Orthologs Set ID: EOG4006C3


Orthology Database
OrthoDB4
Gene Symbol(s)

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Apis mellifera 33857 173, 249, 713
Nasonia vitripennis 15401 173, 255, 713
Pogonomyrmex barbatus 4496 173, 252, 713

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Apis mellifera 33857 GB12454-PA apiMel3
Nasonia vitripennis 15401 NV20824-RA 1.2
Pogonomyrmex barbatus 4496 PB19948-RA 1.2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Apis mellifera 2452 GB12454 apiMel3
Nasonia vitripennis 9987 NV20824-PA 1.2
Pogonomyrmex barbatus 9948 PB19948-PA 1.2

multiple sequence alignment in CLUSTALW format


Nasonia_vitripennis|15401  ATGATGCTGGAAGGAAGACTGGTTTTTTTGCTATTCTAC------TCGACGTTGGCCAGC
Apis_mellifera|33857       ---------ATGTCGAAAATGTTGCACGTCCGTTTTTATATCATTTCGGCGCTTTTGGTG
Pogonomyrmex_barbatus|4496 ---------ATGCCGAGATTGCTGATTTGCCTGATCGTT---TTTACATGCCTTGGTGTT
                                    .:.  .*.* ** *  :    *  :*  :       :*.    *    .  

Nasonia_vitripennis|15401  TGCATTTTGGCACAGGCGAATAATGCAAATTTGGATTACGCCAGCTTTCCGGCTAATGAA
Apis_mellifera|33857       TCTTTCGATACCGCGTCGGCGATCGAGGGTGTGAAAGGTGGCCGTCACCGTGTCCAATCC
Pogonomyrmex_barbatus|4496 GGCACCTGGGCACAGGGTGGGGTGAAAGGTGGGCATCGGCCACGTTACCCTACGAGCGGG
                              :     .*. .*   .  .: .....*  * *: .   ..*  : *  .  ..    

Nasonia_vitripennis|15401  AAC---------------------------GGCACCTGTTACAAGCGAGTCCCGTACGAC
Apis_mellifera|33857       CAGCTCGCCGTGAACAGCACGACGGCGCAAGGACTTTGCTACAAGAGAATACGCTATCAA
Pogonomyrmex_barbatus|4496 AGTCATGGCACCAATTCCTCGCAGGCT---GGCCTTTGCTATAAAACGGTGCCATACAGC
                           ..                            **..  ** ** **.. ..* *  **  ..

Nasonia_vitripennis|15401  GAAGCGCTAGCCGTCAACATTTCCAGAGGTATCGTTAAAACGCGGCCGGGTTCACAGCAG
Apis_mellifera|33857       GATGCTGTCGAATTGAACGCCACGGGCCAGTTCCTTCATAACACCCTCCCGACTTCTCAG
Pogonomyrmex_barbatus|4496 CAT---------ATTTCAAACTCCAGCGGATCGCCTTATAATACCATCCCTCAGCCGCCC
                            *:          * :...  :* .*. . :    * *:*. .  .      .  . *. 

Nasonia_vitripennis|15401  GCTGGAGTAAAGACGAACTCCAATCGCGGCTGGCTGACGATAGTCGACTGCTGCGAGGGC
Apis_mellifera|33857       GAAGGCACGAAAGGC------------GGATGGATAACGATTTTGGATTGTTGCGACGGG
Pogonomyrmex_barbatus|4496 GGAGGTCACCCCCATAACGAT------GGCTGGATCACCATCCTGGACTGTTGTGACGGC
                           * :**    ..                **.***.* ** **  * ** ** ** ** ** 

Nasonia_vitripennis|15401  TTCATCCGCAACGAGAGCACAGGTAAGTGCGAGACGCACTGCGACGAGGGTTGCTTCGGG
Apis_mellifera|33857       TACGAGCGCAATCTTAACTCCGGTGCCTGCAACCCGATCTGCACCGAGGGATGCTTGGGG
Pogonomyrmex_barbatus|4496 TACGAGCGCAATGTGACTAGCGGCCTGTGCGAGCCGCAATGTGATCGCGGCTGTTTCGGT
                           *:*.: *****  : *  : .**    ***.* .**.:.** ..  . ** ** ** ** 

Nasonia_vitripennis|15401  GGCACCTGCACGGGACCGAACGTCTGCACCTGCGAGGATGGCTGGCGTCCAGAGGCTGGG
Apis_mellifera|33857       GGGAACTGCACGGGGCCGAACGTGTGCAGCTGTTCGCCGGGCTGGGTGGCACGGAAGGGC
Pogonomyrmex_barbatus|4496 GGTCGTTGCACGGGTCCGAATATTTGTAGCTGTCCATCAGGATGGCATCCTCAGGATGGT
                           ** .  ******** ***** .* ** * ***  .. . **.***    *: .*.. ** 

Nasonia_vitripennis|15401  GTCTGCAAGCCTATCTGTCGTCGAGGCTGCGCTGATAACGCGTACTGCTTCTCCCCGGAC
Apis_mellifera|33857       GTCTGCGGGCCTTACTGCGAGCAAGCCTGCCAGAAGGACGCGTACTGCTTCTCGCCGAAC
Pogonomyrmex_barbatus|4496 GTCTGCATGCCCGTCTGCTCGTACCCGTGCCAAGAGAACGCCTACTGTTTCACCCCCGAG
                           ******. ***  :***     ..   *** . .* .**** ***** ***:* ** .* 

Nasonia_vitripennis|15401  ATCTGCACCTGCAAGTTCGGCTACGAGGAGGAAGAGGGTATCTGCAAGCCGGTCTGCAGA
Apis_mellifera|33857       GTGTGCGCGTGCAAATTGGGCTACGAGGAGGTGGACGGCGAGTGCAGGCCGATCTGCCCG
Pogonomyrmex_barbatus|4496 GTTTGCACGTGCAAACTGGGCTACGACGAGATCAACGGTCAATGCAAGCCAATCTGTCCC
                           .* ***.* *****. * ******** ***.: .* **  : ****.***..**** .  

Nasonia_vitripennis|15401  CACGGCTGT---AGGAATGGACAGTGCGTTGCGCCTAGGGACTGCAGGTGTAATCCCGGC
Apis_mellifera|33857       CGCGGGTGC---GTGAACGGGGAATGCGTGGCGCCCCACGTGTGCAAGTGCAGGGCCGGG
Pogonomyrmex_barbatus|4496 AACGGGTGCGGCAGGCACGGCGAATGCGTGGCACCGCGCATCTGCAGTTGCAGACAGGGA
                           ..*** **    . *.* **  *.***** **.** .. .: ****. ** *.  . ** 

Nasonia_vitripennis|15401  TACTACCTGAAC---------------GAGACGCAGAGGTGCGAGCCAGTGTGCGAAGGA
Apis_mellifera|33857       TACCAGCTGGAGCCGGGAATGGAGGGAACGAACGCTAAATGCGTGCCGGTGTGCGAAAAC
Pogonomyrmex_barbatus|4496 TACGTCCTGAAC---------------GAGCGCAGGGAGTGCGTGGCCGCGTGCGAGGGC
                           *** : ***.*                ..*.     ...****:* * * ******....

Nasonia_vitripennis|15401  GGATGCCCTCATGGTCGGTGCATCCAGCCTGGTATCTGCGAGTGCAATCGCGGATACATG
Apis_mellifera|33857       GGTTGCCGTAACGGAGAGTGCGCAGCTCCTGGGGTGTGCACCTGCCACGAAGGATACGTC
Pogonomyrmex_barbatus|4496 GGCTGCGTGCACGGCGTGTGCAGCGGGCCGGGCGTGTGCACCTGTAACGAGGGGTACACC
                           ** ***   .* **   ****. .   ** ** .* ***.. ** .*  . **.***.  

Nasonia_vitripennis|15401  AACTCCGAAAACGATCCAGAGACCTGTACGCCCTCCTGTCCGGATACCTGCACCAGCACC
Apis_mellifera|33857       AATCCTCCGAACGAGCCCGAATACTGCGTGCCCGACTGTCCCGCCGGCTGC------GCG
Pogonomyrmex_barbatus|4496 AACCCGCCTAACGACCGCGAGTCCTGCGTTCCCCATTGTCCGAGCGGTTGC------CTC
                           **  *  . ***** * .**.:.*** .  *** . ***** .  .  ***         

Nasonia_vitripennis|15401  AACGGACGATGTCACTCGCCCAACGTCTGCACCTGCGATCCCGGCTACACCCAGACGCCG
Apis_mellifera|33857       AACGGCAAGTGCATCGCCCCGGCCGTTTGCCAGTGCGAGCCGAACCACGTCCTCAACGGA
Pogonomyrmex_barbatus|4496 GGTGGTGAATGTGTCGCACCGAACGTTTGCAGATGCAGGTCCGGCTTTACGCTTAATCAG
                           .. **  ..**  :* * ** ..*** ***.  ***..  * ..* : .  *: *.   .

Nasonia_vitripennis|15401  AGTGGTACCTGCATCCCGGAATGCCTGGGCGACTGTCCCAACGGCCGATGCGTTGCTCCC
Apis_mellifera|33857       AGCAACGCATGCGTGCCCGAGTGCCCGCTGGGCTGCGCGAACGGCGAGTGCGTGGCGCCC
Pogonomyrmex_barbatus|4496 ACCGGCACTTGCATACCGGACTGTCCGGGCGGTTGCGACGGGGGCGAGTGCATCTCACCC
                           *  .. .* ***.* ** ** ** * *   *. **  . .. *** ..***.*  * ***

Nasonia_vitripennis|15401  GAGCAGTGCGAGTGTAACCAAGGCTTCGTTATGAATCGCCAGCTGAGAAGATGCGTGGAA
Apis_mellifera|33857       GGCGTGTGCAAGTGCGAGCCAGGCTTCGCCCTCGACCCC---GCCAACAGATGCGTGCCC
Pogonomyrmex_barbatus|4496 GGCGTTTGCAGCTGCAGACCCGGGTACACGAGGGACCGTCACAGTGGCAGATGCGTTCCG
                           *.  : ***.. ** .. *..** *:*.  .  .* *        ...********  . 

Nasonia_vitripennis|15401  GCTCAGAAAGGCAGCGATGGTTATTACGAAAACTCTGCTGTCAACAGATCGCGCTGGAAC
Apis_mellifera|33857       GAGTGCCCGCTGGGCTGCGCC---------------------------------------
Pogonomyrmex_barbatus|4496 AGT---------------------------------------------------------
                           .                                                           

Nasonia_vitripennis|15401  AATAACCGGACGATTCCACCCGAGACGACGTACGGAGGTCGGGGTACTTACCGACCAGAA
Apis_mellifera|33857       AACGGCGAGTGCGTGGCGCCCGGCGCGTGCAAGTGCGGCCCGGGC---TTCGCCCTCGAC
Pogonomyrmex_barbatus|4496 ---------------ACCACAGGTTCGTCGCAGTGCGGATTTGGT---TACATCGTCGAT
                                           * .*.*.  **:   *  *.**    **    *:*  .  .** 

Nasonia_vitripennis|15401  GAGTCCAGTCAGCTGCGTGGTCCGGAGCAAGGCTTGAAGAGGCCGCAAAACTATAGTGCC
Apis_mellifera|33857       CCCGTCTCCGCCAACAGGTGCGTGCCCGAGTGCCCGCTGGGCTGCGTGAACGGCGAGTGC
Pogonomyrmex_barbatus|4496 CCC---------------------------------------------------------
                            .                                                          

Nasonia_vitripennis|15401  CAGCAGCCTGGAAGAGCTTATGGTACTCAGGGTATCGTTCAGAATAGAAATCGACCGGAC
Apis_mellifera|33857       GTGGCGCCCGGTGCCTGCGCCTGCAAGCCCGGCTACTCCGTGGACGCGAGCAGAAAGTGC
Pogonomyrmex_barbatus|4496 ------------------------------------------------------------
                                                                                       

Nasonia_vitripennis|15401  AGCGAACAGGAAGATACGTACGGTACCACTGGGCAGTACGAAGACGCAGTGACACTCAAT
Apis_mellifera|33857       GTCCCGACGTGCTCCCGGGATTGCGCGAACGGGAGATGCGTCGCGCCG------------
Pogonomyrmex_barbatus|4496 ------------------------GACACCGGCAGATGCATCCCCGCG------------
                                                   .. *. ** ...*.*.:. .  *.            

Nasonia_vitripennis|15401  CAGACGCAAAATAACAATAGAGTTATTGGCTTGAAGGGAGGTGTCAATCGACAAAATATC
Apis_mellifera|33857       ------------------------------------------------------------
Pogonomyrmex_barbatus|4496 ------------------------------------------------------------
                                                                                       

Nasonia_vitripennis|15401  CCAGGAACGTATCCTACTTCTGAAAACAATAATCGTTATACTGGATATAGAAATAATTCA
Apis_mellifera|33857       ------------GACACTTGCGAGTGCAACCCGGGCTACGCTCTGGACGCCAACGACAAC
Pogonomyrmex_barbatus|4496 ------------CCAACGTCACAA------------------------------------
                                        . ** *   *.                                    

Nasonia_vitripennis|15401  ACTGGTGGAATACACCGACCTGCCAATTCTCAAGGA------------------------
Apis_mellifera|33857       TGCGCG------------CCCGACTGTCCCCAGGGTTGCGCGAACGGCGAATGCGTTGCG
Pogonomyrmex_barbatus|4496 ------------------CCGTCACAACCTGTCGGC------------------------
                                             **  .. .: *  : **                         

Nasonia_vitripennis|15401  ------------------------CCGTTTGCTCCTCTTGAGCCTTATGATCCTGATGGT
Apis_mellifera|33857       CCGGGAGTGTGCGCCTGCGACGCGGGCTACTCGCCCGACCCGAGCGGCGGCTGCGTCGGG
Pogonomyrmex_barbatus|4496 ------------------------------------------------------------
                                                                                       

Nasonia_vitripennis|15401  CAAAGAGTAAACGAAACGAATCCACGAGATCGTAATCCACAGTACGAAACTTACGGAAAC
Apis_mellifera|33857       AAGCCGGCCGTGGACGAGCGGCCGTCGAGGACGGACTGTCGCTTGGACTGCGGCCCGAAC
Pogonomyrmex_barbatus|4496 ------------------------------------------------------------
                                                                                       

Nasonia_vitripennis|15401  AGTCAAACACCCAGACCACTACGACCGGTCAATCAACAAGGGCCGTTTCCCAGTCAAGGA
Apis_mellifera|33857       GCGCACTGCGTCGGCCCCAACCAGTGCACCTGCGACCTGGGCTTCAAGCTGGACCCGGAC
Pogonomyrmex_barbatus|4496 ------------------------------------------------------------
                                                                                       

Nasonia_vitripennis|15401  CCTTACCTATCACAAGGTTATTACAATGAGACGCACGGTTCCGATGGAAGGTACTATGGG
Apis_mellifera|33857       ACCAAGAAGTGCGTCCCGTTCTCCAACTCTTTCAGTTGCAGGAACGGG------------
Pogonomyrmex_barbatus|4496 ---------------------------------AATTGCAGATACGGC------------
                                                            ..  * :   * **             

Nasonia_vitripennis|15401  GACCGTCGAAATAACCAGACACAAAGACCATACCAAGGGCCCTACGGTTCGCAAGGGCCC
Apis_mellifera|33857       ------------------------------------------TGCGGCGCCCGCGGCCTC
Pogonomyrmex_barbatus|4496 ------------------------------------------TGCGGTCCGCACGGTGTG
                                                                     *.***  * *..**    

Nasonia_vitripennis|15401  TACCCTGGACAGGGACCCTACTCAACACCAGCACCTGGACAAGGTTTATATCCAAAACTG
Apis_mellifera|33857       TGCGTGGGG---------------------------------------CCCGACATGTGC
Pogonomyrmex_barbatus|4496 TGCGTCGGA---------------------------------------TATAATCGTTGC
                           *.*   **.                                        .  . .     

Nasonia_vitripennis|15401  CCGCCCATTCCAGGTCAAGACCCATACGCAGAAGGCCCATACTCTGGGCAAGGACCGCAT
Apis_mellifera|33857       GTGTGCGATTACGGG---------ATGGCCGTGGATCCCGCGACGGGCAGGTGCCCGGAG
Pogonomyrmex_barbatus|4496 GCCTGCCAGCCAGGA---------TTCGCCGTCGATCCCGACACTGGCAGATGCATCACC
                                * :  ..**          :: **.*: *. **. . :* ** ... *..   . 

Nasonia_vitripennis|15401  CCGACGCAAGAAACTTTCCCCGGGCAGGGGCCGTATTCAACACCAGCTCCTGGGCAAGGT
Apis_mellifera|33857       CCGAGGAGCCAGACGGCG------------------------------------------
Pogonomyrmex_barbatus|4496 ATCGCGACCTCCACAATC------------------------------------------
                           .  . *. . . **                                              

Nasonia_vitripennis|15401  TTATACCCGAAACTGCCGCGTATACCTGGACAAGGACCTGTCTCGACGCACGACCCACGT
Apis_mellifera|33857       ------------------------------------------------------------
Pogonomyrmex_barbatus|4496 ------------------------------------------------------------
                                                                                       

Nasonia_vitripennis|15401  GACTTCGAAAGTCCGTACGGGCCTCAGTACAACGGGCCAACACCAGATCCTTTGGGAGCC
Apis_mellifera|33857       ---------------------------------AGCCAGACGGATCGGCCGCAGTGCCAG
Pogonomyrmex_barbatus|4496 ---------------------------------AACTCGACCTCCTCCTCGCAATGCAGA
                                                            ..  ..**  .     *  :. *.   

Nasonia_vitripennis|15401  CACGGGCTAAATCCATCACAGCGTCTTCCTGGAAATAACCAGCCGTACCAGCCACTCGGA
Apis_mellifera|33857       CGCGGTTGCGGGCCGAACGGCGTCTGCGTCGGCCCCGATCGT------------------
Pogonomyrmex_barbatus|4496 TACGGCTGCGGACCGAACGGCCGATGCGTTGGCCCGAACGTG------------------
                            .***   ... **.:.. .          **... .*                      

Nasonia_vitripennis|15401  CCTTACGGTATCCCAGCACGTGGTCAGCCCGGCAATCCACACGAAACCCTAGGCTTAAAG
Apis_mellifera|33857       ------------------------------------------------------------
Pogonomyrmex_barbatus|4496 ------------------------------------------------------------
                                                                                       

Nasonia_vitripennis|15401  GGCGGCCGAAGACCCTGGCCGGACTCGAGCCGAAACCCTGGCGTGGACATAGCTTACGGC
Apis_mellifera|33857       ------------------------TGCGCGTGCAACGAGGGATTCGCGCTC---------
Pogonomyrmex_barbatus|4496 ------------------------TGCGTCTGCGAACCGGGCTTCCGAATC---------
                                                   *  .   *..*. . **. *    .*.         

Nasonia_vitripennis|15401  GTCAACGAGATGCTAAACCTTCCCCAGAATGGCAACGTCAATCCCAGACCAGGCCAAACA
Apis_mellifera|33857       ---------------------------------------GATCCCAACACCGGC------
Pogonomyrmex_barbatus|4496 ---------------------------------------GATCCCGACACCGGA------
                                                                  .*****....*.**.      

Nasonia_vitripennis|15401  TCCGTGATAGTCGGCCTCTACAATCCGTACAATCAGGTAGCACCAGGAGACGATGGCACC
Apis_mellifera|33857       ---------------------------------AGATGCGTCCCCTCGGCGGCC------
Pogonomyrmex_barbatus|4496 ---------------------------------AAGTGCATTCGGCACGACGTCGGTGGC
                                                            ...  ..  *     *. *        

Nasonia_vitripennis|15401  GATAATATCTACGTTCTAGATCCGTCCATGAATCACGGCTTCTTCAATCCGTTCCTGCCT
Apis_mellifera|33857       ------------------------------------------------------------
Pogonomyrmex_barbatus|4496 ACGGAC------------------------------------------------------
                                                                                       

Nasonia_vitripennis|15401  CCCGGAAGTCCACCACAGCTCGATCCCGGCTTCGCGCCATTCAAACTTCCAGGTTACAGC
Apis_mellifera|33857       ------------------------------------------------------------
Pogonomyrmex_barbatus|4496 ------------------------------------------------------------
                                                                                       

Nasonia_vitripennis|15401  CACTACCGGCCCACCTGCGATTCGCCGTGCGTCAACAGCGTCTGCGTGGGGAACAACGTG
Apis_mellifera|33857       ------GAGCCTTTCTGCGAGCTTCCGTGCCTGAACGGCGAGTGCACCGGCTTGAACCAA
Pogonomyrmex_barbatus|4496 ------GAGAATATCTGCCAGCATCCGTGCCTGAACGGCCAATGCACCGGACCAGATCAG
                                  .*.. : **** *    ****** * ***.** : ***.  **    .*  :.

Nasonia_vitripennis|15401  TGCCAGTGCAAACCCGGCTACGAACCCGATTCCATAAACCCCAACGGCTTCAAATGCGTA
Apis_mellifera|33857       TGCACGTGCAAGCGCGGTTACGTTTTCAGCCCCTCGGACGCGACGAGGACGAGATGCGTG
Pogonomyrmex_barbatus|4496 TGCACGTGCAACCACGGGTACACGCATGATGTTCGTGACGTTACGCGTTCCAGATGCGTA
                           ***..****** * *** ***.     ..       .**   *.  * :  *.******.

Nasonia_vitripennis|15401  CCGTCCTGTCCAGGTGGCTGCGTCAACGGTGTGTGCTCCGGACCCGACCTCTGCATCTGC
Apis_mellifera|33857       CCAGTGTGCTTCGGCGGCTGTCACAATGGCGTGTGCACCGCACCCAATCTGTGCATCTGC
Pogonomyrmex_barbatus|4496 CCGGTGTGCGTAGGTGGATGTCCAAACGGCGTGTGCACCATGCCGAATTACTGTATATGC
                           **.   **   .** **.**   .** ** ******:**. .** .*  : ** **.***

Nasonia_vitripennis|15401  AACGCTGGATTCGTCAAGGAACGAGGCGTCAAAGGCGCCCAGCGATGCATTCCCACTTAT
Apis_mellifera|33857       AACCCTGGCTATATAAAAGAGAGTGGAGTCAAGGGCAGGCAAAGATGCGTTCCCGTTTAT
Pogonomyrmex_barbatus|4496 AATCCCGGATACCGGAAGGAAAGCGGTGTCAAAGGTCGGCAAAGATGTGTCCCGGAA---
                           **  * **.*:    **.**..* ** *****.**    **..**** .* ** . :   

Nasonia_vitripennis|15401  TAG
Apis_mellifera|33857       TGA
Pogonomyrmex_barbatus|4496 TAA
                           *..

multiple sequence alignment in CLUSTALW format


Nasonia_vitripennis|9987   MMLEGRLVFLLFY--STLASCILAQANNANLDYASFPANEN---------GTCYKRVPYD
Apis_mellifera|2452        ---MSKMLHVRFYIISALLVSFDTASAIEGVKGGRHRVQSQLAVNSTTAQGLCYKRIRYQ
Pogonomyrmex_barbatus|9948 ---MPRLLICLIV-FTCLGVGTWAQGGVKGGHRPRYPTSGSHGTNSSQA-GLCYKTVPYS
                                :::   :   : *     : .   . .   . .. .         * *** : *.

Nasonia_vitripennis|9987   EALAVNISRGIVKTRPGSQQAGVKTNSNRGWLTIVDCCEGFIRNESTGKCETHCDEGCFG
Apis_mellifera|2452        DAVELNATGQFLHNTLPTSQEGTKG----GWITILDCCDGYERNLNSGACNPICTEGCLG
Pogonomyrmex_barbatus|9948 H---ISNSSGSPYNTIPQPPGGHPHND--GWITILDCCDGYERNVTSGLCEPQCDRGCFG
                           .   :. :     .       *       **:**:***:*: ** .:* *:. * .**:*

Nasonia_vitripennis|9987   GTCTGPNVCTCEDGWRPEAGVCKPICRRGCADNAYCFSPDICTCKFGYEEEEGICKPVCR
Apis_mellifera|2452        GNCTGPNVCSCSPGWVARKGVCGPYCEQACQKDAYCFSPNVCACKLGYEEVDGECRPICP
Pogonomyrmex_barbatus|9948 GRCTGPNICSCPSGWHPQDGVCMPVCSYPCQENAYCFTPEVCTCKLGYDEINGQCKPICP
                           * *****:*:*  ** .. *** * *   * .:****:*::*:**:**:* :* *:*:* 

Nasonia_vitripennis|9987   HGC-RNGQCVAPRDCRCNPGYYLN-----ETQRCEPVCEGGCPHGRCIQPGICECNRGYM
Apis_mellifera|2452        RGC-VNGECVAPHVCKCRAGYQLEPGMEGTNAKCVPVCENGCRNGECAAPGVCTCHEGYV
Pogonomyrmex_barbatus|9948 NGCGRHGECVAPRICSCRQGYVLN-----ERRECVAACEGGCVHGVCSGPGVCTCNEGYT
                           .**  :*:****: * *. ** *:        .* ..**.** :* *  **:* *:.** 

Nasonia_vitripennis|9987   NSENDPETCTPSCPDTCTSTNGRCHSPNVCTCDPGYTQTPSGTCIPECLGDCPNGRCVAP
Apis_mellifera|2452        NPPNEPEYCVPDCPAGC--ANGKCIAPAVCQCEPNHVLNGSNACVPECPLGCANGECVAP
Pogonomyrmex_barbatus|9948 NPPNDRESCVPHCPSGC--LGGECVAPNVCRCRSGFTLNQTGTCIPDCPGGCDGGECISP
                           *. *: * *.* **  *   .*.* :* ** * .... . :.:*:*:*  .* .*.*::*

Nasonia_vitripennis|9987   EQCECNQGFVMNRQLRRCVEAQKGSDGYYENSAVNRSRWNNNRTIPPETTYGGRGTYRPE
Apis_mellifera|2452        GVCKCEPGFALDP-ANRCVPECPLGCA-------------NGECVAPGACKCGPG-FALD
Pogonomyrmex_barbatus|9948 GVCSCRPGYTRDRHSGRCVPS------------------------TTGSSQCGFG-YIVD
                             *.*. *:. :    ***                          .. :   * * :  :

Nasonia_vitripennis|9987   ESSQLRGPEQGLKRPQNYSAQQPGRAYGTQGIVQNRNRPDSEQEDTYGTTGQYEDAVTLN
Apis_mellifera|2452        PVSANRCVPECPLGCVNGECVAPGACACKPGYSVDASRKCVPTCSRDCANGRCVAP----
Pogonomyrmex_barbatus|9948 P-----------------------------------------------DTGRCIPA----
                                                                            .*:   .    

Nasonia_vitripennis|9987   QTQNNNRVIGLKGGVNRQNIPGTYPTSENNNRYTGYRNNSTGGIHRPANSQG--------
Apis_mellifera|2452        ------------------------DTCECNPGYALDANDNCA----PDCPQGCANGECVA
Pogonomyrmex_barbatus|9948 ------------------------PTSQ------------------PSQPVG--------
                                                    *.:                  *  . *        

Nasonia_vitripennis|9987   --------PFAPLEPYDPDGQRVNETNPRDRNPQYETYGNSQTPRPLRPVNQQGPFPSQG
Apis_mellifera|2452        PGVCACDAGYSPDPSGGCVGKPAVDERPSRTDCRLDCGPNAHCVGPNQCTCDLGFKLDPD
Pogonomyrmex_barbatus|9948 ------------------------------------------------------------
                                                                                       

Nasonia_vitripennis|9987   PYLSQGYYNETHGSDGRYYGDRRNNQTQRPYQGPYGSQGPYPGQGPYSTPAPGQGLYPKL
Apis_mellifera|2452        TKKCVPFSNSFSCRNG------------------CGARGLCVG-------------PDMC
Pogonomyrmex_barbatus|9948 -----------NCRYG------------------CGPHGVCVG-------------YNRC
                                          *                   *.:*   *                 

Nasonia_vitripennis|9987   PPIPGQDPYAEGPYSGQGPHPTQETFPGQGPYSTPAPGQGLYPKLPRIPGQGPVSTHDPR
Apis_mellifera|2452        VCDYG---MAVDPATGRCPEPRSQTA----------------------------------
Pogonomyrmex_barbatus|9948 ACQPG---FAVDPDTGRCITIATSTI----------------------------------
                               *    * .* :*:      .*                                   

Nasonia_vitripennis|9987   DFESPYGPQYNGPTPDPLGAHGLNPSQRLPGNNQPYQPLGPYGIPARGQPGNPHETLGLK
Apis_mellifera|2452        -----------SQTDRPQCQRGCGPNGVCVGPDR--------------------------
Pogonomyrmex_barbatus|9948 -----------NSTSSSQCRYGCGPNGRCVGPNV--------------------------
                                      . *  .    * .*.    * :                           

Nasonia_vitripennis|9987   GGRRPWPDSSRNPGVDIAYGVNEMLNLPQNGNVNPRPGQTSVIVGLYNPYNQVAPGDDGT
Apis_mellifera|2452        --------CACNEGFAL----------------DPNTG-------------RCVPSAA--
Pogonomyrmex_barbatus|9948 --------CVCEPGFRI----------------DPDTG-------------KCIRHDVGG
                                   .  : *. :                :* .*             :        

Nasonia_vitripennis|9987   DNIYVLDPSMNHGFFNPFLPPGSPPQLDPGFAPFKLPGYSHYRPTCDSPCVNSVCVGNNV
Apis_mellifera|2452        ------------------------------------------EPFCELPCLNGECTGLNQ
Pogonomyrmex_barbatus|9948 TD----------------------------------------ENICQHPCLNGQCTGPDQ
                                                                     .  *: **:*. *.* : 

Nasonia_vitripennis|9987   CQCKPGYEPDSINPNGFKCVPSCPGGCVNGVCSGPDLCICNAGFVKERGVKGAQRCIPTY
Apis_mellifera|2452        CTCKRGYVFSPSDATRTRCVPVCFGGCHNGVCTAPNLCICNPGYIKESGVKGRQRCVPVY
Pogonomyrmex_barbatus|9948 CTCNHGYTHDVRDVTRSRCVPVCVGGCPNGVCTMPNYCICNPGYRKESGVKGRQRCVPE-
                           * *: **  .  : .  :*** * *** ****: *: ****.*: ** **** ***:*