 AACAGCACAGAGCTGGTCAAATGC---TGCCAGCAGACCTTCACCAGT------GCAAAC
Taeniopygia_guttata|18881           AACAGCACAAAGCTAGTTGAATGC---TGCCAGCAACTCTTTGCCAGT------GCAAAT
Monodelphis_domestica|26362         AACACAAGTGAGCTAGTTATCTGT---TGCCAAAATCTATTTACCAGCACTGTCACCCAG
Myotis_lucifugus|6147               AACACAACCAATGTGGTATCTTGT---TGCCAGACTCTCTTGAGCAGCACTGTTGTCAAC
Erinaceus_europaeus|9218            GACAAAAGCATTATTGTGTCTTGT---TGCCAAACTCTATTGAGCAGCACTATTGTCAAG
Procavia_capensis|16587             AACACAACCGAAGTCGTCTCTTGT---TGCCAAAATCTATTCAACAGCACT---------
Ornithorhynchus_anatinus|14328      TTCACACCGGAAATAGAAACCTGT---TGCCAAGACCTATTCCGCAGGTATCGGGCCCTC
Spermophilus_tridecemlineatus|15987 AACGCAACCACAGTGGTGTCTTGT---TGCCAAAGTCTGTTGAGCAGCATTACTGACAAG
Dipodomys_ordii|1002                AACATGACCGATGTAGTATCTTGT---TGCCAAAGTTTATTACACAGCACTATTGCCAAG
Tupaia_belangeri|9820               AACACAACTGAAGTGGTATCTTGT---TGCCAAAGTCTATTGAACAGCACTATTGCCACT
Pteropus_vampyrus|13310             AATACAACCAATGTAGTATCTTGT---TGCCAGAGTCTATTGAACAGCTCTGTTGTCAAC
Sus_scrofa|2512                     AGACACAACCATGTAGTATCTTGT---TGCCAGAGTCTATTGAGCAGCACTGTGGCCAAG
Bos_taurus|25488                    AATACAACCAACGTCGTATCTTGT---TGCCAGGGTCTACTGAGCAGTGCTGTTGTCAAG
Sorex_araneus|14769                 AACACAAGCAGTGTGGTGTTGTGC---TGCCAAAGTCTTTTGAGCAGCACTGTTATCAAG
Equus_caballus|15106                AACACAACTGACGTGGTGTCGTGT---TGCCAGAGCCTACTGAGCAGCACTGTTGCCGTG
Equus_caballus|15108                AACACAACCGATATGGTGTCCTGT---TGCCAGAGCCTACTGAGCAGCACTGTTGCCGTG
Mus_musculus|11155                  AACACAACCGAAGTGGTGTCTTGT---TGCCAAAATCTGTTCAACAGCACTGTTGCCAAG
Rattus_norvegicus|14768             AACACAACTGAAGTGGCGTCTTGC---TGTCAAGACCTGTTCAACAGCACTGTTGCCAGG
Loxodonta_africana|22574            AACACAACTGAAGTGGTTTCTTGT---TGCCAAAGTCTATTCAACAGCACT---------
Canis_familiaris|612                AACACAACAGATGTGGTATCTTGT---TGTCAATCTCTATTAAACAGCACTATTGTCAAC
Felis_catus|45683                   AACACCACTGAGGTGGTATCTTGT---TGTCAAAGTCTATTGAACAGNNNNNNNNNNNNN
Cavia_porcellus|2593                AACGCAACCGGAGTGGTATCTTGT---TGCCAAAGCCTACTGCATAGCACTGTGATCCAA
Ochotona_princeps|1261              AATATAACTGAAGTGTTCCCCTGT---TGCCAAAGTCTATGGAACAGCACTGTTGCCAAG
Oryctolagus_cuniculus|21323         AGCACACCTGAAGTGGTAGCTTGT---TGCCAAAGTCTGTGGACCAGCGCTGTTGCCAAG
Microcebus_murinus|10641            AATGCAACCAAAGTAATGTCTTGT---TGCCAAGATCTATTGAGC---------------
Callithrix_jacchus|43513            AACATGACCAAGGTGATATCTTGT---TGCCAAAGTCTGTTGAGCAGCACTGTTGCAAAG
Gorilla_gorilla|5611                AGGCAGTGCCTCCAGCTTGCATGTGCAGCACACGCTGCCACAGAAAGCACTGTTGCCAAG
Rhesus_macaque|15650                AACACAACCAAGGTGATATCTTGT---TGCCAAAGTCTGTTGAACAGCACTGTTGCCAAG
Pongo_abelii|27761                  AACACAACCAAGGTGATAGCTTGT---TGCCAAAGTCTGTTGAGCAGCACTGTTGCCAAG
Homo_sapiens|93736                  AACACAACCAAGGTGATAGCTTGT---TGCCAAAGTCTGTTGAGCAGCACTGTTGCCAAG
Pan_troglodytes|37055               AACACAACCAAGGTGATAGCTTGT---TGCCAAAGTCTGTTGAGCAGCACTGTTGCCAGG
Otolemur_garnettii|2666             AACACAACCAATGTGATGTCTTGT---TGCCGAAGTCTATTGAGCAGCACTGTTGTCAAG
Dasypus_novemcinctus|94             AACACAACCGAGATCGTATCTTGC---TGTCAAAGTCTGTTGAGCAGCACTGTCGCCAAG
Oryzias_latipes|21673               AGTCGTGCAGAAATCCTTCAATGC---TGTACTCAACTTTATAGCAGCGTGACGTTGTAT
Tetraodon_nigroviridis|3766         AACAGCTCACAGCTGATCCACTGC---TGCACACAACTGTACAcaagTGTGACGGTGAAT
Fugu_rubripes|5460                  AACAGCTCACAGCTGGTCGCCTGC---TGCACCCACCTGTACACCAGTGTGACAGTGCAT
                                                                                                

Caenorhabditis_elegans|24820        ---------TTCCGGATTCCTAGCGGA---------------------------------
Macropus_eugenii|618                AACGCCAGTGATATTTTGCCAGCA---------AGCTTATCCACATTGAAAGGCTGCTGT
Nematostella_vectensis|19532        ------------------------------------------------------------
Tarsius_syrichta|82                 GGTCCTGGCGAGGTCATCCCAGGAGGAAACCACAGCCTGTATTCTCTGAAGGGTTGCTGC
Choloepus_hoffmanni|2733            GGTCCCAGTGCAGTCATCCCAGGAGAAAACCACAGCCTGTATTCTTTGAAGGGCTGCTGC
Ornithorhynchus_anatinus|15894      ------------------------------------------------------------
Vicugna_pacos|7402                  GGTCCTGGTGAGGTCATCCCAGGAGGAAACCACAGCCTGCACTCTTTGGAGGACTGCTGC
Xenopus_tropicalis|2950             GGGCCCTCAAATGTTACAATTGGTGGAAATCACAGCATGAGCTTACTCAGCGGTTGTTGC
Anolis_carolinensis|1480            ------------------------------------------------------------
Gallus_gallus|22892                 AGTTCACTGGAGAACTTCCCTGGAGGAAACTACACCCTGAATTTCTGGAAAAAATGTTGC
Taeniopygia_guttata|18881           CATATGGAGGAGATCTTTCCTGGAGGAAACTACAGTCTGAATCCCTGGAAAGTGTGTTGC
Monodelphis_domestica|26362         AACTACAGTAACATTTTACCA---------AGAAGCTTATCTACCTTGAATAACTGCTGT
Myotis_lucifugus|6147               GGTCCCGGCAAGGTCATCCCAGGAGGAAACCACAGCCTGTATTCTCTGAAGAACTGCTGC
Erinaceus_europaeus|9218            GGTCCCAATGAGATCATCCCTGGAGGAAACTTCAGCCTGCATTCTTTGAAGAGTTGCTGT
Procavia_capensis|16587             ---------AAGATCATCCCAGGAGGAAACTATAGCCTATATTCTTTAAAAGGCTGCTGC
Ornithorhynchus_anatinus|14328      TCT---------------------------------------------------------
Spermophilus_tridecemlineatus|15987 GAGCCTCGTGGGATCATCCCAGGAGGAAACTACAACCTGTACTTTGTGAAGAGCTGCTGC
Dipodomys_ordii|1002                GGACCCGGGGAGATCATCCCAGGAGGAAACCACAGTCTGTCGTCTTTGAAGGGCTGCTGC
Tupaia_belangeri|9820               GGTCCCGGTGCGGTCATCCCAGGAGGAAACCACAGCATGTATTCTTTGAAAGGCTGCTGT
Pteropus_vampyrus|13310             GGTCCCGGCCAGGTCATCCCAGGAGGAAACCACAGCTTGTATTTTTGGAAAAACTGCTGC
Sus_scrofa|2512                     GGCCCTGGTGAGATCATCTCAGCAGGAAACTATAGCCTGTACTCGTTGAAGGACTGCTGC
Bos_taurus|25488                    GGTCCTGGTGAGGTCATCCCAACCGGAAACCATAGCCTATATTCTTTGAAGAACTGCTGC
Sorex_araneus|14769                 GGTCCTGGTGAGCTCATCCTTGGAGGGAACCAGAGTCTGGATGCGCTGAAAGGCTGCTGC
Equus_caballus|15106                GGTCCCGGGGAGGTCATCCCAGGAGGGAACCACAGCCTGTCTTCTTTGAAGAACTGCTGT
Equus_caballus|15108                GGTCCCGGGGAGGTCATCCCAGGAGGGAACCACAGCCTGTCTTCTTTGAAGACCTGCTGT
Mus_musculus|11155                  GGACCAAATGACGTCGTCCCAGGAGGAAACTTCAGCCTCTATGCTTTGAAGAGCTGCTGC
Rattus_norvegicus|14768             GGACCAAATGACGTCCTCCCAGGAGGAAACTTCAGCCTCTACACTTTGAAGAGCTGCTGC
Loxodonta_africana|22574            ---------GAGGTCATCCCAGGAGGAAACCACAGCCTGTATTCTTTGAAGGGCTGCTGC
Canis_familiaris|612                GGTCCTGGTGTCATCATCCCAGGAGGAAACCACAGCTTGTCTTCTTTAAGGGGCTGCTGC
Felis_catus|45683                   NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Cavia_porcellus|2593                GGGCCTGGCCAGGTCATCCCAGGAGGAAACTCCAGCCTGCACTCCTTAAAGGGCTGCTGC
Ochotona_princeps|1261              GGACCTGGTGACGTCATTCCAGGAGGAAATTCTAGCCTGTTCGCCTTGAAGGGCTGCTGC
Oryctolagus_cuniculus|21323         GGACCCGGTGAGGTCATCCCAGGAGGAAACTATAGCCTGTACGCTCTGAAGGGCTGCTGC
Microcebus_murinus|10641            ------------------------------------------------------------
Callithrix_jacchus|43513            AGTCCTGGTGAAGTCATCCCAGGGGGAAACTACAGCCTGTATTCTTTGAAGGGCTGCTGC
Gorilla_gorilla|5611                GGTCCTGGTGAAGTCATCCCAGGAGGAAACCACAGTCTGTATTCTTTGAAGGGCTGCTGC
Rhesus_macaque|15650                GGTCCTGGTGAAGTCTTCCCAGGAGGAAACCACAGCCTGTATTCTTTGAAGGGCTGCTGC
Pongo_abelii|27761                  GGTCCTGGTGAAGTCATACCAGGAGGAAACTACAGTCTGTATTCTTTGAAGGGCTGCTGC
Homo_sapiens|93736                  GGTCCTGGTGAAGTCATCCCAGGAGGAAACCACAGTCTGTATTCTTTGAAGGGCTGCTGC
Pan_troglodytes|37055               GGTCCTGGTGAAGTCATCCCAGGAGGAAACCACAGTCTGTATTCTTTGAAGGGCTGCTGC
Otolemur_garnettii|2666             GGTCCCGGTGAGGTTATCCCAGGAGGAAACTACAGCCTGTATTCTTTGAAGGATTGCTGC
Dasypus_novemcinctus|94             GGTCCCAGTGCAGTCGTCCCAGGAGGAAACCACAGCCTGTATTCTTTGAAGGGCTGTTGC
Oryzias_latipes|21673               GAGCCATGGAACGTGACGGCTGGGGGAGGATTCACCCAGAGCAGCCTGCGGGGTTGCTGC
Tetraodon_nigroviridis|3766         GACCCATGGAACATAACAATCAGCAACGGATTCAGTGAGAGCAGCCTGCGACAGTGCTGT
Fugu_rubripes|5460                  GAGCCGTGGAACATAACAATCAGCGAGGGATTCAATGAGAGCAGCCTGCGGCAGTGCTGT
                                                                                                

Caenorhabditis_elegans|24820        ---------------------------------------------------TAA
Macropus_eugenii|618                CTGGTGCTGAATCAAACTACATTTAACTGTGATTGGGTCGCTACCTCATTCTGA
Nematostella_vectensis|19532        ---------------------------------------------------TGA
Tarsius_syrichta|82                 AAGTTGTTGAATCCACCAACGTTTAACTGCAGTTGGATCCCTAATACCTTTTGA
Choloepus_hoffmanni|2733            AAATTGTTGAATCCATCAACATTTAACTGCAGTTGGATCCCTAATAGAGTTTGA
Ornithorhynchus_anatinus|15894      ------------------------------------------------------
Vicugna_pacos|7402                  AGATTGCTGAATCCATCAACACTGAACTGCAGTTGGATCCCTAATGCATTTTGA
Xenopus_tropicalis|2950             CAACTGGTGCACTCTCCATCCTTAAATTGTAGTTGTATTGCTCATTTTTTT---
Anolis_carolinensis|1480            ------------------------------------------------------
Gallus_gallus|22892                 CAAATACTGAATCGAACAACTTTGAATTGC------------------------
Taeniopygia_guttata|18881           CAAATACTGGGTCAACCTTCTTTTCACTGC------------------------
Monodelphis_domestica|26362         CTGATGCTAAATTCAACTACATTCAACTGCGATTGGGTTACTTCCTCCTTCTGA
Myotis_lucifugus|6147               CAATTGTTGAATCCATCATCATTGAACTGCAGTTGGATCCCTGATGCATTCTGA
Erinaceus_europaeus|9218            ACATTGCTGAATCCGTCAACACTGAATTGTAGTTGGATCCCTAATGTATTTTGA
Procavia_capensis|16587             AAATTGTCAAATTCATCAACATTTAACTGCAGTCGG------------------
Ornithorhynchus_anatinus|14328      ------------------------------------------------------
Spermophilus_tridecemlineatus|15987 AAATTGTTGAATCCACCAAATCTGAACTGCAGTTGGATCCCTGACACATTTTGA
Dipodomys_ordii|1002                ACATTGGTGAATCCATCAACACTTAACTGCAGTTGGATTCCCAACACATTTTGA
Tupaia_belangeri|9820               GGATTGTTGAAACCATCCACATTTAACTGCAGCTGGATCCCTAACACATTTTGA
Pteropus_vampyrus|13310             CAGTTGTTGAGTCCATCAACACTGAACTGCAGTTGGATTCCTAATACATTCTGA
Sus_scrofa|2512                     AAATTGCTGACTCCGTCGACGCTGAACTGCAGTTGGATCCCTAATGCATTTTGA
Bos_taurus|25488                    AACTTGTTGAATACACCAACACTGAACTGCAGTTGGATTCCTAACGTACTTTGA
Sorex_araneus|14769                 ACTTTGTTGAATCCTTCAACACTGAACTGCACTTGGATTCCAAATGTATTTTGA
Equus_caballus|15106                GAATTGTTGAAGCCATCAACACTGAACTGCACTTGGATCCCTGACGAACTCTGA
Equus_caballus|15108                GAATTGCTGAAGCCATCAACACTGAACTGCACTTGGATCCCTGACGAACTCTGA
Mus_musculus|11155                  AACCTGCTGAAACCACCAACGCTGAACTGCAATTGGATCCCTAATAAATTGTGA
Rattus_norvegicus|14768             AACCTGCTGAAACCACCAACGCTGAACTGTGGTTGGATCCCTAACATACCGTGA
Loxodonta_africana|22574            AAATTGTTGAATCCATCAACATTTAACTGCAGTTGGGTCTCTAATACATTTTGA
Canis_familiaris|612                AAGTTGTTAACTCCACCAACACTGAACTGCAGTTGGATCCCTGATGCATTTTGA
Felis_catus|45683                   NNNNNNNNNNNNNNNNNNNNNNNNNNCTGCAGTTGGATCCCTAATGCATTTTGA
Cavia_porcellus|2593                AAAGTGTTGATTCCACCTCCACTCAACTGCAGCTCGATCCTGAATGCCTTCTGA
Ochotona_princeps|1261              AAA---TTGAAGCCATCAGCATTTAACTGCAGTTGGATCCATAATACGTTTTGA
Oryctolagus_cuniculus|21323         AAA---TTGAACCCATTGACATTTAACTGCAGTTGGATCCCGAATACATTTTGA
Microcebus_murinus|10641            ------------------------------------------------------
Callithrix_jacchus|43513            ACATTGTTGAATCCATCAACCTTTAACTGCAGTTGGATCTCTAATACATTTTAA
Gorilla_gorilla|5611                ACATTGTTGAATCCATCAACTTTTAACTGCAATGGGATCCCTAATACATTTTGA
Rhesus_macaque|15650                ACATTGTTGAATCCATCAACATTTAACTGCAGTTGGATCCCTAATATATTTTGA
Pongo_abelii|27761                  ACATTGTTGAATCCATCGACCTTTAACTGCAGTGGGATCCCTAATACATTTTGA
Homo_sapiens|93736                  ACATTGTTGAATCCATCGACCTTTAACTGCAATGGGATCTCTAATACATTTTGA
Pan_troglodytes|37055               ACATTGTTGAATCCATCGACCTTTAACTGCAATGGGATCCCTAATACATTTTGA
Otolemur_garnettii|2666             AAATTGCTGAATCCATCAACACTTAACTGCAGTTGGATCCCTACTACATTTTGA
Dasypus_novemcinctus|94             AAATTGTTGACTCCATCAACATTTAACTGCAGTTGGATCCCTAATGAGTTTTGA
Oryzias_latipes|21673               GCACTCGCACCCCCAGAACATTTCAACTGCAGTCTGGCACAAAATAAAGCC---
Tetraodon_nigroviridis|3766         CTGCTTACACCCGCCGCACAATTTAACTGCAGCCTTATT---------------
Fugu_rubripes|5460                  ---CTGCTCACGCCCTCTGCACAAGCCTGCAATTATGTCAAAAATATTTTG---
                                                                                          

multiple sequence alignment in CLUSTALW format


Caenorhabditis_elegans|20327        ------------------------------------------------------------
Macropus_eugenii|570                ---------------------------------------IKEEDIKNQNGSG-RYSLRNR
Nematostella_vectensis|11676        ------------------------------------------------------------
Tarsius_syrichta|81                 -------------------------------------------KEENQNKAGNNNVMRSR
Choloepus_hoffmanni|2412            -------------------VELTSVTASGAEGHSNSVFQDDEDFLENKNTSVNNSSLRSR
Ornithorhynchus_anatinus|5203       ---------------------------------------------------SPSNRVRNR
Vicugna_pacos|6874                  -------------------VELLRMTALRTQGHSNTGFQDEEGFSENQNTSGNDNSASSR
Xenopus_tropicalis|3492             ------------------------------------------------------------
Anolis_carolinensis|1129            ------------------------------------------------------------
Gallus_gallus|12835                 ------------------------------------------------------------
Taeniopygia_guttata|5661            ------------------------------------------------------------
Monodelphis_domestica|15301         ------------------------------------------------------------
Myotis_lucifugus|5535               -------------------MELRTVTASEADSYQNTAFQNEEDINENQNTSG-NNSIRNR
Erinaceus_europaeus|7582            -------------------VELGELPAPTAQGYSNTGFQXXXXXXXXXXXXX-XXXXXXX
Procavia_capensis|15521             -------------------------------GCNNAAFQDENDFLKNGNTTG-NDLPRSR
Ornithorhynchus_anatinus|26687      ------------------------------------------------------------
Spermophilus_tridecemlineatus|14308 -------------------MELTSTAAPKTEGFSNTGFRNEE-LLENQNISG-NSSIRSR
Dipodomys_ordii|931                 ----------------------------------------DESILENQNASG-NNSIRSR
Tupaia_belangeri|8505               ------------------------------------------------------------
Pteropus_vampyrus|12545             -------------------MELKSVTATGAEGYRNTGFQSEEDLHEYQNTSGNNNSLRSR
Sus_scrofa|11653                    --------------------------------------------VESQNTSGNDNSLRSR
Bos_taurus|575                      -------------MSSKISVELQRVAALPAQGCSNTGFQNDEDGFENQNPSGNDHSLRNR
Sorex_araneus|13136                 -------------------MELGKVPAPRAKGYSNTGFQTEEDVHENQNTSR-YSSLRGR
Equus_caballus|18253                ------------------------------------------------------------
Equus_caballus|8856                 ---------------------------------------------ENQNTSGNDSSLRSR
Mus_musculus|12059                  MSRAD--PGKNSEPSESKMSLELRPTAPSDLGRSNEAFQDED--LERQNTPG-NSTVRNR
Rattus_norvegicus|448               MSRSDPDPGKNSEPSKSKMSLELRPTAPSDQGRLNEAFQDED--LEEQNAPG-NSTVRSR
Loxodonta_africana|19930            ----------------------------------------EDGFLKNGNTSG-KDSLRSR
Canis_familiaris|13615              ------------------------MTTPRAEGCSNTGFQNDEDLDENQNTSGNNNSLRCR
Felis_catus|11764                   -------------------VELKSRTAARAEGYSNTGFQNEDDFDEKQNTSGNNNSLRCR
Cavia_porcellus|2032                -------------------------------------FFQDEN-LENQNMSG-NNLVRSR
Ochotona_princeps|1096              -------------------MELKDRAARGAEGFNNTAFQIEENFLENQNVSENNNSIRSG
Oryctolagus_cuniculus|7760          ---------------------------------------IEDNFLENQNTSENNSSVRNR
Microcebus_murinus|9029             -------------------MELNSMAAPGAQGCSNTGFQEEENCLKNQNTSENNNSIRNR
Callithrix_jacchus|34835            -------------------MELRSTAAPRAKGYSNTAFQNEENFLENENTSGNNNSIRSG
Gorilla_gorilla|5256                -------------------MELRSTAAPRAEGYSNVGFQNEENFLENENTSG-NNSIRSR
Rhesus_macaque|8524                 -------------------MELRSTAAPRAEGYSNTGFQNEENFLENENTSGNKNSVRSR
Pongo_abelii|891                    -------------------MELRSTAAPRAEGYSNTGFQNEENFLENENTSGNNNSITSR
Homo_sapiens|67131                  -------------------MELRSTAAPRAEGYSNVGFQNEENFLENENTSG-NNSIRSR
Pan_troglodytes|14404               -------------------MELRSTAAPRAEGYSNVGFQNEENFLENENTSG-NNSIRSR
Otolemur_garnettii|2293             -------------------MELNSMAPPTAEGHRNAGFQXXXXXXXXXXXXX-XXXXXXX
Dasypus_novemcinctus|84             -------------------KELRSAVASVTEGHSNAAFQXXXXXXXXXXXXX-XXXXXXX
Oryzias_latipes|6103                ------------------------------------------------------------
Tetraodon_nigroviridis|8944         ------------------------------------------------------------
Fugu_rubripes|25876                 ------------------------------------------------------------
                                                                                                

Caenorhabditis_elegans|20327        -------MKISDVEENSTPQKENVLQRSCSLTSK-------------SLQNNLNIIEKFG
Macropus_eugenii|570                NECNGERINSQQEEE-HVTIEQDLPKRKESIEES----ESTHQKG--XXXXXXXXXXXXX
Nematostella_vectensis|11676        ------------------------------------------------------------
Tarsius_syrichta|81                 VVQSGEHVNTGQXXXXXXXXXXXXXXXXXXXXXX----XXXXXXX--YLERKYDTVCDFY
Choloepus_hoffmanni|2412            VVQNREQENTKQGEECTIAIEQEPPKNREDTEDD----QDTHQKG--YLEKKYDEVCDFF
Ornithorhynchus_anatinus|5203       NLLNGEDGNVTQETE-HITIEVDTLDNKLDEETD---ETETVNKG--FLETKYDEGCAFY
Vicugna_pacos|6874                  DVQNREPENSEQXXXXXXXXXXXXXXXXXXXXXX----XXXXXXX--XXXXXXXXXXXXX
Xenopus_tropicalis|3492             ------------------------------------------------IERKYDNVCSFC
Anolis_carolinensis|1129            -----------------------------------------------YLEKKYDTVLHFF
Gallus_gallus|12835                 -----------------------------------------------LLEKKYHKACNFC
Taeniopygia_guttata|5661            ------------------------------------------------------------
Monodelphis_domestica|15301         -----------------------------------------------YLEKKYDATCDFL
Myotis_lucifugus|5535               VVQNSKHVNAKQGEE-QVPIEQDSLRNEEDEEDD----QVMHPNG--XXXXXXXXVCDFR
Erinaceus_europaeus|7582            XXXXXXXXXXXXLEE-QVVIEQDSPEYKEDVENX-----XXXXXXXXYLARKYGAVCDFC
Procavia_capensis|15521             AVHKGERVDSKQREE-CVSVEQDFQENTGDMEDD----EDMQPKG--YLEKKYDAVCGIY
Ornithorhynchus_anatinus|26687      ------------------------------------------------------------
Spermophilus_tridecemlineatus|14308 VVQSREQGNTKQGEE-LVNIEQDSLRKEEEEDME----DDQ------YLERKYDTVYDFY
Dipodomys_ordii|931                 AVQSREQGNTEQGEEAQVTIEQDALRNKEDTEED-------MPKG--XXXXXXXXXXXXX
Tupaia_belangeri|8505               --------------E-KVSIEQGSPGIKKDMNDD----QEIHQK---CLEKKYDLICDFC
Pteropus_vampyrus|12545             DAQNREHVNAKQSEE-QVTIEQDSPRNKDNEDGD----QETHQKG--XXXXXXXXXXXXX
Sus_scrofa|11653                    VVQNREDENGKQDEE-QVTIEEDSPRKEEEEED-----QETHQKGYRCLENKCGTVYDFY
Bos_taurus|575                      VVQNREHENGKQVEE-HITIGQDSLRKDEEEEDD----QETHRKGYRCLERMCGRMSDFC
Sorex_araneus|13136                 VVQNKAPGNSNQDEE-QVTIE-------DNLEDD----QEIHEEG--FLEKKCSRICNFC
Equus_caballus|18253                -----------------------------------------------YLERNYGTVRDFC
Equus_caballus|8856                 AVQSRGHGKAKQDEE-QVTIELDSPRNKEDAKDD----QETHPKG--YLERKYGMIRDFY
Mus_musculus|12059                  VVQSGEQGHAKQDDR-QITIEQEPLGNKEDPEDD---SEDEHQKG--FLERKYDTICEFC
Rattus_norvegicus|448               VVQSGEQGRAKQDDR-QITIEQEPLGPKEGTEEE---SEDERQKG--FLERKYDTVCEFC
Loxodonta_africana|19930            AVQKGEPVNTKQGEE-CVSIEQDSPKNTEDMEDS----EDMHPKG--YLEKKYDAVCDIC
Canis_familiaris|13615              VSKGREHENAKQDEE-QITIEQDSLRNKEDMEDD----PETHQKGYRYLERKYDTVCDFY
Felis_catus|11764                   AVQ-----NTQQDEE-QVTIEQDSLRNKEDVEDD----PEAHQKG--YLERKYDTVCDFY
Cavia_porcellus|2032                VVQNGEQGTPKQGEE-HITIEQDSLGNKDEDEDD----QDTLPKG--CLERKYNKIRDFC
Ochotona_princeps|1096              AVQSGEQMNSKQDEE-QVTIQQDSPRNKDNDSDV---DEENHPKG--CLERKYDTILDFC
Oryctolagus_cuniculus|7760          AVPSGEQGNTKQGEE-QVIIEQDPARNKDDDDDDNEVDEEMHAKG--CLARKYDRVCDFC
Microcebus_murinus|9029             AVQSGEHGNTKQGEE-QVTIEQDSPRNKDDVEDD----QEMHEKG--CLERKYNTVCDFC
Callithrix_jacchus|34835            AAQRGEHTNTKQGEE-QVTVEPDSPRNKEDMEDD---DEEMQPKG--CLERRYDTVCGFC
Gorilla_gorilla|5256                AVQSREHTNTKQDEE-QVTVEQDSPRNKEDMEDD---DEEMQQKG--CLERRYDTVCGFC
Rhesus_macaque|8524                 AVQSREHTDTKQDEE-QGTVEQDSPRNKEDMEDD---EEEVQQKG--CLERRYDTVCGFC
Pongo_abelii|891                    AVQSREHANTKQDEE-QVTVDQDSPRNKEGTEDD---EEEMQQKG--CLERRYDTVCGFC
Homo_sapiens|67131                  AVQSREHTNTKQDEE-QVTVEQDSPRNREHMEDD---DEEMQQKG--CLERRYDTVCGFC
Pan_troglodytes|14404               AVQSREHTNTKQDEE-QITVEQDSPRNREHMEDD---DEEMQQKG--CLERRYDTVCGFC
Otolemur_garnettii|2293             XXXXXXXXXXXXGED-HVTIERDSPRNKDDVEDD----QEMHEKG--CLERKYDIVCDFC
Dasypus_novemcinctus|84             XXXXXXXXXXXXGEE-CITIEQDPPKDTDNIEDG----QDTRQKG--YLGKKYDTVCGFY
Oryzias_latipes|6103                -----------------------------------------------FLEKKLKGLQSFW
Tetraodon_nigroviridis|8944         --------------------------------------------------RQMEVFQDYW
Fugu_rubripes|25876                 ----------------QMQMNNDGVCGKETGEEN----SKAGHHDKSILEKKMTAFQDYL
                                                                                                

Caenorhabditis_elegans|20327        QQIRPYFGIGSLLIFLVVYHGFLVAAGIHNYQKAAPLIYVTLFFWICYLLNLIVGTKTFR
Macropus_eugenii|570                XXXXXXXXXXXXXXXXXXFLTLVTAACVVNFHRALPLFVLTVATIFFVIWDYLIGKYESQ
Nematostella_vectensis|11676        --------MVILTTLLLIY--SIVAIIISGFEKVKILFAITMFLWFCLIYMFISAHWGSA
Tarsius_syrichta|81                 RKHKTMVRYIIWGILLAGYLVVVIAACVLNFHRALPLFVITVAAIFFVIWDRLMAKYEHR
Choloepus_hoffmanni|2412            RKHKTTLRYIIWGILLAGYLSVVIAACVLDFHRALPLFVITMIIIFFVIWDYLMAKYEDR
Ornithorhynchus_anatinus|5203       RKHETVIRYVIIGLLSAGFLAMVIAACVLNFKRALPLFLFLVAVILFVSWDYLMPRYEEK
Vicugna_pacos|6874                  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Xenopus_tropicalis|3492             QKHRRLIKHIIYGILLAGFLAMVIAACVLNFRRALALFVLTLLGIFFVFWDLFMDRYEGK
Anolis_carolinensis|1129            KKHKTIIRQVVYGILAAAYLAMVIAACTLNFHRALPLFVLTILAIFFICWDFLMAKYENR
Gallus_gallus|12835                 KKHRTRINYVMYRILITVYLAVVIAACSLNFQRALPLFIITVLAIFFICWDFLVAKYEDR
Taeniopygia_guttata|5661            ---KTNLTDMHILLSVTAYLAVVIAACSLNFQRALPLFVITILAIFFICWDFLIAKYEDR
Monodelphis_domestica|15301         RKHKVVVQYIIYGVLLAGYLALVIAACVVNFYRALPLFVLTVVAISFVIWDYVIAKCEGH
Myotis_lucifugus|5535               RKHRTTIRYIIWGILLAGYLAMVIAACVLNFHRALPLFVITVVAIFFVIWDHFMAKYEHQ
Erinaceus_europaeus|7582            RRHKTTLRYILWGVLLIGYLAIVIAACVLNFQRALPLFVITVAIVFFVAWDFFMAKYEHR
Procavia_capensis|15521             QKYKTTLKYILWGILSAGYLALVITACVLNFRRAFPLFVIPVAVIFFLVWDYLMAKYEEQ
Ornithorhynchus_anatinus|26687      ------------------------------------------------------------
Spermophilus_tridecemlineatus|14308 KKHKTTIRYIIWGILLAGYLALVIAACVLNFHRALPLFGITVAAIFFVVWDHLMAKYEHR
Dipodomys_ordii|931                 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Tupaia_belangeri|8505               KKHKTILRYIIWGILIAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Pteropus_vampyrus|12545             XXXXXXXXXXXXXXXXXXYLAMVIAACVLDFHRALPLFVITVAASFFVVWDHLMAKYEHR
Sus_scrofa|11653                    REHKTTLQYILRGILLAGYLALVIAACVLNFHRALPLFVITVVVIFFVVWDRFMAKYESQ
Bos_taurus|575                      REHKTTLRYIIWGILIAGYLALVIAACVMNFHRALPLFVITVVAIFFVVWDHLMAKYESQ
Sorex_araneus|13136                 KRHKIIFHYIFWGVLLAGYLAAVIAACVINFHRALPLFVLTVAVIFFVTWDHLMAKYEPR
Equus_caballus|18253                QKHKTTLRYILWGTLLAGYLAMVIAACGLNFHRALPLFVITVAAIFFVVWDHFMAKYDHR
Equus_caballus|8856                 QKHKTTFRYIFWGILLAGYLAVVIAACALNFHRALPLFVITVAAIFFVVWDHFMAKYEHR
Mus_musculus|12059                  RKHRVVLRSTIWAVLLTGFLALVIAACAINFHRALPLFVITLVTIFFVIWDHLMAKYEQR
Rattus_norvegicus|448               RKHRVILQHTIWAVLLTGFLALVIAACALNFHRALPLFVITLVTIFFVVWDRLMAKYEQR
Loxodonta_africana|19930            RKHKTTLKYIIWGILLAGYLAMVIAACVLNFRRALPLFVITVAVIFFLVWDYLMAKYEDR
Canis_familiaris|13615              KKHKTIFQYIIWGILILGYLAMVIAACVLNFQRALALFVITVAAIFFVIWDYFMAKYEHQ
Felis_catus|11764                   KKHKTTLQYILWGILIVGYLAMVIAACALNFHRALPLFVITVAVIFFVVWDYFMAKYEHR
Cavia_porcellus|2032                TKHKVILRYIIWGILLVGYLAMVIAACVLNFRRALPLFVITVAAIFFVIWDHLMAKYESR
Ochotona_princeps|1096              RKHKTTLQYITWGILLTGYLLLVITACVLNFHRALPLFVITMAAIFFVIWDHLMARYEHR
Oryctolagus_cuniculus|7760          RKHKTTLRYIIWGILLAGYLVLVTTACVLNFHRALPLFVITVAAIFFVIWDRLMVKYERR
Microcebus_murinus|9029             RKHKTILRYIIWGILLAGYLALVIAACVLNFHRALPLFVITVTAIFFVVWDRLMARYEHR
Callithrix_jacchus|34835            RKHKTTLRHIIWGMLLAGYLVMVIVACVLNFHRALPLFVITVVAIFFVVWDHLMAKYEHQ
Gorilla_gorilla|5256                RKHKTTLRHIIWGILLAGYLVMVISACVLNFHRALPLFVITVAAIFFVVWDHLMAKYEHR
Rhesus_macaque|8524                 RKHKISLRHIIWGILLAGYLVMVIAACVLNFHRALPLFGITVAAIFFVVWDHLMAKYEQR
Pongo_abelii|891                    RKHKTILWHIIWGILLAGYLVMVISACVLNFHRALPLFVITVAAIFFVVWDHLMAKYEHR
Homo_sapiens|67131                  RKHKTTLRHIIWGILLAGYLVMVISACVLNFHRALPLFVITVAAIFFVVWDHLMAKYEHR
Pan_troglodytes|14404               RKHKTTLRHIIWGILLAGYLVMVISACVLNFHRALPLFVITVAAIFFVVWDHLMAKYEHR
Otolemur_garnettii|2293             RKHKTILRYIIWGILLAGYLAMVIAACVLNFQRALPLFVITVTAIFFVIWDHLTARYEPR
Dasypus_novemcinctus|84             RKHKTIFWHIIWGILLAAYLCVVIAACVLDFHRALPLFVITVVVIFFVVWDYLIAKYEDR
Oryzias_latipes|6103                ARHKSQVRLIMNLVLAAGFVAMVTAACIVKFHRAVGLLVISLVTIFFLVWDWMMERYGDQ
Tetraodon_nigroviridis|8944         NQHRDLICLVAKIVLAAVFIALVIVACIIDLHRALGLLVFTLLAIFFYFWDRLVERYGSW
Fugu_rubripes|25876                 HQHSDQISLVAKIVLVTAFFVMVIIACVLNLQRALGLLILTLLAVFFYVWDWLMKRYGSW
                                                                                                

Caenorhabditis_elegans|20327        AVYDDVGRKLEEITEQKKFVPLSLKIAFIFALLAFTIIDSIH-DLTRLTGFFAYVFYILF
Macropus_eugenii|570                IA-EFLSPAGRFLNKHWFWLKWLMWILLIWGVICWLIFDTAKQGTQSL-SFGGXXXXXXX
Nematostella_vectensis|11676        IYRALFKPIARVIQGQWYWLKWVCIVVILALLALFLGLDNHD-EPERLISLAGLCVNILV
Tarsius_syrichta|81                 ID-EILSPGRNLLSSHWFWLKWVIWSSLILVVIFWLIFDTAKLGQRQLVSFGGLIMYIVL
Choloepus_hoffmanni|2412            ID-AFLSPSKRLLDGHWFWLKWVIWISLILWVILWLILDTAKLGQQQLVSFGGLIMYIVL
Ornithorhynchus_anatinus|5203       IA-GLFSRGHGFLNKQWFWLKWVLWSSLIIGVIFWLIFDTAKLGKQNLVSFGGLIVFIVL
Vicugna_pacos|6874                  XX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Xenopus_tropicalis|3492             IV-KLFSPIGTFTKKHWFWMKWVIWISLVAGVICWLIFDTAKMGANQLISFGGLVMYVLL
Anolis_carolinensis|1129            IA-KSLSPFGKFLNKQWFWLKWVVWISLITAIVCWLIFDTAKQGAKQLISFAGLVVYVLL
Gallus_gallus|12835                 IA-AFFSPGERYLEKQWFWLKWVLCAALIVAIIFWLIFDTAKQGSHQLISFGGLVMYILL
Taeniopygia_guttata|5661            IA-AFFSPGDRYLKKQWFWLKWVLCAALIIMIICWLIFDTTKRGSSQLISFGGLVMYIVL
Monodelphis_domestica|15301         IA-GFLSPGGRVLNKHWFWLRWLMWILLIIAVICWLIFDTAKQGTQPLVSFGGLVFYVLL
Myotis_lucifugus|5535               ID-EFLSPGRRLLDSHWFWLKWVIWSSLILGVIFWLIFDTAKLGQQQLVSFGGLNIYIIL
Erinaceus_europaeus|7582            VI-EFLSPGRRLLNRHWFWLKWVIWSSLVLGSLFWLIFDTAALGSQQLISFGGLIMYMTL
Procavia_capensis|15521             ID-EFLSPGRRRLYSQWFWLKWVLWSSLILAVIFWLIFDTAKLGRQQLVSFGGLVMFLLL
Ornithorhynchus_anatinus|26687      -------------------LKFFLW-----------------------------------
Spermophilus_tridecemlineatus|14308 ID-EIISPGKMLLNSHWFWLKWVIWSLLILGIIFWLIFDTAKLGQQQLVSFGGLIMYIIL
Dipodomys_ordii|931                 XX-XXXXXXXXXXXXXXXXXXXVIWSLLILGVIFWLILDTAKLGKQQLVSFGGLITYIIL
Tupaia_belangeri|8505               XX-XXXXXXXXXXXXHWFWLKWVIWSLLILGVIFWLIFDTARLGQQQLISFGGLIMYIVL
Pteropus_vampyrus|12545             VD-EFLSPGRRLLDSHWFWLKWVIWSSLILGIIFWLVFDTAKLGQQQLVSFGGIIMYIIL
Sus_scrofa|11653                    ID-KFLSPGRKLLDSHWFWLKWVTWGSLILGVILWLIFDTAKLGQQQLVSFGGLIMYISL
Bos_taurus|575                      IA-RFLSPGQRLLDSHWFWLKWVIWGCLILGVILWLVFDTAKLGQQQLVSFGGLIIYTSL
Sorex_araneus|13136                 VI-ECLSPGRRLVDNHWFWLKWVIWSALILVVILWLALDTAKLGQQQLVSFGGLIMYIVL
Equus_caballus|18253                IE-ELLSPGRRFLDSHWFWLKWVIWSSLILGVVFWLIFDTAKLGKWQLVSFGGLIVYVIL
Equus_caballus|8856                 IE-ELLSPGRRFLDSHWFCLKWVIWSSLILGVIFWLIFDTAKLGQRQLVSFGGLIMYVIL
Mus_musculus|12059                  ID-DFLSPGRRLLDRHWFWLKWVVWSSLILAIILWLSLDTAKLGQQNLVSFGGLIMYLIL
Rattus_norvegicus|448               ID-DVLSPGKRLLERHWFWLKWVVWCSLILAVILWLALDTARLGQQQLISFGGLVMYIVL
Loxodonta_africana|19930            ID-ELLSPGRSLLNRHWFWLKWVLWSSLILGVIFWLIFDTAKLGRQQLVSFAGLVMFLLL
Canis_familiaris|13615              ID-ECLSPAKGLLNSHWFWMKWVVWSLLILGVILWLIFDTAKLGQQQLISFGGLVMYIIL
Felis_catus|11764                   IN-ECLSPGKRLLNSHWFWMKWVIWSLLILGVIFWLILDTAKLGQQQLVSFGGLIMYIIL
Cavia_porcellus|2032                ID-EILSPGRRLLDSHWFWIKWVMWSLLILGIIFWLILDTAKLGQQQLVSFGGLVMYILL
Ochotona_princeps|1096              LD-DLLSPGRRLLNHHWFWLKWVIWSLLILAVMFWLILDTAKLGQQQLVSFGGLIMYVIL
Oryctolagus_cuniculus|7760          MD-EILSPGRGLLNRHWFWLKWVIWSSLILAVMCWLILDTAKLGQQQLVSFGGLLMYVTL
Microcebus_murinus|9029             VD-EILAPGRRLLNGHWFWLKWVIWSCLSLGVIFWLVLDTARMGRQHLVSFGGLIMYITL
Callithrix_jacchus|34835            ID-EMLSPGRKFLSGHWFWLKWVIWSSLVLAVIFWLAFDTAKLGQQQLVSFGGLIMYIVL
Gorilla_gorilla|5256                ID-EMLSPGRRLLNSHWFWLKWVIWSSLVLAVIFWLAFDTAKLGQQQLVSFGGLIMYIVL
Rhesus_macaque|8524                 IY-EMLSPGRRLLNGHWFWLKWVIWSSLVLAVIFWLAFDTAKLGQQQLVSFGGLVTYIVL
Pongo_abelii|891                    IY-EMLSPGRRLLNSHWFWLKWVIWSSLVLAVIFWLAFDTAKLGQQQLVSFGGLITYIVL
Homo_sapiens|67131                  ID-EMLSPGRRLLNSHWFWLKWVIWSSLVLAVIFWLAFDTAKLGQQQLVSFGGLIMYIVL
Pan_troglodytes|14404               ID-EMLSPGRRLLNSHWFWLKWVIWSSLVLAVIFWLAFDTAKLGQQQLVSFGGLIMYIVL
Otolemur_garnettii|2293             ID-ELLSPGRRFLDSHWFWLKWVIWSSLILATIFWLILDTAKRGQQNLVSFGGLIMYLVL
Dasypus_novemcinctus|84             IA-AFLSPGRRLLDSHWFWL-WVIWIMLILGVIFWLILDTAKLGQQQLISFGGLVMYIIL
Oryzias_latipes|6103                VW-EVLAPVKNILKRNWVWFRWILYVLLLAAVVCWLVLDTAQRGTRQLLSFGGLLFLVFS
Tetraodon_nigroviridis|8944         MW-EASSPIRCLLSRNWFWMRCVLYASLLVLTVLWLVLDTAKQGTRQIVSFFGLLLFVLL
Fugu_rubripes|25876                 MW-EASSPIRCLLSRSWVWMRWVALVSLLVFVVLWLVLDTAQRGPRQMVSFLGLLLLIFL
                                                                                                

Caenorhabditis_elegans|20327        MFVFSNNRMKINWSVVSSALIMHYCVALIILKWSTGQWFFQKFAELIVGFLEFAQVGAKF
Macropus_eugenii|570                XXXXXXXXXXVFWRPVFWGIGLQFLLGILILRTTPGFEAFNWLGNQVQTFLEYTDTGATF
Nematostella_vectensis|11676        CWLFSKNRRKIRWRPVFWGLALQFIFGLLILRTPQGFSVFNFFGRNIQAFLDFTNEGAKF
Tarsius_syrichta|81                 LLLFSKYPTRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFLEYTDAGASF
Choloepus_hoffmanni|2412            VFLFSKHPTRVYWRPIFWGIGLQFLFGLLILRTKLGFMAFDWLGRQVQTFLGFTDAGASF
Ornithorhynchus_anatinus|5203       MLIFSKYPTKV-------------------------------------------------
Vicugna_pacos|6874                  XXXXXXXXXXVYWRPVFWGIGIQFLLGLLILRTKPGFMAFDWLGKQVQTFLAYSDAGASF
Xenopus_tropicalis|3492             MFIFSKHPTKVRWRQVFWGIGLQFLLGLLILRTKPGFDAFDWLGIQVQVSLCVNTSNMAV
Anolis_carolinensis|1129            MLIFSKYPTKVVWRPVFWGIGLQFVLGLITLRTKVGFDAFNWLGVQVQTFLGYTDAGSKF
Gallus_gallus|12835                 MFIFSKYPTRVAWRPVFSGIVMQFILGLLILRTKVGFDVFNWLGIQIQTFLEYSDTGAKF
Taeniopygia_guttata|5661            MLLFSKYPTQVAWRPVFSGIGMQFILGILILRTKVGFDVFNWLGIQIQTFLEYSDAGAKF
Monodelphis_domestica|15301         MFIFSKHPTRVFWRPVFWGIGLQFVFGVLILRTTYGFEAFNWLGKQVQTFLGYADSGARF
Myotis_lucifugus|5535               LFLFSKYPTKVYWRPVFWGIGLQFLLGLLILRTKPGYIAFDWLGKQVQTFLEFTNAGASF
Erinaceus_europaeus|7582            LFLFSKYPTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFLEFTNAGASF
Procavia_capensis|15521             TFLFSKHPTKVYWRPVFWGIGLQFLT--LLISKKPAFV-FDL---HQVXXXXXXXXXXXX
Ornithorhynchus_anatinus|26687      ------------------------------------------------------------
Spermophilus_tridecemlineatus|14308 LFIFSKYPTRVYWRLVFWGIGLQFLLGLFILRTNSGYIAFNWLGTQVQIFLDYTDAGARF
Dipodomys_ordii|931                 LFLFSKHPTRVHWRPVFWGIGLQFLLGLLILRTKPGFIAFDWLGRQVHXXXXXXXXXXXX
Tupaia_belangeri|8505               AFVFSKHPTKVYWRPVFWGIGLQFLLGLLILRTNPGFVAFDWLGRQVQTFLAYTDAGAVF
Pteropus_vampyrus|12545             LFLFSKYPTKVYWRPVFWGIGLQFLLGLLILRTEAGFKAFDWLGKQVQIFLEYTNAGAIF
Sus_scrofa|11653                    TFLFSKHPTKVSWRPVFWGIGLQFLLGLLILRTKPGFIAFDWLGKQVQTFLEYTDAGALF
Bos_taurus|575                      TFLFSKHPTKVYWRPVFWGIGLQFLLGLLILRTEPGFMAFDWLGKQVQTFLGYSDAGASF
Sorex_araneus|13136                 VFLFSKHPTKVYWRPVFWGIGLQFFLGLLILRTNPGFMAFDWLGTQVQTFLEYTNAGSSF
Equus_caballus|18253                LFLFSKHPTKVHWRPVFWGIGLQFLLGLLILRTGPGLRASQWLGKQVHTFLEHTDAGASF
Equus_caballus|8856                 MFLFSKHPTKVRWRPVFWGIGLQFLLGLIILRTGPGLMAFQWLGKQVQTFLEHTDAGASF
Mus_musculus|12059                  LFLFSKHPTRVYWRPVFWGIGLQFLLGLLILRTRPGFVAFDWMGRQVQTFLGYTDTGARF
Rattus_norvegicus|448               LFLFSKHPTRVYWRPVFWGIGLQFLLGLLILRTRPGFVAFDWMGKQVQTFLGYTDAGAQF
Loxodonta_africana|19930            TFLFSKHPTKVYWRPVFWGIGLQFLIALLILRTEPGFVAFDWLGKQVQTFLGYTDVGALF
Canis_familiaris|13615              VFLFSKHPTKVYWRPVFWGIGLQFLLGLLILRTDPGFMAFDWLGQQVQTFLEYTNAGAEF
Felis_catus|11764                   VFIFSKHPTKVYWRPVFWGIGLQFLLGLLILRTEPGFMAFDWLGKQVQTFLEYTNAGAEF
Cavia_porcellus|2032                LFLFSKHPTRVYWRPVCWGIGLQFLLGLLILRTKPGFIAFDWLGRQVQTFLGYTDAGAVF
Ochotona_princeps|1096              MFLFSKHPTRVYWRPVFWGIGLQFLLGLLILRTKPGYIAFDWLGGQVQIFLEYSDAGASF
Oryctolagus_cuniculus|7760          IFLFSKHPTRVYWRPVFWGIGLQFLLGLLILRTKPGFIAFDWLGKQVQTFLGYTDAGASF
Microcebus_murinus|9029             LFLFSKHPTRVYWRPVFWGIGLQFLLGLLILRTDPGFIAFNWLGKQVQTFLEYTDAGASF
Callithrix_jacchus|34835            LFLFSKYPTRVYWRPVLWGIGLQFLLGLLILRTDPGFIAFDWLGRQVQTFLEYTDAGASF
Gorilla_gorilla|5256                LFLFSKYPTRVYWRPVLWGIGLQFLLGLLILRTDPGFIAFDWLGRQVQTFLEYTDAGASF
Rhesus_macaque|8524                 LFLFSKYPTRVYWRPVLWGIGLQFLLGLLILRTDPGYIAFDWLGRQVQTFLEYTDAGASF
Pongo_abelii|891                    LFLFSKYPTRVYWRPVLWGIGLQFLLGLLILRTDPGFIAFDWLGRQVQTFLEYTDAGASF
Homo_sapiens|67131                  LFLFSKYPTRVYWRPVLWGIGLQFLLGLLILRTDPGFIAFDWLGRQVQTFLEYTDAGASF
Pan_troglodytes|14404               LFLFSKYPTRVYWRPVLWGIGLQFLLGLLILRTDPGFIAFDWLGRQVQTFLEYTDAGASF
Otolemur_garnettii|2293             LFLFSKHPTRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Dasypus_novemcinctus|84             VFLFSKHPTRVYWRPVFWGIGLQFLLGLLILRTKPGFMMFDWLGRQVQXXXXXXXXXXXX
Oryzias_latipes|6103                MMVFSKHPFKWSWRTLLSGIGLQFIFGLLTLRTEFGLQALTWVGNKVEMFLSFTDVGSQF
Tetraodon_nigroviridis|8944         MLVFSKHPFHWSWQALISGTLLQFLIALLIFRTSSGASAVEWIAQKVEILFGFTDVGSKF
Fugu_rubripes|25876                 MLLFSKHPFKWSWRVLVSGILIQFIIALLIFRTSTGDSALKWAANKVEILFAFEDVGSRF
                                                                                                

Caenorhabditis_elegans|20327        VFGFIAGPPNICDLAPVFIFTSLQTLIYFSAVVALLFYFGII-QVVLQKSQWFMKVLIGT
Macropus_eugenii|570                VFGE-KYTDHF------FAFKVLPIVVFFSTVISMLYYLGFM-QWLIRKVGWLMQVTLGS
Nematostella_vectensis|11676        VFGDPTYLDHF------FAFKVLPVIIFFSSFISVCYYIGIM-QVIIKKLAWLMQVTMGT
Tarsius_syrichta|81                 VFGE-KYKDHF------FAFKILPIVIFFSTVMSMLYYLGLM-QWVIRKVGWLMFVTMGS
Choloepus_hoffmanni|2412            VFGE-KYTDHF------FAFKXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXX
Ornithorhynchus_anatinus|5203       ------------------------------------------------------------
Vicugna_pacos|6874                  VFGE-KYTDHF------FAFKVLPIVVFFSTVMSMLYYLGLM-QWIVRKVGWIMLVTMGT
Xenopus_tropicalis|3492             SYGW-SHMQHS------HHLQVLPIVIFFSTIMSMLYYMGFM-QWLIKKVGWFMQKTMGT
Anolis_carolinensis|1129            VFGE-KYTDHF------FAFKVLPIVIFFSTVMSVLYHVGFM-QWLIKKVGWIMQITLGT
Gallus_gallus|12835                 VFGD-KYTDHF------FAFKVLPIVVFFSTVMSMLYHIGFM-QWLVGKVGWIMQIFMGT
Taeniopygia_guttata|5661            VFGD-KYTDHF------FAFKVLPIVVFFSTVMSMLYHVGFM-QWLVGKVGWIMHVFMGT
Monodelphis_domestica|15301         VFGE-KYTDHF------FAFKVLPIVVFFSTVISMLYYLGFM-QWLIRKVGWLMLVTLGS
Myotis_lucifugus|5535               VFGE-KYTDHF------FAFKILPIVIFFSTVMSMLYYLGLM-QWIVRKVGWIMLVTMGS
Erinaceus_europaeus|7582            VFGE-KYTDHF------FAFKVLPIVVFFSTVMSMLYYLGLM-QWVIRKVGWVMLVTMGS
Procavia_capensis|15521             XXXX-XXXXXX------XXXXILPIVVFFSTVMSMLYYLGWM-QWIIKKIGWLMLVTMGT
Ornithorhynchus_anatinus|26687      ------------------------------------------------------------
Spermophilus_tridecemlineatus|14308 VFGE-KYTDHF------FAFKVLPIVVFFSTVMSMLYYMGLM-QWIIRKVGWIMLVTMGS
Dipodomys_ordii|931                 XXXX-XXXXXX------XXXXILPIVVFFSTVMSMLYYLGFM-QWIVRKVGWVMLVTLGS
Tupaia_belangeri|8505               VFGE-KYTDHF------FAFQVLPIVVFFSTVMSMLYYLGLM-QWIIRKVGWLMLITMGS
Pteropus_vampyrus|12545             VFGE-KYTDHL------FAFKVLPIVVFFSTVTSMLYYLGLM-QWIIRKIGWIMLVTMGS
Sus_scrofa|11653                    VFGE-KYTDHF------FAFKVLPIVVFFSTVMSMLYYLGLM-QWVVRKVGWVMLVTMGT
Bos_taurus|575                      VFGE-KYTDHF------FAFKVLPIVIFFSTVMSMLYYLGLM-QWIIRKVGWVMLVTMGT
Sorex_araneus|13136                 VFGE-KYTDHF------FAFKVLPIVVFFSTVMSMLYYLGLM-QWVIRKVGWLMLVTMGS
Equus_caballus|18253                VFGE-NYTDHY------LAFKFLPMVVFFSAVTSMLYYLGLM-QWIIRKIGWLMLVTMGS
Equus_caballus|8856                 VFGE-KYTDHF------FAFKVLPIVVFFSAAINCQSYSDMLDQKSMKCVGWLMLVTVGS
Mus_musculus|12059                  VFGE-KYTDHF------FAFKILPIVVFFSTVMSMLYYLGLM-QWIIRKVGWLMLVTMGS
Rattus_norvegicus|448               VFGE-KYTDHF------FAFKILPIVVFFSTVMSMLYYLGLM-QWIIRKVGWLMLVTMGS
Loxodonta_africana|19930            VFGE-KYTDHF------FAFKILPIVVFFSTVMSMLYYLRLM-QWVIRKIGWLMLVTMGT
Canis_familiaris|13615              VFGD-TYADHL------FAFKVLPIVVFFSTVMSMLYYLGLM-QWIIRKVGWVMLVTMGS
Felis_catus|11764                   VFGE-TYADHF------FAFKVLPIVVFFSTVMSMLYYLGLM-QWIIRKVGWVMLVTMGS
Cavia_porcellus|2032                VFGE-KYTDHF------FAFKILPIVVFFSTVMSMLYFLGLM-QWLIRKVGWTMLVTMGS
Ochotona_princeps|1096              VFGE-KYTDHF------FAFKVLPIVGFFSTVMSMFYYLGLM-QWIIRKIGWVMLVTIGS
Oryctolagus_cuniculus|7760          VFGE-KYTDHF------FAFKVLPIVVFFSTVMSMLYYLGLM-QWVIRKVGWVMLVTMGS
Microcebus_murinus|9029             VFGE-KYKDHF------FAFKVLPIVVFFSTVMSMLYYLGLM-QWIIRK-----------
Callithrix_jacchus|34835            VFGE-KYKDHF------FAFKVLPIVVFFSTVMSMLYYLGLM-QWIIRKVGWIMLVTTGS
Gorilla_gorilla|5256                VFGE-KYKDHF------FAFKVLPIVVFFSTVMSMLYYLGLM-QWIIRKVGWIMLVTMGS
Rhesus_macaque|8524                 VFGE-KYKDHF------FAFKILPIVVFFSTVMSMLYYLGLM-QWIIRKVGWIMLVTTGS
Pongo_abelii|891                    VFGE-KYKDHF------FAFKVLPIVVFFSTVMSMLYYLGLM-QWIIRKVGWIMLVTTGS
Homo_sapiens|67131                  VFGE-KYKDHF------FAFKVLPIVVFFSTVMSMLYYLGLM-QWIIRKVGWIMLVTTGS
Pan_troglodytes|14404               VFGE-KYKDHF------FAFKVLPIVVFFSTVMSMLYHLGLM-QWIIRKVGWIMLVTTGS
Otolemur_garnettii|2293             XXXX-XXXXXX------XXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXIGWVMLVTMGS
Dasypus_novemcinctus|84             XXXX-XXXXXX------XXXXVLPIVVFFSTVMSMLYYLGLM-QWVVRKVGWLMLVTMGS
Oryzias_latipes|6103                VFGD-NYTDHF------FVFRVMPILVFLSSVISILYYVGFM-SWLICKIGFVMQVTMGT
Tetraodon_nigroviridis|8944         IFGK-KYIDHP------FAFKVMPVLLFLSSIVSVLYYVGFM-PWLICKIGYAMQIVMGT
Fugu_rubripes|25876                 VFGE-KFTDHP------FVFKVMPVLLFLSSIISVLYYIGFM-PWLICKIGYAMQVTMGT
                                                                                                

Caenorhabditis_elegans|20327        TPVESVNAWACTFLGMSEAPLMVAPYIEKLTDSEIFAIVTSGFACVAGTVFTAYVALGAC
Macropus_eugenii|570                SPIESVVTAGNIFVGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Nematostella_vectensis|11676        SAVESLNAAGNIFVGQTEAPLLVRPFLSHVTMSELHAIMTGGFATIAGGVLAAYIEFGVS
Tarsius_syrichta|81                 SPIESIVASGNIFVGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Choloepus_hoffmanni|2412            XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIS
Ornithorhynchus_anatinus|5203       ------------------------------------------------------------
Vicugna_pacos|6874                  SPVESVVASGNIFVGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVS
Xenopus_tropicalis|3492             SPTESLVAAGNIFVGQTESPLLIRPYLELLTRSEIHAIMTAGFATIAGSVLGAYISFGVS
Anolis_carolinensis|1129            TPVESLVAAGNIFVGQSESPLLVKPYLPYVTKSELHAIMTAGFATIAGSVLGAYISFGVS
Gallus_gallus|12835                 TPVESLVAAGNIFVGQTESPLLVRPYLPYITKSELHAVMTAGFSTIAGSVLGAYISFGVS
Taeniopygia_guttata|5661            TPVESLVAAGNIFVGQTESPLLVRPYLPYITKSELHAVMTAGFSTIAGSVLGAYISFGVS
Monodelphis_domestica|15301         SPIESVVAAGNIFVGQTESPLLVRPYLSHLTKSELHAVMTAGFATIAGSVLGAYISFGVS
Myotis_lucifugus|5535               SPIESVVAAGNIFVGQSESPLLVRPYLPYITKSELHAIMTAGYATIAGSVLGAYISFGVS
Erinaceus_europaeus|7582            SPIESVVAAGNIFIGQTESPLLVRPYLPYVTKSELHAIMTAGFATIAGSVLGAYISFGVS
Procavia_capensis|15521             SPIESVVASGNIFVGQTESPLLVRPYLPYVTKSELHAIMTAGFSTIAGSVLGAYISFGVS
Ornithorhynchus_anatinus|26687      -------------------------------------------------------EFQVP
Spermophilus_tridecemlineatus|14308 SPVESLVAAGNIFVGQTDSPLLVRPYLPYITRSELHAIMTAGFATIAGSVLGAYISFGXX
Dipodomys_ordii|931                 SPIESVVAAGNIFVGQTESPLLVRPYLPHVTKSELHAVMTAGFATIAGSVLGAYISFGVS
Tupaia_belangeri|8505               SPIESVVAAGNIFVGQTESPLLVRPYLPHVTKSELHAIMTAGFSTIAGSVLGAYISFGVS
Pteropus_vampyrus|12545             SPVESVVAAGNIFVGQSESPLLVRPYLPYITRSELHAIMTAGFSTIAGSVLGAYISFGVS
Sus_scrofa|11653                    SPTESVVASGNIFIGQTESPLLVRPYLPYVTRSELHAVMTTGFATIAGSVLGAYISFGIS
Bos_taurus|575                      SPVESVVASGNIFIGQTESPLLVRPYLPYVTKSELHAIMTAGFSTIAGSVLGAYISFGVS
Sorex_araneus|13136                 SPVESVVAAGNIFIGQTESPLMVRPYLPHITKSELHAIMTAGFSTIAGSVLGAYISFGVS
Equus_caballus|18253                SPVESVVAAGNIFVGYTESPLLVQPYIQHATRSELHAIMTAGFATIAGNVLGPYISFGIS
Equus_caballus|8856                 SPIESVVAAGNIFIGQTESPLLVRPYLPHVTRSELHAIMTAGFSTIAGSVLGAYISFGIS
Mus_musculus|12059                  SPIESVVAAGNIFIGQTESPLLVQPYLPHVTKSELHTIMTAGFATIAGSVLGAYISFGVS
Rattus_norvegicus|448               SPIESVVAAGNIFVGQTESPLLVQPYLPHVTKSELHTIMTAGFATIAGSVLGAYISFGVS
Loxodonta_africana|19930            SPVESVVASGNVFVGQTESPLLVRPYLPYVTKSELHAMMTAGFATIAGSVLGAYISFGVS
Canis_familiaris|13615              SPIESVVAAGNIFVGQTESPLLVRPYLPHITKSELHAIMTAGFSTIAGSVLGAYISFGVS
Felis_catus|11764                   SPIESVVAAGNIFVGQTESPLLVRPYLPHITKSELHAVMTAGFSTIAGSVLGAYISFGVS
Cavia_porcellus|2032                SPIESVVAAGNIFVGQTESPLLVQPYLPYVTRSELHAIMTAGFATIAGSVLGAYISFGVS
Ochotona_princeps|1096              SPIESVVASGNIFVGQTESPLLVRPYLPYITKSELHAIMTAGFSTIAGSVLGAYISFGIP
Oryctolagus_cuniculus|7760          SPIESVVASGNIFVGQTESPLLVRPYLPHVTRSELHAIMTAGFSTIAGSVLGAYISFGIP
Microcebus_murinus|9029             ----------------TESPLLVRPYLPHVTRSELHAIMTAGFSTIAGSVLGAYISFGIP
Callithrix_jacchus|34835            SPIESVVASGNIFVGQTESPLLVRPYLPYITKSELHAIMTAGFSTIAGSVLGAYISFGVP
Gorilla_gorilla|5256                SPIESVVASGNIFVGQTESPLLVRPYLPYITKSELHAIMTAGFSTIAGSVLGAYISFGVP
Rhesus_macaque|8524                 SPIESVVASGNIFVGQTESPLLVRPYLPYITKSELHAIMTAGFSTIAGSVLGAYISFGVP
Pongo_abelii|891                    SPIESVVASGNIFVGQTESPLLVRPYLPYITKSELHAIMTAGFSTIAGSVLGAYISFGVP
Homo_sapiens|67131                  SPIESVVASGNIFVGQTESPLLVRPYLPYITKSELHAIMTAGFSTIAGSVLGAYISFGVP
Pan_troglodytes|14404               SPIESVVASGNIFVGQTESPLLVRPYLPYITKSELHAIMTAGFSTIAGSVLGAYISFGVP
Otolemur_garnettii|2293             SPIESVVASGNVFVGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVP
Dasypus_novemcinctus|84             SPIESVVAAGNIFIGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVS
Oryzias_latipes|6103                SPTESMAAAGNIFLGLTDSPLLIRPYISELTVSEIHAVMTGGFASISGTILGAYISLGVD
Tetraodon_nigroviridis|8944         TSVESVVAAGTIFLGQTESLILVRPYISKLTLSEIHALITVGLAGISGTMFAAYIALGVK
Fugu_rubripes|25876                 TPVESVVAAGTIFLGQAESLILVHPYISRLTLSEIHTLMTVGLAGISGTMLAAYISLGVK
                                                                                                

Caenorhabditis_elegans|20327        PIYLLTASLL-SAPMSLACSKIMFPE----------------------FFDTLCSAGVAL
Macropus_eugenii|570                XXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-DSRNILEAASHGASSS
Nematostella_vectensis|11676        ASHLLSASVM-SAPAALAISKLLYPETETPE-TIEEAIDLPEG-GERNVIEAAAKGASTA
Tarsius_syrichta|81                 XXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXX
Choloepus_hoffmanni|2412            ASHLLTASVM-SAPASLAIAKLFWPETETPKITVKNAMKMENG-DSRNLLEAATQGASSS
Ornithorhynchus_anatinus|5203       ------------------------------------------------------------
Vicugna_pacos|6874                  SSHLLTASVM-SAPAALAISKLFWPETETPKITLKNAMKMESG-DSRNLLEAATQGASSS
Xenopus_tropicalis|3492             SSHLLTASVM-SAPAALAVSKLFWPETEPIKVNMKHGMKLEKG-EARNILEAASQGASAS
Anolis_carolinensis|1129            ATHLLTASVM-SAPAALAIAKLFWPETEQPRITVQRSTNLGKG-DSQNLLEAASQGASSS
Gallus_gallus|12835                 ASHLLTASVM-SAPASLATSKLFWPETEKPKVTLKSGLKMAKG-ESNNLLEAASQGASSS
Taeniopygia_guttata|5661            SSHLLTASVM-SAPASLAASKLFWPETEKPLVTLRSGIQMAKS-ESKNLLEAASQGASTS
Monodelphis_domestica|15301         ASHLLTASVM-SAPASLACAKLFWPETEIPKITLKTALKMEKG-DSRNLLEAASHGASSS
Myotis_lucifugus|5535               PTHLLTASVM-SAPASLA-AKLXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXX
Erinaceus_europaeus|7582            SSHLLTASVM-SAPAALAVAKLFWPETETPKITLKNAMKMENG-DSRNLLEAASQGASSS
Procavia_capensis|15521             PSHLLSASVM-SAPASLAVAKLFWPETETPKITLKNAMKMENG-XXXXXXXXXXXXXXXX
Ornithorhynchus_anatinus|26687      ASHLLTASVM-SAPASLAIAKLFWPETKKPKIIFKDSMKIEKG-DAINLLEAASQGASSS
Spermophilus_tridecemlineatus|14308 XXHLLTASVM-SAPASLAVAKLFWPETEKSKITLKNAMKMEIG-DSRNLLEAATQGASSS
Dipodomys_ordii|931                 STHLLTASVM-SAPASLAVAKLFWPETEKPKITLKNAMKMENG-DSRNLLEAATQGASSS
Tupaia_belangeri|8505               SSHLLTASVM-SAPASLAVAKLFWPETEKPKITLKNAMEMENG-DSRNLLEAATQGASSS
Pteropus_vampyrus|12545             STHLLTASVM-SAPASLAVAKLFWPETETPKITLKNAMEMENG-DSRNLLEAATQGASSS
Sus_scrofa|11653                    SSHLITSSVM-AAPAALAISKLFWPETEKPKITLKNAMKMENG-DSRNLLEAATNGASSS
Bos_taurus|575                      SSHLLTASVM-SAPAALAISKLFWPETETPKINLKNAMKMESG-DSRNLLEAATQGASSS
Sorex_araneus|13136                 SSHLLTASVM-SAPASLAVAKLFWPETEKPKITLKNAMKMEHG-DSRNILEAASQGASSS
Equus_caballus|18253                PAHLLTASVM-SAPASLAVAKLFWPETETPKTTLKDAMKMEMG-DSRNLLEAASYGTSSS
Equus_caballus|8856                 PTHLLTASVM-SAPASLAMAKLLWPETETPKITLKNAMEMEMG-DSRNLLEAASQGASAS
Mus_musculus|12059                  STHLLTASVM-SAPAALAVAKLFWPETEKPKITLKSAMKMENG-DSRNLLEAASQGASSS
Rattus_norvegicus|448               STHLLTASVM-SAPAALAVAKLFWPETEKPKITLKNAMKMENG-DSRNLLEAATQGASSS
Loxodonta_africana|19930            SSHLLTASVM-SAPASLAIAKLFWPETETPKITLKNAMKMESG-ESRNLLEAATQGASSS
Canis_familiaris|13615              PSHLLTASVM-SAPASLAVAKLFWPETETPKITLKNAMKMETG-DSRNLLEAATQGASSS
Felis_catus|11764                   ASHLLTASVM-SAPASLAVAKLFWPERETPKITLQNAMKMESG-DSRNLLEAATQGASSS
Cavia_porcellus|2032                STHLLTASVM-SAPASLAVAKLFWPETEKPKVTLKSAMKMKNG-DSRNLLEAATQGASSS
Ochotona_princeps|1096              SAHLLTASVM-SAPASLAVAKLFWPETEKSKVTLKNAMQMQSG-DSRNLLEAATQGASSS
Oryctolagus_cuniculus|7760          STHLLTASVM-SAPASLAVAKLFWPETEKPKITLKNAMKMEHGSDSRNLLEAATQGASSS
Microcebus_murinus|9029             SAHLLTASVM-SAPASLAAAKLFWPETEKPKITLKNAMKMENG-DSRNLLEAATQGASSS
Callithrix_jacchus|34835            SSHLLTASVM-SAPASLAAAKLFWPETEKPKITLKNAMKMESG-DSGNLLEAASQGASSS
Gorilla_gorilla|5256                SSHLLTASVM-SAPASLAAAKLFWPETEKPKITLKNAMKMESG-DSGNLLEAATQGASSS
Rhesus_macaque|8524                 SSHLLTASVM-SAPASLAAAKLFWPETEKPKITLKNAMKMESG-DSGNLLEAATQGASSS
Pongo_abelii|891                    SSHLLTASVM-SAPASLAAAKLFWPETEKPKITLKNAMKMESG-DSGNLLEAATQGASSS
Homo_sapiens|67131                  SSHLLTASVM-SAPASLAAAKLFWPETEKPKITLKNAMKMESG-DSGNLLEAATQGASSS
Pan_troglodytes|14404               SSHLLTASVM-SAPASLAAAKLFWPETEKPKITLKNAMKMESG-DSGNLLEAATQGASSS
Otolemur_garnettii|2293             SSHLLTASVIVRAPASLAAAKLFWPETEKPKITLKNAMKMESG-DSRNLLEAATQGASSS
Dasypus_novemcinctus|84             SSHLLTASVM-SAPASLAVAKLFWPETETPKITLKNAMKMENR-DSRNLLEAASQGASSS
Oryzias_latipes|6103                ATHLLTASLM-SAPASLAIAKTFWPERNKTVLISIKDLKLING-ENKNLLEAASQGASRT
Tetraodon_nigroviridis|8944         AEHVLTSTVM-SAPASLAIAKTFWPETETSSVKDESGIKIPVD-DNTNVFEAASRGATSA
Fugu_rubripes|25876                 ATYVLTATVM-TAPASLAVGKIFWPETETSQVKDEEDIKTNIE-TNTTVFEAASTGATSA
                                                                                                

Caenorhabditis_elegans|20327        VPTVFAIGATLVVIMSLLAFLDAVMEYIGDLIGYDGWTFQMLFGYAFFPLAYMMGVNDNS
Macropus_eugenii|570                ISLVANIAVNMIAFLALLAFMNSALSWLGNMFDYPQLNFEXXXXXXXXXXXXXXXX--XX
Nematostella_vectensis|11676        IALVANVAANLIAFLAFLAFFNAMLSWLGSMVGHPELSFEFICSYVLRPVAYLMGV--QW
Tarsius_syrichta|81                 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XX
Choloepus_hoffmanni|2412            IGLVANIAVNLIAFLALLSFVNSALSWFGSMFDYPQLSFEXXXXXXXXXXXXXXXX--XX
Ornithorhynchus_anatinus|5203       ------------------------------------------------------------
Vicugna_pacos|6874                  IALVANIAVNLIAFLALLSFVNSALSWFGNMFDYPQLSFEIICSYIFMPFSFMMGV--DW
Xenopus_tropicalis|3492             IPLVANIAVNLMAFLSLLAFFNAALSWLGNMFDYPQLSFEVICSYVFMPFSFMMGV--DW
Anolis_carolinensis|1129            IFLVANIAATLIAFLAVLAFCNAALSWLGNMFDYPQLDFEIICAYVFMPFSFIMGV--DW
Gallus_gallus|12835                 ILLVANIAVNLISFLALLAFIDSALSWVGNLFDYPQLNFENICAYVFMPFSFMMGV--DW
Taeniopygia_guttata|5661            IGLVANIAVNVISFLALLSFLDSALSWVGNLFDYPQLTFENICAYVFMPFSFMMGV--DW
Monodelphis_domestica|15301         VSLVANITVNMISFLALLAFVDSSLSWLGNMFDYPELSFEVICSYVFMPFSFMMGV--DW
Myotis_lucifugus|5535               XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLICSYIFMPFSFMMGV--DW
Erinaceus_europaeus|7582            ISLVANIAANLIAFLALLSFVNSALSWFGNMFDYPQLSFEIICSYIFMPFSFMMGV--DW
Procavia_capensis|15521             XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLCSYIFMPFSFMMGI--DW
Ornithorhynchus_anatinus|26687      ISLVANITVNLIAFLSLLAFVDSALSWLGNMYNYPQLSFKIICSYVFMPLSFLMGI--DW
Spermophilus_tridecemlineatus|14308 IPLVANITVNLIAFLALLSFMNSALSWFGNMFDYPQLSFELICSYIFMPF-FMXXX--XW
Dipodomys_ordii|931                 IPLVANIAVNLIAFLALLSFMNSALSWFGNMFDYPQLSFELICSYLFMPFSFVMGV--DW
Tupaia_belangeri|8505               ISLVANIAVNLIAFLALLSFVNSALSWFGNMFDYPQLSFELICSYIFMPFSFMMGV--DW
Pteropus_vampyrus|12545             ISLVANIAV-LIAFIALLSFMNSALSWFGNMLDYPQLSFELICSYIFMPFSFMMGV--DW
Sus_scrofa|11653                    ISLVANIAVNLIAFLALLSFVNSALSWFGNMFDYPQLSFEIICSYVFMPFSFMMGV--DW
Bos_taurus|575                      ISLVANIAVNLIAFLALLSFMNSALSWLGNMFDYPQLSFEVICSYVFMPFAFMMGV--DW
Sorex_araneus|13136                 ISLVANIAVNLIAFLALLSFVNSALSWFGNMFDYPQLSFEIICSYIFMPFSFMMGV--DW
Equus_caballus|18253                ISLVANIAVNMIAFLALLSFVNAALSWFGNMFDYPQLSFELICSYIFMPFSFMMGV--DW
Equus_caballus|8856                 ISLVANIAVNLIAFLALLSFANAALSWFGNMFDYPQLSFEIICSYIFMPFSFMMGV--DW
Mus_musculus|12059                  IPLVANIAANLIAFLALLSFVNSALSWFGSMFNYPELSFELICSYIFMPFSFMMGV--DW
Rattus_norvegicus|448               IPLVANIAANLIAFLALLSFVNSALSWFGSMFDYPQLSFELICSYIFMPFSFMMGV--DW
Loxodonta_africana|19930            ISLVANIAVNLIAFLALLSFLNSALSWFGNMFDYPQLSFEIICSYIFMPFSFMMGV--DW
Canis_familiaris|13615              ISLVANIAVNLIAFLALLSFVNAALSWLGNMFDYPQLSFEIICSYVFMPLSFMMGV--EW
Felis_catus|11764                   ISLVANIAVNLIAFLALLSFLNAALSWFGNMFDYPQLSFEIICSYIFMPFSFMMGV--DW
Cavia_porcellus|2032                IPLVASIAANLIAFLALLSFVNSALSWLGNMFDYPQLSFELICSYIFMPFSFMMGV--DW
Ochotona_princeps|1096              ISLVANITVNLIAFLALLSFVNSALSWFGSMFDYPQLSFELICSYIFMPFSFMMGV--DW
Oryctolagus_cuniculus|7760          IALVANITVNLIAFLALLSFVNSALSWFGNMFDYPQLSFELICSYIFMPFSFMMGV--DW
Microcebus_murinus|9029             IPLVANIAVNLIAFLALLSFVNSALSWFGNMFDYPQLSFELICSYIFMPFSFMMGV--DW
Callithrix_jacchus|34835            ISLVANIAVNLIAFLALLSFMNSALSWFGNMFDYPQLSFELICSYIFMPFSFMMGV--EW
Gorilla_gorilla|5256                ISLVANIAVNLIAFLALLSFMNSALSWFGNMFDYPQLSFELICSYIFMPFSFMMGV--EW
Rhesus_macaque|8524                 ISLVANIAVNLIAFLALLSFMNSALSWFGNMFDYPQLSFELICSYIFMPFSFIMGV--EW
Pongo_abelii|891                    ISLVANIAVNLIAFLALLSFMNSALSWFGNMFDYPQLSFELICSYIFMPFSFMMGV--EW
Homo_sapiens|67131                  ISLVANIAVNLIAFLALLSFMNSALSWFGNMFDYPQLSFELICSYIFMPFSFMMGV--EW
Pan_troglodytes|14404               ISLVANIAVNLIAFLALLSFMNSALSWFGNMFDYPQLSFELICSYIFMPFSFMMGM--EW
Otolemur_garnettii|2293             IVLVANIAVNLIAFLALLSFVNSALSWFGNMFDYPQLSFELMCSYIFMPLSFMMGV--DW
Dasypus_novemcinctus|84             IGLVANIAVNLIAFLALLSFVNSALSWFGNMLGYPQLSFELICSYIFMPFSFMMGV--DW
Oryzias_latipes|6103                VRLVGSIITNIIAFLALLAFLDCILSWLGGLFDYPQLSFSLICSYVFMPLSFMMGV--SW
Tetraodon_nigroviridis|8944         VGLVVTIVVNLMVFISLMTFLDSILSWFGSLFDCPQLSFALIFSYVFRPLAFMMGV--SW
Fugu_rubripes|25876                 VGLAVTIVVNLMVFISLMSFLDGVLSWFGGLFDFPQLSFSLIFSYLFMPLAFMMGV--SY
                                                                                                

Caenorhabditis_elegans|20327        DQTLLVAQLMGTKTAVNEFVAYNNLGILQKAGK-------------LQPKSVVIATYALC
Macropus_eugenii|570                XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRSEIIATYALC
Nematostella_vectensis|11676        KDCDVVAELLGIKTFLNEFVAYIRLSALIKNRTHLQPGRTISVSR---IRSEIITTYALC
Tarsius_syrichta|81                 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRSETIATYALC
Choloepus_hoffmanni|2412            XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRSETIATYALC
Ornithorhynchus_anatinus|5203       ------------------------------------------------------------
Vicugna_pacos|6874                  QDSFMVAKLIGYKTFFNEFVAYQHLSKLIHLRQEAGPKFVNGVQQYMSIRSETVATYALC
Xenopus_tropicalis|3492             EDSFIVGKLIGYKTFFNEFVAYEYLAGLINKRKESGPMYIEGIKQYMSIRSETIATYALC
Anolis_carolinensis|1129            EDSFIVGGLLGYKTFFNEFVAYEHLSKLIQLRKNGGEMYRDGVKQYLSIRSETIATYALC
Gallus_gallus|12835                 EDSFIVGGLLGYKTFFNEFVAYERLSKLIHNREKGGSMYVNGVKQYMTVRSETIATYALC
Taeniopygia_guttata|5661            EDSFIVGGLLGYKTFFNEFLAYERLSKLIQNREKGGSMYINGVKQYMTVRSEVIATYALC
Monodelphis_domestica|15301         EDSFMVGGLIGYKTFFNEFVAFQQLAKMIKLRKLAGPKFIDGVQQYISVRSETIATYALC
Myotis_lucifugus|5535               QDSFMVAKLLGYKTFFNEFVAYEHLSKLINLRKEAGPKFVNGVQQYMSIRSETIATYALC
Erinaceus_europaeus|7582            QDSFMIAKLIGYKTFFNEFVAYEHLSKLINLRKKAGPKFVDGVQQYMSIRSEIIATYALC
Procavia_capensis|15521             QDSFLVAKLIGYKTFFNEFVAYEHLSKMINLRKQVGPKFVNGQQQYMSVRSETIATYALC
Ornithorhynchus_anatinus|26687      QDSFMVGELLGYKTFFNEFVAYEHLSKLIKLRKQAGPKFIDGVQQYMSVRSEIIATYALC
Spermophilus_tridecemlineatus|14308 QDSFMVGRLIGYKTFFNEFVAYEQLSQLINLRKQGGPKFVNGTQQYMSXXXXXXXXXXXX
Dipodomys_ordii|931                 QDSFMLAKLLGYKTFFNEFVAYEHLSKLINLRKAAGPKFVDGVQQYMSIRSETIATYALC
Tupaia_belangeri|8505               QDSFMVAKLIGYKTFFNEFVAYEQLSKFINLRKEAGPKFVNGVQQYMSIRSETIATYALC
Pteropus_vampyrus|12545             QDSFMVAKLIGYKTFFNEFVAYEHLSTLINLRKEAGPKFVNGVQQYMSIRSETIATYALC
Sus_scrofa|11653                    QDTFMVAKLMGYKTFFNEFVAYQKLSELIHLRQAGGPKFVDGVQQYISIRSETIATYALC
Bos_taurus|575                      QDSFMVAKLIGYKTFFNEFVAYQQLSKLISLRQVGGPKFVDGVQQYMSMRSEAISTYALC
Sorex_araneus|13136                 HDSFMVAKLIGYKTFFNEFVAYEHLSKLINLRKKAGPKFVNDVQQYMSIRSETIATYALC
Equus_caballus|18253                QDSFMVAKLIGYKTFFTEFVAYERLSKLVDLRKEAGPKFVDGVQQYMSIRSETIATYALC
Equus_caballus|8856                 QDSFMVAKLIGYKTFFNEFVAYEHLSKLVHLRKEAGPKFVDGVQQYISIRSETIATYALC
Mus_musculus|12059                  QDSFMVAKLIGYKTFFNEFVAYDHLSKLINLRKAAGPKFVNGVQQYMSIRSETIATYALC
Rattus_norvegicus|448               QDSFMVAKLIGYKTFFNEFVAYEHLSKFINLRKAAGPKFVNGVQQYMSIRSETIATYALC
Loxodonta_africana|19930            QDSFMVAKLIGYKTFFNEFVAYEHLSKLINLRKEAGPKFVNGQQQYMSIRSETIATYALC
Canis_familiaris|13615              QDSFMVAKLIGYKTFFNEFVAYEHLSKLISLRKEAGPQFVNGVQQYMSIRSETIATYALC
Felis_catus|11764                   QDSFMVAKLIGYKTFFNEFVAYEHLSKLINLRKEAGPKFVNGVQQYMSIRSETIATYALC
Cavia_porcellus|2032                QDSFMVAKLIGYKTFFNEFVAYEHLSKLISLRKEAGPKFVNGVQQYMSIRSETIATYALC
Ochotona_princeps|1096              QDSFMVAKLIGYKTFFNEFVAYEHLSRLINLRKEAGPKFVNGVQQYMSIRAETIATYALC
Oryctolagus_cuniculus|7760          QDSFMVAKLIGYKTFFNEFVAYEHLSRLISLRKEAGPKFVNGVQQYMSIRAETIATYALC
Microcebus_murinus|9029             QDSFMVAKLIGYKTFFNEFVAYEHLSKLIDLRKEAGPRFVNGVQQYMSIRSEIIATYALC
Callithrix_jacchus|34835            QDSFMVARLIGYKTFFNEFVAYEHLSEWIHLRKEGGPKFLNGVQQYLSIRSEIIATYALC
Gorilla_gorilla|5256                QDSFMVARLIGYKTFFNEFVAYEHLSKWIHLRKEGGPKFVNGVQQYISIRSEIIATYALC
Rhesus_macaque|8524                 QDSFMVARLIGYKTFFNEFVAYEHLSKWIHLRKEGGPKFVNGVQQYISIRSETIATYALC
Pongo_abelii|891                    QDSFMVARLIGYKTFFNEFVAYEHLSKWIYLRKEGGPKFVNGVQQYISIRSEIIATYALC
Homo_sapiens|67131                  QDSFMVARLIGYKTFFNEFVAYEHLSKWIHLRKEGGPKFVNGVQQYISIRSEIIATYALC
Pan_troglodytes|14404               QDSFMVARLIGYKTFFNEFVAYEHLSKWIHLRKEGGPKFVNGVQQYISIRSEIIATYALC
Otolemur_garnettii|2293             QDSFLVAKLIGYKTFFNEFVAYEHLSKLINLRKEAGPKFVDGVQQYMSIRSEIIATYALC
Dasypus_novemcinctus|84             QDSFMVGKLIGYKTFFNEFVAYEHLSKLINLREAAGPKFVNGEQQYLSXXXXXXXXXXXX
Oryzias_latipes|6103                DDSFLVAELIGLKTFLNEFVAYQRLSEFIKRREAGGPEYVNNIKQYISVHSEMIATYALC
Tetraodon_nigroviridis|8944         EDSGLVAELIGTKTFLNELLAYQKMSKLIKLRKAGGPEYVDNVKQYISAHSEMIATYALC
Fugu_rubripes|25876                 EDSFIVAELIGIKTVLNELLAYQKMSKIIKLRNAGGPEYVDNVKQYISVHSEMIATYALC
                                                                                                

Caenorhabditis_elegans|20327        GFSNFSSMGMSIEFLGGLAPSKRSTISKLVLRALCA-GSIACFMNATVAG---ILISSPV
Macropus_eugenii|570                GFANFGSLGVVIGGLTSMAPSRKRDIAAGAFRALIA-GTVASFMTACKAG---MLSSPPM
Nematostella_vectensis|11676        GFANFSSIGIQIGGLGPMAPTRIRDMAKIAMRALLA-GTIACFMTACVAG----------
Tarsius_syrichta|81                 GFANIGSL-IAIGGLTSMAPSRKRDIASGAVRALIA-GTVACFMTACVAG---ILSSTPV
Choloepus_hoffmanni|2412            GFSNFGSLGIVIGGLTSLAPSRKRDIASGAMRALIA-GTIACFMTACIAG---MLTSTPV
Ornithorhynchus_anatinus|5203       ------------------------------------------------------------
Vicugna_pacos|6874                  GFANIGSLGIVIGGLTSITPSRKRDIASGAVRALIA-GTIACFMTACIAG---MLTNSPV
Xenopus_tropicalis|3492             GFANFGSLGITIGGLSSMAPSRKGDIASGAIRAMIA-GTVACFMTACIAG---LLTQPVE
Anolis_carolinensis|1129            GFANFGSLGVVISALTALAPSRKKDIANGAFRAMVA-GTVACFMTACVAG----------
Gallus_gallus|12835                 GFANFGSLGMVIGSLTSMAPSKKKEIANGAFRAMIA-GTVACFMTACIAG---MLAVPDV
Taeniopygia_guttata|5661            GFANFGSLGLVIGGLTSIAPSKKKEIADGAFRAMTA-GTVACFMTACVAG---MLTVPSP
Monodelphis_domestica|15301         GFANLASLGVVIGGLTSMAPSRKGDIAGGAFRALVA-GNVASFMTACIAG---ILSNLPG
Myotis_lucifugus|5535               GFANISSLGIAIGALTSMAPSRKDDIISGAMRALIS-GTTACFMTACVAG---ILSGTPV
Erinaceus_europaeus|7582            GFANFGSLGIVIGGLTSMAPSRKRDIASGAMRALIS-GTIACFMTACIAG---MLSSTPK
Procavia_capensis|15521             GFANFGSLGIVIGGLTSMAPSRKQDIASGALRALIA-GTIACFMTACIAG---ILSGSPV
Ornithorhynchus_anatinus|26687      GFANFGSLGIVIGGLSSMAPTRKHDISKGAIRALIA-GTVACFMTACIAGTFLFLPCTSL
Spermophilus_tridecemlineatus|14308 XXXXXXXXXXXXXXXXSLAPGRKRDIVAGSVRALIA-GTVACFMTACVAG---ILSGTPE
Dipodomys_ordii|931                 GFANMGSLGIVIGGLTSIAPCRKRDIASGAVRALIA-GTIACFMTACIAG---MLSDTPV
Tupaia_belangeri|8505               GFANFGSLGIVIGGLTSIAPSRKRDIASGALRALIA-GTMACFMTACIAG---ILSSTPA
Pteropus_vampyrus|12545             GFANISSLGIAIGALTSMAPSRKRDITSGAVRALIS-GTIACFMTACIAG---LLSGTPV
Sus_scrofa|11653                    SFANIGSLGIAIGGLTSIAPSRKRDISSVAVRALIA-GTIASFMTASIAG---ILINTPV
Bos_taurus|575                      GFANFGSLGIVIGGLTSMAPSRKRDITAGAMRALIA-GTIACFLTACIAG---MLTNTPV
Sorex_araneus|13136                 GFANFGSLGMVIGGLSSMAPSRKRDIASGAMRALIA-GTIACFMTACIAG---MLSSTPI
Equus_caballus|18253                GFGSVSSLGLAISTLTSMAPSRKRDIAAGAVRALIA-GTIACFMTACIAG---ILSSTPV
Equus_caballus|8856                 GFANFGSLGIVIGGLTSMAPSRKRDIASGAVRALIA-GTVACFMTACIAG---ILSSTPV
Mus_musculus|12059                  GFANFGSLGIVIGGLTSIAPSRKRDIASGAMRALIA-GTIACFMTACIAG---ILSDTPV
Rattus_norvegicus|448               GFANFGSLGIVIGGLTSIAPSRKRDIASGAMRALIA-GTIACFMTACIAG---MLSDTPV
Loxodonta_africana|19930            GFANFGSLGIVIGGLTSIAPSRKHDITSGAVRALIA-GTIACFLTACIAG---MLSGSPV
Canis_familiaris|13615              GFANIGSLGIVIGGLTSMAPSRKRDITSGSVRALIA-GTVACFMTACIAG---LLSSTPV
Felis_catus|11764                   GFANFGSLGIVIGGLTSMAPSRKHDIASGAVRALIA-GTVACFMTACIAG---MLSSTPA
Cavia_porcellus|2032                GFANFGSLGIVIGGLTSMAPSRKSDIASGAIRALIS-GTVACFMTACVAG---LLSSTPI
Ochotona_princeps|1096              GFSNIGSLGIVIGGLTSMAPSRKRDIAAGAVRALIA-GTISCFMTACVAG---ILSATPV
Oryctolagus_cuniculus|7760          GFANIGSLGIVIGGLTSMAPSRKRDIAAGAVRALIA-GTTACFMTACIAG---ILSATPV
Microcebus_murinus|9029             GFANIGSLGIVIGGLTSITPSRKRDIASGAVRALIA-GTVACFMTACIAG---ILSSTPV
Callithrix_jacchus|34835            GFANIGSLGIVIGGLTSMAPSRKHDIASGAVRALIA-GTVACFMTACIAG---ILSSTPA
Gorilla_gorilla|5256                GFANIGSLGIVIGGLTSMAPSRKRDIASGAVRALIA-GTLACFMTACIAG---T-APCPL
Rhesus_macaque|8524                 GFANIGSLGIVIGGLTSMAPSRKRDIASGAVRALIA-GTVACFMTACIAG---ILSSTPV
Pongo_abelii|891                    GFANIGSLGIVIGGLTSMAPSRKHDIASGAVRALIA-GTMACFMTACIAG---ILSSTPV
Homo_sapiens|67131                  GFANIGSLGIVIGGLTSMAPSRKRDIASGAVRALIA-GTVACFMTACIAG---ILSSTPV
Pan_troglodytes|14404               GFANIGSLGIVIGGLTSMAPSRKRDIASGAVRALIA-GTVACFMTACIAG---ILSSTPV
Otolemur_garnettii|2293             GFANIGSLGIVIGGLXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXX---ILSSTPM
Dasypus_novemcinctus|84             XXXXXXXXXXXXXXXXSMAPSRKQDIASGAVRALIA-GTIACFMTACIAG---MLSSTPV
Oryzias_latipes|6103                GFSNIASLGMSIGALRSSRPFRHLFVFSGTKKEFITRDTVSLFSISSVLG---MLYIP--
Tetraodon_nigroviridis|8944         GFSNFASMGIAFGSMSNFAPDRQADIASCGFRALIA-GSVSCFMTACIAG---VLYVP--
Fugu_rubripes|25876                 GFSNFASMGIAFGCMTNLAPGRQADIARCGIRALVA-GSVSCFMTACIAG---ILYIPEV
                                                                                                

Caenorhabditis_elegans|20327        -----------------ICQSSQKSDTC---------------FRIPSG-----------
Macropus_eugenii|570                -EIDCNSLLEKAFNST-SPSNTTELVTC-CQNIFTSIVASNASDILPA---SLSTLKGCC
Nematostella_vectensis|11676        -E----------------------------------------------------------
Tarsius_syrichta|81                 -DINCHHILENAFNSS-LPGNTTKVISC-CQSLLSSTIVKGPGEVIPGGNHSLYSLKGCC
Choloepus_hoffmanni|2412            -D-NCHYVLGTAFNSS-LPRNTTEIVSC-CQSLLSSTVAKGPSAVIPGENHSLYSLKGCC
Ornithorhynchus_anatinus|5203       ------------------------------------------------------------
Vicugna_pacos|6874                  -DSGCHHILEYAFNSS-LAGDTTNVVSC-CQSLLSSTVAKGPGEVIPGGNHSLHSLEDCC
Xenopus_tropicalis|3492             -QFTCRELLESSLLNTSSPVNSTEVVDC-CVGLFKWVVADGPSNVTIGGNHSMSLLSGCC
Anolis_carolinensis|1129            ------------------------------------------------------------
Gallus_gallus|12835                 -EVPCHILSQNAFNSTSSPANSTELVKC-CQQTFTS--ANSSLENFPGGNYTLNFWKKCC
Taeniopygia_guttata|5661            -EVPCHILLGNASNFTDFPDNSTKLVEC-CQQLFAS--ANHMEEIFPGGNYSLNPWKVCC
Monodelphis_domestica|15301         -EIDCYSLLANAFNSS-SPSNTSELVIC-CQNLFTSTVTQNYSNILP---RSLSTLNNCC
Myotis_lucifugus|5535               -DVSCHHILENVFNSS-LPRNTTNVVSC-CQTLLSSTVVNGPGKVIPGGNHSLYSLKNCC
Erinaceus_europaeus|7582            -DVNCYYILENAFNTS-LPADKSIIVSC-CQTLLSSTIVKGPNEIIPGGNFSLHSLKSCC
Procavia_capensis|15521             -DINCHHILENAFNFS-SPRNTTEVVSC-CQNLFNST------KIIPGGNYSLYSLKGCC
Ornithorhynchus_anatinus|26687      -DVECHGLLENAFNSS-LPSFTPEIETC-CQDLFRRYRALS-------------------
Spermophilus_tridecemlineatus|14308 -DINCHHILENAFSSS-LPGNATTVVSC-CQSLLSSITDKEPRGIIPGGNYNLYFVKSCC
Dipodomys_ordii|931                 -DINCHHILESTFNSS-FPSNMTDVVSC-CQSLLHSTIAKGPGEIIPGGNHSLSSLKGCC
Tupaia_belangeri|8505               -DINCHHILENAFNSS-LLKNTTEVVSC-CQSLLNSTIATGPGAVIPGGNHSMYSLKGCC
Pteropus_vampyrus|12545             -DINCHHILENAFNSS-LPRNTTNVVSC-CQSLLNSSVVNGPGQVIPGGNHSLYFWKNCC
Sus_scrofa|11653                    -DINCHHILENAFNS-----RHNHVVSC-CQSLLSSTVAKGPGEIISAGNYSLYSLKDCC
Bos_taurus|575                      -DINCHHILENAFNSG-LVRNTTNVVSC-CQGLLSSAVVKGPGEVIPTGNHSLYSLKNCC
Sorex_araneus|13136                 -DNDCHHIFERAFNSS-LSRNTSSVVLC-CQSLLSSTVIKGPGELILGGNQSLDALKGCC
Equus_caballus|18253                -DITCHHIFENTFASG-LSQNTTDVVSC-CQSLLSSTVAVGPGEVIPGGNHSLSSLKNCC
Equus_caballus|8856                 -DINCHHTLENAFASS-LSQNTTDMVSC-CQSLLSSTVAVGPGEVIPGGNHSLSSLKTCC
Mus_musculus|12059                  -DINCHHVLE---NGR-VLSNTTEVVSC-CQNLFNSTVAKGPNDVVPGGNFSLYALKSCC
Rattus_norvegicus|448               -AINCHHVLE---SSK-VLSNTTEVASC-CQDLFNSTVARGPNDVLPGGNFSLYTLKSCC
Loxodonta_africana|19930            -DINCHDILENAFNFS-LPRNTTEVVSC-CQSLFNST------EVIPGGNHSLYSLKGCC
Canis_familiaris|13615              -DINCHYILENAFNSS-SPTNTTDVVSC-CQSLLNSTIVNGPGVIIPGGNHSLSSLRGCC
Felis_catus|11764                   -DINCHLILENAFNSS-SPANTTEVVSC-CQSLLNXXXXXXXXXXXXXXXXXXXXXXXXX
Cavia_porcellus|2032                -DINCHHILEDAFNST-LPSNATGVVSC-CQSLLHSTVIQGPGQVIPGGNSSLHSLKGCC
Ochotona_princeps|1096              -DINCQHVLQKAFDSS-LTSNITEVFPC-CQSLWNSTVAKGPGDVIPGGNSSLFALKGCC
Oryctolagus_cuniculus|7760          -DINCQHALENAFNSS-LPSSTPEVVAC-CQSLWTSAVAKGPGEVIPGGNYSLYALKGCC
Microcebus_murinus|9029             -DINCHHILETAFNSS-LPSNATKVMSC-CQDLLS-------------------------
Callithrix_jacchus|34835            -DINCHHVLENAFNSS-FPGNMTKVISC-CQSLLSSTVAKSPGEVIPGGNYSLYSLKGCC
Gorilla_gorilla|5256                -CPSAHRM-----NGS-FQDRQCLQLACAAHAATESTVAKGPGEVIPGGNHSLYSLKGCC
Rhesus_macaque|8524                 -DINCHHVLENAFTSS-FPGNTTKVISC-CQSLLNSTVAKGPGEVFPGGNHSLYSLKGCC
Pongo_abelii|891                    -DINCHHVLENAFNST-FPGNTTKVIAC-CQSLLSSTVAKGPGEVIPGGNYSLYSLKGCC
Homo_sapiens|67131                  -DINCHHVLENAFNST-FPGNTTKVIAC-CQSLLSSTVAKGPGEVIPGGNHSLYSLKGCC
Pan_troglodytes|14404               -DINCHLVLENAFNST-FPGNTTKVIAC-CQSLLSSTVARGPGEVIPGGNHSLYSLKGCC
Otolemur_garnettii|2293             -DINCHHILEIPFNSS-LPRNTTNVMSC-CRSLLSSTVVKGPGEVIPGGNYSLYSLKDCC
Dasypus_novemcinctus|84             -DFNCHNILGNAFNSS-VPKNTTEIVSC-CQSLLSSTVAKGPSAVVPGGNHSLYSLKGCC
Oryzias_latipes|6103                ---DCPLLLNTEFNNT-NVTSRAEILQC-CTQLYSSVTLYEPWNVTAGGGFTQSSLRGCC
Tetraodon_nigroviridis|8944         -EVHCAHFLSTHFNNS-VVTNSSQLIHC-CTQLYTSVTVNDPWNITISNGFSESSLRQCC
Fugu_rubripes|25876                 PEVLCAGFLSTHFNKS-VVMNSSQLVAC-CTHLYTSVTVHEPWNITISEGFNESSLRQCC
                                                                                                

Caenorhabditis_elegans|20327        -----------------
Macropus_eugenii|570                LVLNQTTFNCDWVATSF
Nematostella_vectensis|11676        -----------------
Tarsius_syrichta|81                 KLLNPPTFNCSWIPNTF
Choloepus_hoffmanni|2412            KLLNPSTFNCSWIPNRV
Ornithorhynchus_anatinus|5203       -----------------
Vicugna_pacos|6874                  RLLNPSTLNCSWIPNAF
Xenopus_tropicalis|3492             QLVHSPSLNCSCIAHFF
Anolis_carolinensis|1129            -----------------
Gallus_gallus|12835                 QILNRTTLNC-------
Taeniopygia_guttata|5661            QILGQPSFHC-------
Monodelphis_domestica|15301         LMLNSTTFNCDWVTSSF
Myotis_lucifugus|5535               QLLNPSSLNCSWIPDAF
Erinaceus_europaeus|7582            TLLNPSTLNCSWIPNVF
Procavia_capensis|15521             KLSNSSTFNCSR-----
Ornithorhynchus_anatinus|26687      -----------------
Spermophilus_tridecemlineatus|14308 KLLNPPNLNCSWIPDTF
Dipodomys_ordii|931                 TLVNPSTLNCSWIPNTF
Tupaia_belangeri|8505               GLLKPSTFNCSWIPNTF
Pteropus_vampyrus|12545             QLLSPSTLNCSWIPNTF
Sus_scrofa|11653                    KLLTPSTLNCSWIPNAF
Bos_taurus|575                      NLLNTPTLNCSWIPNVL
Sorex_araneus|13136                 TLLNPSTLNCTWIPNVF
Equus_caballus|18253                ELLKPSTLNCTWIPDEL
Equus_caballus|8856                 ELLKPSTLNCTWIPDEL
Mus_musculus|12059                  NLLKPPTLNCNWIPNKL
Rattus_norvegicus|448               NLLKPPTLNCGWIPNIP
Loxodonta_africana|19930            KLLNPSTFNCSWVSNTF
Canis_familiaris|13615              KLLTPPTLNCSWIPDAF
Felis_catus|11764                   XXXXXXXXXCSWIPNAF
Cavia_porcellus|2032                KVLIPPPLNCSSILNAF
Ochotona_princeps|1096              K-LKPSAFNCSWIHNTF
Oryctolagus_cuniculus|7760          K-LNPLTFNCSWIPNTF
Microcebus_murinus|9029             -----------------
Callithrix_jacchus|34835            TLLNPSTFNCSWISNTF
Gorilla_gorilla|5256                TLLNPSTFNCNGIPNTF
Rhesus_macaque|8524                 TLLNPSTFNCSWIPNIF
Pongo_abelii|891                    TLLNPSTFNCSGIPNTF
Homo_sapiens|67131                  TLLNPSTFNCNGISNTF
Pan_troglodytes|14404               TLLNPSTFNCNGIPNTF
Otolemur_garnettii|2293             KLLNPSTLNCSWIPTTF
Dasypus_novemcinctus|84             KLLTPSTFNCSWIPNEF
Oryzias_latipes|6103                ALAPPEHFNCSLAQNKA
Tetraodon_nigroviridis|8944         LLTPAAQFNCSLI----
Fugu_rubripes|25876                 -LLTPSAQACNYVKNIL