Orthologs Set ID: EOG4006C4


Orthology Database
OrthoDB4
Gene Symbol(s)
CG11050,GL25580,GE13999

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Apis mellifera 36690 684, 818, 990
Bombyx mori 4229 832, 990
Daphnia pulex 20605 684, 749, 818, 980
Drosophila melanogaster 1258 135, 684, 990
Drosophila persimilis 2096 684, 990
Drosophila yakuba 1640 135, 684, 990
Linepithema humile 6106 684, 818, 990
Nasonia vitripennis 2602 648, 684, 818, 990
Pediculus humanus 7481 684, 818, 990
Pogonomyrmex barbatus 5297 684, 818, 990
Tribolium castaneum 8420 1039

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Apis mellifera 36690 GB15154-PA apiMel3
Bombyx mori 4229 BGIBMGA003527-TA v2.0
Daphnia pulex 20605 PASA_GEN_6300040 1.1
Drosophila melanogaster 1258 FBtr0079291, NM_135208 33924 FBgn0031836 CG11050 dm3
Drosophila persimilis 2096 FBtr0191195 6593509 FBgn0163164 GL25580 droPer1
Drosophila yakuba 1640 FBtr0260517 6527066 FBgn0231630 GE13999 droYak2
Linepithema humile 6106 LH22047-RA 1.2
Nasonia vitripennis 2602 NV18353-RA 1.2
Pediculus humanus 7481 PHUM455410-RA 8230545 PHUM455410 PhumU1
Pogonomyrmex barbatus 5297 PB12264-RA 1.2
Tribolium castaneum 8420 GLEAN_08897 Tcas3.0

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Apis mellifera 5152 GB15154 apiMel3
Bombyx mori 3527 BGIBMGA003527-PA v2.0
Daphnia pulex 15407 JGI_V11_307447 1.1
Drosophila melanogaster 1183 FBpp0078921 33924 FBgn0031836 CG11050 dm3
Drosophila persimilis 15131 FBpp0189687 6593509 FBgn0163164 GL25580 droPer1
Drosophila yakuba 4509 FBpp0259009 6527066 FBgn0231630 GE13999 droYak2
Linepithema humile 13730 LH22047-PA 1.2
Nasonia vitripennis 8241 NV18353-PA 1.2
Pediculus humanus 7327 PHUM455410-PA 8230545 PHUM455410 PhumU1
Pogonomyrmex barbatus 2264 PB12264-PA 1.2
Tribolium castaneum 8677 GLEAN_08897 Tcas3.0

multiple sequence alignment in CLUSTALW format


Daphnia_pulex|20605          ------------------------------------------------------------
Pediculus_humanus|7481       ------------------------------------------------------------
Drosophila_persimilis|2096   ATGTTCTCACTGCAG------CAAATAATCAAAGCAGCGACCGCCAATAGCGGCAACTGC
Drosophila_melanogaster|1258 ATGTTCTCACTACAACTACAGCAGTTGCTCCGAGCGACAGCAAGC---------------
Drosophila_yakuba|1640       ATGTTCTCACTACAG------CAGTTGCTCAGAGCGACAGCGACTTCGAAC---------
Nasonia_vitripennis|2602     ------------------------------------------------------------
Apis_mellifera|36690         ------------------------------------------------------------
Linepithema_humile|6106      ------------------------------------------------------------
Pogonomyrmex_barbatus|5297   ------------------------------------------------------------
Tribolium_castaneum|8420     ------------------------------------------------------------
Bombyx_mori|4229             ------------------------------------------------------------
                                                                                         

Daphnia_pulex|20605          ------------------------------------------------------------
Pediculus_humanus|7481       ------------------------------------------------------------
Drosophila_persimilis|2096   GGCGTGGGTGGCAGCGATCTCTACAGGCTGCTCAGGCAT------CGCCTGACGTCATCA
Drosophila_melanogaster|1258 ---------------------------------------------GGCGTGACGTCGGGA
Drosophila_yakuba|1640       ------GGCGGCAACGATCTCAGCCGGCTGCTGCGCCACATGGGCGGCGTGACGTCAGGA
Nasonia_vitripennis|2602     ------------------------------------------------------------
Apis_mellifera|36690         ------------------------------------------------------------
Linepithema_humile|6106      ------------------------------------------------------------
Pogonomyrmex_barbatus|5297   ------------------------------------------------------------
Tribolium_castaneum|8420     ------------------------------------------------------------
Bombyx_mori|4229             ------------------------------------------------------------
                                                                                         

Daphnia_pulex|20605          ------------------------------------------------------------
Pediculus_humanus|7481       ------------------------------------------------------------
Drosophila_persimilis|2096   GCAGCAACTACAGCAATAACCACAACCACAACTACAAATACAGCAATACCAAAGAAATCT
Drosophila_melanogaster|1258 GCCACAAAGACACTGTGCACAGCCACA------------------------------GCG
Drosophila_yakuba|1640       GCTACAACGACACTGTGCACAGCGTCA---------------------------------
Nasonia_vitripennis|2602     ------------------------------------------------------------
Apis_mellifera|36690         ------------------------------------------------------------
Linepithema_humile|6106      ------------------------------------------------------------
Pogonomyrmex_barbatus|5297   ------------------------------------------------------------
Tribolium_castaneum|8420     ------------------------------------------------------------
Bombyx_mori|4229             ------------------------------------------------------------
                                                                                         

Daphnia_pulex|20605          ------------------------------------------------------------
Pediculus_humanus|7481       ------------------------------------------------------------
Drosophila_persimilis|2096   AGTCAAGCAACAGCGGTGTCGAGCGACGAAAACTTCAGCCACAACGCCATTCGCTCGTCC
Drosophila_melanogaster|1258 TCTGCCGCCACAAAGCACTCTAGTCAAGCGAAGTTCGGCGACAACAGCAGTCACGGTTCG
Drosophila_yakuba|1640       ------GCCACAAAGCACTCTAGTCAGGCGAAGTTCGGCGACAACAGCAGTCACGGTTCG
Nasonia_vitripennis|2602     ------------------------------------------------------------
Apis_mellifera|36690         ------------------------------------------------------------
Linepithema_humile|6106      ------------------------------------------------------------
Pogonomyrmex_barbatus|5297   ------------------------------------------------------------
Tribolium_castaneum|8420     ------------------------------------------------------------
Bombyx_mori|4229             ------------------------------------------------------------
                                                                                         

Daphnia_pulex|20605          ------------------------------------------------------------
Pediculus_humanus|7481       ------------------------------------------------------------
Drosophila_persimilis|2096   CATTCGAACCCCAACGGTTGTTGTTACGGAGAGTCAGATTCGGAGTCGGCGCACAGCGTG
Drosophila_melanogaster|1258 CCATCGCACACGGACGGTCGCAGTCACGGTGAATCAGAGTCGGATTTGGAGTCGGCGCAC
Drosophila_yakuba|1640       CCCTCGCACACGGACGGTCGCAGTCACGGTGAATCAGAGTCGGATTTGGAGTCGGCGCAC
Nasonia_vitripennis|2602     ------------------------------------------------------------
Apis_mellifera|36690         ------------------------------------------------------------
Linepithema_humile|6106      ------------------------------------------------------------
Pogonomyrmex_barbatus|5297   ------------------------------------------------------------
Tribolium_castaneum|8420     ------------------------------------------------------------
Bombyx_mori|4229             ------------------------------------------------------------
                                                                                         

Daphnia_pulex|20605          ------------------------------------------------------------
Pediculus_humanus|7481       ------------------------------------------------------------
Drosophila_persimilis|2096   AACGGAAACTTGTCAACG---CAATTCGCCCGAAAGCTGCTGCAGCAACGCAGACAGGAC
Drosophila_melanogaster|1258 GGCCAGAATTTCACATCACACCACTTAGCCAGACGGATACTTCAGCAGCGCAGCCAGGAC
Drosophila_yakuba|1640       GGCCAGAATTTCACAGCACACCATTTCGCCCGACGAATACTTCAGCAGCGCAGCCAGGAC
Nasonia_vitripennis|2602     ------------------------------------------------------------
Apis_mellifera|36690         ------------------------------------------------------------
Linepithema_humile|6106      ------------------------------------------------------------
Pogonomyrmex_barbatus|5297   ------------------------------------------------------------
Tribolium_castaneum|8420     ------------------------------------------------------------
Bombyx_mori|4229             ------------------------------------------------------------
                                                                                         

Daphnia_pulex|20605          ------------------------------------------------------------
Pediculus_humanus|7481       ------------------------------------------------------------
Drosophila_persimilis|2096   ATCCAGCGCCTCATACACACCCAGCCACCCAGTGGACAC---GGAACCAAATCCTCCCAG
Drosophila_melanogaster|1258 ATCCAGCGCCACATCCACACGCAGTCAGCCAAGGGACAGACCAGTGCCAAGTCCTCGCAG
Drosophila_yakuba|1640       ATCCAGCGCCACATCCACACACAGTCATCGAAAGGACAGACCAGAGCCAAGTCGTCGCAG
Nasonia_vitripennis|2602     ------------------------------------------------------------
Apis_mellifera|36690         ------------------------------------------------------------
Linepithema_humile|6106      ------------------------------------------------------------
Pogonomyrmex_barbatus|5297   ------------------------------------------------------------
Tribolium_castaneum|8420     ------------------------------------------------------------
Bombyx_mori|4229             ------------------------------------------------------------
                                                                                         

Daphnia_pulex|20605          ------------------------------------------------------------
Pediculus_humanus|7481       ------------------------------------------------------------
Drosophila_persimilis|2096   CAACAGAATCAGCAACAGACGACCACAAAGTTCGCCATGTCCTCGCTAGCAGCGGAGCCC
Drosophila_melanogaster|1258 CAACAGCAGCATCAGCAGACCGCCACCAAGTTCGCCATGTCATCGCTAGCAGCTGAGCCT
Drosophila_yakuba|1640       CAACAGCAGCAGCAGCAGACCGCCACCAAGTTCGCCATGTCTTCGCTAGCGGCCGAGCCC
Nasonia_vitripennis|2602     ------------------------------------------------------------
Apis_mellifera|36690         ------------------------------------------------------------
Linepithema_humile|6106      ------------------------------------------------------------
Pogonomyrmex_barbatus|5297   ------------------------------------------------------------
Tribolium_castaneum|8420     ------------------------------------------------------------
Bombyx_mori|4229             ------------------------------------------------------------
                                                                                         

Daphnia_pulex|20605          ------------------------------------------------------------
Pediculus_humanus|7481       ------------------------------------------------------------
Drosophila_persimilis|2096   CTGCCCCAGGCCCACAAACCGGATGAAATCACAGCAGCCGCCAGCACCAGTGATGTGGCA
Drosophila_melanogaster|1258 CTG---CAGTCGCAGAAATCGGATGAAATCACGGCCAGCACGGGCGGCGGAGATGTGGAG
Drosophila_yakuba|1640       CTG---CAGTCGCAGAAACCGGATGAAATCACGGCCAGCACG---GGCGGCGATGCGGAG
Nasonia_vitripennis|2602     ------------------------------------------------------------
Apis_mellifera|36690         ------------------------------------------------------------
Linepithema_humile|6106      ------------------------------------------------------------
Pogonomyrmex_barbatus|5297   ------------------------------------------------------------
Tribolium_castaneum|8420     ------------------------------------------------------------
Bombyx_mori|4229             ------------------------------------------------------------
                                                                                         

Daphnia_pulex|20605          ------------------------------------------------------------
Pediculus_humanus|7481       ------------------------------------------------------------
Drosophila_persimilis|2096   GCGTCCGGCACCACTCCCAGCAATGGCCTGGGCGCCTCGTGCCAGGAGGCTGCCTCC---
Drosophila_melanogaster|1258 ACGCCC------------------GGACTGGGCGCATCCTGCCACGAGGTGGCCGCCGCA
Drosophila_yakuba|1640       GCACCC------------------GGACTAGGCGCATCCTGCCACGAGGTGGCCTCCGCA
Nasonia_vitripennis|2602     ------------------------------------------------------------
Apis_mellifera|36690         ------------------------------------------------------------
Linepithema_humile|6106      ------------------------------------------------------------
Pogonomyrmex_barbatus|5297   ------------------------------------------------------------
Tribolium_castaneum|8420     ------------------------------------------------------------
Bombyx_mori|4229             ------------------------------------------------------------
                                                                                         

Daphnia_pulex|20605          ---------------------------ATGACAGCAGTTAATTCTAAAGTTCTTGAGTTT
Pediculus_humanus|7481       ---------------------ATGTCAATATCTTCAAATTCTGCAAATGTCATTACTTTT
Drosophila_persimilis|2096   ------AGCACGGGCAAGAAGCCCTGCTTCAGCACTGGTCTCGCCGAGATTCTGCAGTTC
Drosophila_melanogaster|1258 TCGGCCAGTGCCGGCAAGAAGCCCTGCTTCAGCTCGGGCCTCGGCGAGATACTTCAGTTC
Drosophila_yakuba|1640       TCGGCCAGTGCCGGCAAGAAGCCCTGCTTCAGCTCGGGCCTCGGCGAGATACTCCAGTTC
Nasonia_vitripennis|2602     ------------------ACAGTCTTCTTCGTACTCGGAGCCAGAACTATGATGGAATTC
Apis_mellifera|36690         ---------------------------------ATGGATATCGAGAAATTACAAGAATTT
Linepithema_humile|6106      ------------------------------------------------------------
Pogonomyrmex_barbatus|5297   ------------------------------ATGCAAGATACAAAGAGACTACAAGAGTTT
Tribolium_castaneum|8420     ------------------------------------------------------------
Bombyx_mori|4229             ------------------------------------------------------------
                                                                                         

Daphnia_pulex|20605          TGCCAGTTCATGGGAAGATTGAAGCATCTTCCGAGAACTGGCTGGGTGATAAGGGACATT
Pediculus_humanus|7481       TTACAACTAGTCGGAAAACTCAAGAATTTGAAACGAACAGGATGGGTTATCAGGAACGTG
Drosophila_persimilis|2096   ATGGAGCTCATCGGAAATCTAAAGCACACCAAACGCACTGGATGGGTGCTGCGTGATGTC
Drosophila_melanogaster|1258 ATGGAGCTCATCGGCAACCTGAAGCACACAAAACGCACCGGATGGGTGCTGCGTGATGTC
Drosophila_yakuba|1640       ATGGAGCTCATCGGCAACCTGAAGCACACAAAGCGCACCGGATGGGTGCTGCGTGATGTC
Nasonia_vitripennis|2602     ATGGAGCTTATCGGCAGATTGAAGCACCTGAAAAGGACAGGCTGGGTGATTAGAAATGTT
Apis_mellifera|36690         ATGGAATTGGTTGGTCGATTGAAACATATGAAAAGAACAGGATGGGTTCTTAAAAATGTT
Linepithema_humile|6106      ATGGAATTGGTTGGCCGACTAAAACATATGAAAAGAGAAGGATGGGTGAAACGGAATATA
Pogonomyrmex_barbatus|5297   ATGGAGCTAGTTGGCCGATTAAAGCATATGAAAAGGACAGGATGGGTAATACGGAATATA
Tribolium_castaneum|8420     ATGGACCTGGTGAACAACTTGAAACACAGTTCCCGGAGGGGTTGGTCACTTCTTAATGTG
Bombyx_mori|4229             ------------------------------------------------------------
                                                                                         

Daphnia_pulex|20605          CCTAATTGTGAAACTGTGGCTGGTCACATGTACCGAATGGCCATGTTGACTTTTCTTTTG
Pediculus_humanus|7481       GAAGATCCAGAAACGGTTTCAGGTCACATGTACAGGATGAGTGTCATGACTTTTCTTTTA
Drosophila_persimilis|2096   AACGACTGTGAATCGATATCGGGTCACATGTATCGGATGAGCATGCTCACATTTCTGCTA
Drosophila_melanogaster|1258 AACGACTGCGAATCGATTTCGGGTCACATGTACAGGATGAGCATGCTAACCTTTCTGCTC
Drosophila_yakuba|1640       AACGACTGCGAATCGATTTCGGGTCACATGTACAGGATGAGCATGCTTACCTTCCTGCTG
Nasonia_vitripennis|2602     CCTGACCCTGAAACTATTTCAGGTCACATGTACAGAATGGCTATGTTATCCTTCTTAGTT
Apis_mellifera|36690         TCTGATCCAGAAACAATTGCAGGTCATATGTATAGGATGGCTATGTTTTCTTTCTTGGTA
Linepithema_humile|6106      ACTGAACCTGAGACAATTGCTGGACATATGTATCGAATGGCAATGTTATCATTTCTAGTG
Pogonomyrmex_barbatus|5297   CCTGATTCCGAAACAATTGCTGGACATATGTATCGAATGGCGATGTTATCTTTTCTAGTG
Tribolium_castaneum|8420     GAAAACCACGAACAAATTGCCGGACACATGTACGCAATGGGCATGATGACCTTCCTAATA
Bombyx_mori|4229             ---------------------------ATGTACAGGATGGGAATCATGACATTCTTACTA
                                                        *****   .***.  .*  * :* **  *  * 

Daphnia_pulex|20605          GAAACTAAAGAT------------GTTGATATTCAAAGGTGCCTTAAAATGTGTCTTGTC
Pediculus_humanus|7481       CCAGAATCTGCTGGG---------GTTGATAAAGCTAGGTGCATGAAATTGTCAATAGTG
Drosophila_persimilis|2096   GATGGCAGCGAGGGA---------CTCAACCAGATACGGTGCATGGAACTGGCTCTGGTG
Drosophila_melanogaster|1258 GACGGCAGTGAGGGA---------CTCAACCAGATACGCTGCATGGAACTGGCGCTGGTA
Drosophila_yakuba|1640       GATGGCAGTGAGGGA---------CTCAACCAGATTCGCTGCATGGAACTGGCACTCGTA
Nasonia_vitripennis|2602     GACCCTAAAGAGAAC---------CTAGACAAATCAAAATTGATTGAGATGGCATTAGTC
Apis_mellifera|36690         GAT---AATGAAAAT---------TTAGATAAAGTCAAAATTATGCAAATGGCTTTAATA
Linepithema_humile|6106      GATGGGAAAGAAAAT---------TTAGATAAAACCAAAATAATGCAAATGACTTTAATT
Pogonomyrmex_barbatus|5297   GATGGAAAAGAAAAT---------TTAGACAAAACTAAAATAATGCAAATGACGTTAATT
Tribolium_castaneum|8420     GGCGACGAATCCAAT---------TTGGATAGATTCAAGTGTTTACAATTAGCCCTAGTT
Bombyx_mori|4229             ACAGAAGAAAATAATCCTACTAAATTGGACAGAATAAAATGTCTTCAAATAGCTCTCATT
                                       .              * .* .     .. :   *  *. *.    * .* 

Daphnia_pulex|20605          CACGATATGGCAGAAAGCATTGTTGGTGATTTGACTCCTCACTGTGGCGTCTCAGTTGAA
Pediculus_humanus|7481       CATGATCTTGCTGAATGCATTGTCGGTGACATAACACCTTATTGTGGAATAGATCCTGCT
Drosophila_persimilis|2096   CACGACCTGGCGGAGAGTCTAGTGGGGGATATAACCCCATTCTGTGGTGTGTCCAAGGAG
Drosophila_melanogaster|1258 CACGATTTGGCAGAGAGTTTGGTGGGTGACATAACGCCATTCTGCGGGATATCCAAAGAC
Drosophila_yakuba|1640       CACGATTTGGCTGAGAGTTTGGTGGGTGACATCACGCCGTTCTGCGGGATTTCCAAAGAC
Nasonia_vitripennis|2602     CATGACTTGGCGGAGTGCATTGTTGGTGATATCACCCCACACTGCGGTGTATCACCAGAA
Apis_mellifera|36690         CATGATTTAGCTGAATGTATTGTAGGTGATATAACACCTTCTTGTGGTATTCCATCTGAA
Linepithema_humile|6106      CACGATCTAGCCGAATGCATTGTGGGAGATATAACACCTTTCTGTGGTATTTCGCCAGAT
Pogonomyrmex_barbatus|5297   CATGATCTCGCCGAATGCATTGTAGGAGATATAACACCTCACTGCGGCATATCGCCAGAT
Tribolium_castaneum|8420     CATGACCTGGCCGAATGCATTGTGGGGGATATAACCCCCCATGACAACATCCCCGAAGAC
Bombyx_mori|4229             CACGACTTGGCTGAGTGCATTGTTGGAGACCTCACACCTCACTGTGGAGTGAGTCCTGAA
                             ** **  * ** **.:*  * ** ** **  * ** **     . .. .*       *. 

Daphnia_pulex|20605          GACAAACATCGTCAAGAGGAAGAAGCCATGGAGACTCTAATTAAATTGGTGCCTGAATTG
Pediculus_humanus|7481       GAAAAACATAGGCAAGAAGATGTTGCTATGAAGGAAATAACCCAATTGATAGGAGACAGT
Drosophila_persimilis|2096   GAAAAGAGGGCCATGGAGTTCAAGGCTATGGAGGATATATGCAAACTGATCGAACCCCGC
Drosophila_melanogaster|1258 GATAAGCGAGCCATGGAGTTCAAGGCGATGGAAGATATCTGCAAGCTGATCGAGCCTCGT
Drosophila_yakuba|1640       GATAAGCGAGCCATGGAGTTCAAGGCGATGGAAGATATCTGCAAGCTGATCGAGCCCCGC
Nasonia_vitripennis|2602     GATAAGCACAGGATGGAAGATGAAGCAATGGAAAAGATTTGTAAAAATCTTGGAGACAGG
Apis_mellifera|36690         ATTAAGCATAAATTAGAAGATGAAGCTATGGAAGATATTTGCAAACTTCTTGGAGATAGA
Linepithema_humile|6106      GAAAAACACAGGCGAGAAGATGAAGCTATGGAAGACATTTGTAAATTGCTTGGTGATAAG
Pogonomyrmex_barbatus|5297   GAGAAACATAGGAGGGAAGATAAAGCTATGGAGGATATTTGTAAGCTGCTGGGTGATAAA
Tribolium_castaneum|8420     AAGAAACACGCCCTGGAAGACAAGGCAATGAAGGAAATCACGTCGCACCTGGGGGAGGAT
Bombyx_mori|4229             GAAAAACACAGAAGAGAAGATGAGGCCATGAAGACAATTTCAGGACTAACTGGAATTGCT
                             .: **...      .**. : .: ** ***.*... .* :    . :             

Daphnia_pulex|20605          TCTGGTGAAGATATGAAAAGTCTGTTCATGGAGTATGAAAACCAAGAAACTCAAGAAGCA
Pediculus_humanus|7481       ---GGTGTAGAAATTTATAAGCTGTATAAGGAATATGAAGCTCAAGTAACTAACGAGTCG
Drosophila_persimilis|2096   ---GGCAAGCGCATAATGGAGCTCTTCGAGGAGTACGAACATGCAGAAAGCGCTGAGAGC
Drosophila_melanogaster|1258 ---GGCAAACGCATTATGGAGCTGTTTGAGGAATACGAGCATGGACAGACTGCCGAGAGC
Drosophila_yakuba|1640       ---GGAAAACGCATTATGGAACTGTTTGAGGAATACGAGCATGGGCAGACAGCAGAGAGC
Nasonia_vitripennis|2602     ---GGAGCTGAAATGCTCAAATTGTTTAGAGAATATGAGAAGCAAGAATCTGCTGAAGCC
Apis_mellifera|36690         ---GGACCTATGATATTGGAAATATTTCGAGAATATGAAAAACAAGAATCCCCGGAAGCA
Linepithema_humile|6106      ---GGACCTGAAATACTACAAATGTTTCGGGAATATGAAAAGCAGGAATCTCCCGAGGCA
Pogonomyrmex_barbatus|5297   ---GGACCTGAAATACTACAAATATTTCGTGAATATGAAAAACAAGAATCTCCGGAAGCA
Tribolium_castaneum|8420     ATCGGCACTATGATTTATAAGCTTTACAAAGAGTACGAAGCCAAAGAGACACCTGAAGCA
Bombyx_mori|4229             ---GGTGATAGAATGTATGAATTATACAAAGAATACGAAGACCAAAGTTCACCTGAGGCT
                                **       **  :  .  * *:    **.** **. .   .   :   . **.   

Daphnia_pulex|20605          ATTTTGGTCAAAGATCTCGACCGCTTCGACATGATTTGCCAAGCGTACGAATACGAGGAG
Pediculus_humanus|7481       AAATATGTGAAAGATTTGGACAAATTGGATATGGTACTACAGGCTTATGAATATGAAAAA
Drosophila_persimilis|2096   AGGTTCGTCAAGGATCTGGATCGGCTGGACATGGTGATGCAGGCGTTCGAGTACGAGAAA
Drosophila_melanogaster|1258 AAGTTCGTCAAGGATTTGGATCGTCTGGATATGGTTATGCAGGCGTTCGAGTACGAGAAG
Drosophila_yakuba|1640       AAGTTCGTTAAGGATTTGGATCGCCTGGATATGGTCATGCAGGCGTTCGAGTACGAGAAG
Nasonia_vitripennis|2602     TGTTACGTGAAAGATTTGGACAGAATAGATCTATTAATGCAAGCATTTGAGTACGAAAAA
Apis_mellifera|36690         AAATATGTTAAAGATTTAGACAGATTAGATCTAATTATGCAAGCATATGAATATGAAAAA
Linepithema_humile|6106      CAATATGTAAAAGACTTGGATAGACTGGATTTGTTGATGCAAGCATACGAATATGAGAAA
Pogonomyrmex_barbatus|5297   CAGTATGTAAAAGATTTAGATAGGCTAGACTTACTGATGCAAGCATACGAATATGAGAAA
Tribolium_castaneum|8420     ATATTTGTCAAAGATTTAGATCGTTTAGATTTGCTAATTACCGCCGTTCATTACGAAAAA
Bombyx_mori|4229             AAATTTGCTAAAGACTTGGACCGTTATGATATGATCCTACAAGCATTTGAGTACGAAAAA
                                *: *  **.**  * ** ..  : **  *. *    .. **  :  * ** **..*.

Daphnia_pulex|20605          TCTCACAAGACGCCTCTGGCTCTGCAAGAATTCTTCGTTGCAACCGAGGGTCGTTTCAAG
Pediculus_humanus|7481       ATTGGTGGTTATCCTGGAAAGCTAGAAGAATTTTTTAAATCAACATTAAATAAATTTTCT
Drosophila_persimilis|2096   CGCGACAATTGTCTGCTGAAGCATCAGGAGTTCTTCGACTCGACGGAGGGAAAGTTCAAT
Drosophila_melanogaster|1258 CGGGACAATTGCCTTCTGAAGCACCAGGAGTTCTTCGACTCAACGGAGGGCAAGTTCAAC
Drosophila_yakuba|1640       CGGGACAATTGCCTTCTGAAGCACCAGGAGTTCTTCGACTCAACGGAGGGCAAGTTCAAC
Nasonia_vitripennis|2602     CGTGATAATAGCCCTGGGCATCTACAGGAATTTTTTACAAACACCCAGGAAAAAATCAAG
Apis_mellifera|36690         AGAGATAATATTCCTGGAAAATTAGAAGAATTTTTTACTACTACAAGCGGCAAGATAAGG
Linepithema_humile|6106      AGAGATAATATTCCGGGAGAACTAAACGAGTTTTTTGTCGCGATTAATGGCAAGATCAGA
Pogonomyrmex_barbatus|5297   AGAGACAACATTCCGGGAGAACTTGACGAATTCTTCGTTGCGATTAATGGAAAGATTAGA
Tribolium_castaneum|8420     CGTGATAACACGCCAAAGAAAATGCAGGAGTTTTTCGACAGCACTGAAGGTAAATTTAAG
Bombyx_mori|4229             CGTGAAAATACTCCAAAGAAATGTCAAGAGTTCTTTACTGCAACAGAGGGAAAATTTGAC
                                 . .. :  *    . .     * **.** ** .     *     .. .. :*    

Daphnia_pulex|20605          CATCCGGAAGTGAAGCGCTGGGTGGATGAATTAAATCAGAAGCGAGCCCTGCTGACAGCT
Pediculus_humanus|7481       TTTCCATGGACTATGGATATTGTCCAAGAACTTTATAGACAAAGAAACCTATTTTTGAGT
Drosophila_persimilis|2096   CATCCGTTTGTTAAGAAGCTGGTAAACGAGATCTACGAGCAGAGGAATGTACTGGCCAAG
Drosophila_melanogaster|1258 CATCCGTTTGTTAAGAAGCTGGTCAACGAGATCTACGAGCAGAGGGATGTCCTGGCCAAG
Drosophila_yakuba|1640       CATCCGTTCGTTAAGAAGCTGGTCAACGAGATCTACGAGCAGAGGGATGTCCTGGCCAAG
Nasonia_vitripennis|2602     GATCCTTTCCTTGGTGACATTGTGAGGGAAATTAACAGTCAACGAGAAGCACTCTCCAAG
Apis_mellifera|36690         CATCCTTTTATTCAAAAATTAGCATCTGAAATTATTGCAAGAAGACAAGCTTTATGTTGT
Linepithema_humile|6106      CATCCTTTTATCAATAAAATTGCCATAGACATAACCGAGGAGAGGGATAAGTTGTGTCGT
Pogonomyrmex_barbatus|5297   CATCCTTTCATTAATAAAATCGCCATTGACATAACCGAAGAAAGAGATAAGTTATGTCGC
Tribolium_castaneum|8420     CACCCTTTTATCCAGAAACTAGTCAAGACCTTAATTGAGTACCGCAATAGTCCCCACTTA
Bombyx_mori|4229             CACCCGTTTATACAAGATTTAGTCAAAGAACTGTACTTGCAAAGAGAAATCTTTGAGAAA
                              : **           .    *     ..  * :      . .*  .             

Daphnia_pulex|20605          ------------------------------------------------------------
Pediculus_humanus|7481       ---------------------------------------------------------AAA
Drosophila_persimilis|2096   GCAAAGGGCGCCACACCGCCGCCGGCCATTGAAGTGCCCAAAATGGAGTTGCCCCCTCCC
Drosophila_melanogaster|1258 GCAAAGGGCGCCACACCACCGCCGGCCATCGAGGTGCCTAGCATGGAG---AGATCTTCG
Drosophila_yakuba|1640       GCAAAGGGCGCCACACCACCGCCGACCATTGAGGTGCCTAGCATGGAG---AGATCATCG
Nasonia_vitripennis|2602     ------------------------------------------------------------
Apis_mellifera|36690         ------------------------------------------------------------
Linepithema_humile|6106      ------------------------------------------------------------
Pogonomyrmex_barbatus|5297   ------------------------------------------------------------
Tribolium_castaneum|8420     ---------------------------------------------------AACCAACAA
Bombyx_mori|4229             ---------------------------------------------------------CAT
                                                                                         

Daphnia_pulex|20605          CCCGTGGCGAATGGCGAAGCGGACAAGCCACTCAACTCTTAA
Pediculus_humanus|7481       AATAAAGTAAAT---------------------------TAA
Drosophila_persimilis|2096   AAACTGGCCAACGGGCACAACAGCTCAAGT---------TGA
Drosophila_melanogaster|1258 AAACTTGCTAACGGGCATGACGGCTCGAGT---------TGA
Drosophila_yakuba|1640       AAACTTGCTAACGGGCATGACGGCTCGAGT---------TGA
Nasonia_vitripennis|2602     ACCCTGGCTAACGGTAAT------------------------
Apis_mellifera|36690         AATTTAACTACATCAGTA---------------------TAA
Linepithema_humile|6106      AATTCAAATGCCGCAAAA---------------------TAA
Pogonomyrmex_barbatus|5297   AACGTGAATGTTTCGAAA---------------------TAA
Tribolium_castaneum|8420     ACATTACCCAATAACACAATAATGAAAGAA---------TAA
Bombyx_mori|4229             ACCGTTGTCAATGGTCATGTG------------------TAA
                             ..       .                                

multiple sequence alignment in CLUSTALW format


Daphnia_pulex|15407          ------------------------------------------------------------
Pediculus_humanus|7327       ------------------------------------------------------------
Drosophila_persimilis|15131  MFSLQ--QIIKAATANSGNCGVGGSDLYRLLRH--RLTSSAATTAITTTTTTNTAIPKKS
Drosophila_melanogaster|1183 MFSLQLQQLLRATAS--------------------GVTSGATKTLCTAT----------A
Drosophila_yakuba|4509       MFSLQ--QLLRATATSN-----GGNDLSRLLRHMGGVTSGATTTLCTAS-----------
Nasonia_vitripennis|8241     ------------------------------------------------------------
Apis_mellifera|5152          ------------------------------------------------------------
Linepithema_humile|13730     ------------------------------------------------------------
Pogonomyrmex_barbatus|2264   ------------------------------------------------------------
Tribolium_castaneum|8677     ------------------------------------------------------------
Bombyx_mori|3527             ------------------------------------------------------------
                                                                                         

Daphnia_pulex|15407          ------------------------------------------------------------
Pediculus_humanus|7327       ------------------------------------------------------------
Drosophila_persimilis|15131  SQATAVSSDENFSHNAIRSSHSNPNGCCYGESDSESAHSVNGNLST-QFARKLLQQRRQD
Drosophila_melanogaster|1183 SAATKHSSQAKFGDNSSHGSPSHTDGRSHGESESDLESAHGQNFTSHHLARRILQQRSQD
Drosophila_yakuba|4509       --ATKHSSQAKFGDNSSHGSPSHTDGRSHGESESDLESAHGQNFTAHHFARRILQQRSQD
Nasonia_vitripennis|8241     ------------------------------------------------------------
Apis_mellifera|5152          ------------------------------------------------------------
Linepithema_humile|13730     ------------------------------------------------------------
Pogonomyrmex_barbatus|2264   ------------------------------------------------------------
Tribolium_castaneum|8677     ------------------------------------------------------------
Bombyx_mori|3527             ------------------------------------------------------------
                                                                                         

Daphnia_pulex|15407          ------------------------------------------------------------
Pediculus_humanus|7327       ------------------------------------------------------------
Drosophila_persimilis|15131  IQRLIHTQPPSGH-GTKSSQQQNQQQTTTKFAMSSLAAEPLPQAHKPDEITAAASTSDVA
Drosophila_melanogaster|1183 IQRHIHTQSAKGQTSAKSSQQQQHQQTATKFAMSSLAAEPL-QSQKSDEITASTGGGDVE
Drosophila_yakuba|4509       IQRHIHTQSSKGQTRAKSSQQQQQQQTATKFAMSSLAAEPL-QSQKPDEITAST-GGDAE
Nasonia_vitripennis|8241     ------------------------------------------------------------
Apis_mellifera|5152          ------------------------------------------------------------
Linepithema_humile|13730     ------------------------------------------------------------
Pogonomyrmex_barbatus|2264   ------------------------------------------------------------
Tribolium_castaneum|8677     ------------------------------------------------------------
Bombyx_mori|3527             ------------------------------------------------------------
                                                                                         

Daphnia_pulex|15407          -----------------------------MTAVNSKVLEFCQFMGRLKHLPRTGWVIRDI
Pediculus_humanus|7327       ---------------------------MSISSNSANVITFLQLVGKLKNLKRTGWVIRNV
Drosophila_persimilis|15131  ASGTTPSNGLGASCQEAAS---STGKKPCFSTGLAEILQFMELIGNLKHTKRTGWVLRDV
Drosophila_melanogaster|1183 TP------GLGASCHEVAAASASAGKKPCFSSGLGEILQFMELIGNLKHTKRTGWVLRDV
Drosophila_yakuba|4509       AP------GLGASCHEVASASASAGKKPCFSSGLGEILQFMELIGNLKHTKRTGWVLRDV
Nasonia_vitripennis|8241     --------------------------TVFFVLGARTMMEFMELIGRLKHLKRTGWVIRNV
Apis_mellifera|5152          -------------------------------MDIEKLQEFMELVGRLKHMKRTGWVLKNV
Linepithema_humile|13730     ----------------------------------------MELVGRLKHMKREGWVKRNI
Pogonomyrmex_barbatus|2264   ------------------------------MQDTKRLQEFMELVGRLKHMKRTGWVIRNI
Tribolium_castaneum|8677     ----------------------------------------MDLVNNLKHSSRRGWSLLNV
Bombyx_mori|3527             ------------------------------------------------------------
                                                                                         

Daphnia_pulex|15407          PNCETVAGHMYRMAMLTFLLETKD----VDIQRCLKMCLVHDMAESIVGDLTPHCGVSVE
Pediculus_humanus|7327       EDPETVSGHMYRMSVMTFLLPESAG---VDKARCMKLSIVHDLAECIVGDITPYCGIDPA
Drosophila_persimilis|15131  NDCESISGHMYRMSMLTFLLDGSEG---LNQIRCMELALVHDLAESLVGDITPFCGVSKE
Drosophila_melanogaster|1183 NDCESISGHMYRMSMLTFLLDGSEG---LNQIRCMELALVHDLAESLVGDITPFCGISKD
Drosophila_yakuba|4509       NDCESISGHMYRMSMLTFLLDGSEG---LNQIRCMELALVHDLAESLVGDITPFCGISKD
Nasonia_vitripennis|8241     PDPETISGHMYRMAMLSFLVDPKEN---LDKSKLIEMALVHDLAECIVGDITPHCGVSPE
Apis_mellifera|5152          SDPETIAGHMYRMAMFSFLVD-NEN---LDKVKIMQMALIHDLAECIVGDITPSCGIPSE
Linepithema_humile|13730     TEPETIAGHMYRMAMLSFLVDGKEN---LDKTKIMQMTLIHDLAECIVGDITPFCGISPD
Pogonomyrmex_barbatus|2264   PDSETIAGHMYRMAMLSFLVDGKEN---LDKTKIMQMTLIHDLAECIVGDITPHCGISPD
Tribolium_castaneum|8677     ENHEQIAGHMYAMGMMTFLIGDESN---LDRFKCLQLALVHDLAECIVGDITPHDNIPED
Bombyx_mori|3527             ---------MYRMGIMTFLLTEENNPTKLDRIKCLQIALIHDLAECIVGDLTPHCGVSPE
                                      ** *.:::**:  .     ::  : ::: ::**:**.:***:**  .:   

Daphnia_pulex|15407          DKHRQEEEAMETLIKLVPELSGEDMKSLFMEYENQETQEAILVKDLDRFDMICQAYEYEE
Pediculus_humanus|7327       EKHRQEDVAMKEITQLIGDS-GVEIYKLYKEYEAQVTNESKYVKDLDKLDMVLQAYEYEK
Drosophila_persimilis|15131  EKRAMEFKAMEDICKLIEPR-GKRIMELFEEYEHAESAESRFVKDLDRLDMVMQAFEYEK
Drosophila_melanogaster|1183 DKRAMEFKAMEDICKLIEPR-GKRIMELFEEYEHGQTAESKFVKDLDRLDMVMQAFEYEK
Drosophila_yakuba|4509       DKRAMEFKAMEDICKLIEPR-GKRIMELFEEYEHGQTAESKFVKDLDRLDMVMQAFEYEK
Nasonia_vitripennis|8241     DKHRMEDEAMEKICKNLGDR-GAEMLKLFREYEKQESAEACYVKDLDRIDLLMQAFEYEK
Apis_mellifera|5152          IKHKLEDEAMEDICKLLGDR-GPMILEIFREYEKQESPEAKYVKDLDRLDLIMQAYEYEK
Linepithema_humile|13730     EKHRREDEAMEDICKLLGDK-GPEILQMFREYEKQESPEAQYVKDLDRLDLLMQAYEYEK
Pogonomyrmex_barbatus|2264   EKHRREDKAMEDICKLLGDK-GPEILQIFREYEKQESPEAQYVKDLDRLDLLMQAYEYEK
Tribolium_castaneum|8677     KKHALEDKAMKEITSHLGEDIGTMIYKLYKEYEAKETPEAIFVKDLDRLDLLITAVHYEK
Bombyx_mori|3527             EKHRREDEAMKTISGLTGIA-GDRMYELYKEYEDQSSPEAKFAKDLDRYDMILQAFEYEK
                              *:  *  **: :        *  : .:: ***   : *:  .****: *::  * .**:

Daphnia_pulex|15407          SHKTPLALQEFFVATEGRFKHPEVKRWVDELNQKRALLTA--------------------
Pediculus_humanus|7327       IGGYPGKLEEFFKSTLNKFSFPWTMDIVQELYRQRNLFLS-------------------K
Drosophila_persimilis|15131  RDNCLLKHQEFFDSTEGKFNHPFVKKLVNEIYEQRNVLAKAKGATPPPAIEVPKMELPPP
Drosophila_melanogaster|1183 RDNCLLKHQEFFDSTEGKFNHPFVKKLVNEIYEQRDVLAKAKGATPPPAIEVPSME-RSS
Drosophila_yakuba|4509       RDNCLLKHQEFFDSTEGKFNHPFVKKLVNEIYEQRDVLAKAKGATPPPTIEVPSME-RSS
Nasonia_vitripennis|8241     RDNSPGHLQEFFTNTQEKIKDPFLGDIVREINSQREALSK--------------------
Apis_mellifera|5152          RDNIPGKLEEFFTTTSGKIRHPFIQKLASEIIARRQALCC--------------------
Linepithema_humile|13730     RDNIPGELNEFFVAINGKIRHPFINKIAIDITEERDKLCR--------------------
Pogonomyrmex_barbatus|2264   RDNIPGELDEFFVAINGKIRHPFINKIAIDITEERDKLCR--------------------
Tribolium_castaneum|8677     RDNTPKKMQEFFDSTEGKFKHPFIQKLVKTLIEYRNSPHL-----------------NQQ
Bombyx_mori|3527             RENTPKKCQEFFTATEGKFDHPFIQDLVKELYLQREIFEK-------------------H
                                     :***     ::  *     .  :   *                         

Daphnia_pulex|15407          PVANGEADKPLNS
Pediculus_humanus|7327       NKVN---------
Drosophila_persimilis|15131  KLANGHNSSS---
Drosophila_melanogaster|1183 KLANGHDGSS---
Drosophila_yakuba|4509       KLANGHDGSS---
Nasonia_vitripennis|8241     TLANGN-------
Apis_mellifera|5152          NLTTSV-------
Linepithema_humile|13730     NSNAAK-------
Pogonomyrmex_barbatus|2264   NVNVSK-------
Tribolium_castaneum|8677     TLPNNTIMKE---
Bombyx_mori|3527             TVVNGHV------