Orthologs Set ID: EOG4006C6


Orthology Database
OrthoDB4
Gene Symbol(s)
UGT3A1,UGT3A2

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Anolis carolinensis 9649 984, 1228, 1451
Bombyx mori 12014 113, 417, 520, 740, 1111, 1451
Bombyx mori 13385 512, 749, 984, 1228, 1451
Bos taurus 12729 103, 205, 338, 984, 1228, 1451
Bos taurus 12730 338, 984, 1220
Caenorhabditis elegans 14340 168, 262, 403, 840, 1228
Caenorhabditis elegans 25270 168, 403, 508, 1451
Callithrix jacchus 45121 205, 338, 984, 1228, 1451
Canis familiaris 22015 103, 205, 338, 984, 1228, 1451
Canis familiaris 22019 103, 205, 210, 335, 984, 1228, 1451
Choloepus hoffmanni 10632 87, 97, 199, 338, 984, 1228
Dasypus novemcinctus 14729 214, 338, 984, 1089, 1114, 1228, 1451
Dipodomys ordii 7215 103, 205, 332, 433, 495, 510, 525, 546, 582, 699, 984, 1014, 1020, 1146, 1228, 1451, 1508
Echinops telfairi 13652 30, 38, 42, 103, 205, 275, 338, 984, 1228, 1451
Equus caballus 14190 103, 205, 338, 984, 1228, 1451
Equus caballus 14192 103, 205, 338, 984, 1228, 1451
Equus caballus 14193 338
Felis catus 38352 103, 205, 338, 711, 984, 1228
Fugu rubripes 4293 103, 205, 338, 532, 739, 984, 1142, 1228, 1451, 1679
Gasterosteus aculeatus 19940 64, 103, 205, 338, 532, 739, 984, 1142, 1228, 1451
Gorilla gorilla 244 103, 205, 335, 984, 1228, 1451
Gorilla gorilla 249 103, 205, 338, 984, 1228, 1451
Homo sapiens 68741 103, 205, 338, 984, 1228, 1451
Homo sapiens 68743 103, 205, 338, 984, 1228, 1451
Loxodonta africana 24713 103, 205, 338, 984, 1228, 1451
Microcebus murinus 19157 103, 205, 338, 984, 1228, 1451
Microcebus murinus 7068 346, 984, 1228, 1451, 1505
Mus musculus 13539 103, 202, 338, 984, 1228, 1451
Ochotona princeps 6294 103, 205, 338, 984, 1228
Ornithorhynchus anatinus 12628 338, 984, 1228, 1451
Oryctolagus cuniculus 2791 103, 205, 338, 984, 1228, 1451
Otolemur garnettii 7502 103, 205, 228, 318, 338, 984, 1050, 1062, 1228
Pan troglodytes 29694 103, 205, 338, 984, 1228, 1451
Pan troglodytes 29695 103, 205, 338, 984, 1228, 1451
Pongo abelii 21971 103, 205, 338, 984, 1228, 1451
Pteropus vampyrus 14496 103, 205, 338, 984, 1228
Rattus norvegicus 18092 984, 1228, 1451
Rhesus macaque 31907 103, 205, 338, 984, 1228, 1451
Rhesus macaque 31909 103, 205, 338, 984, 1228, 1451
Tarsius syrichta 4797 58, 103, 205, 338, 966, 984, 1228, 1332, 1451
Tarsius syrichta 7332 25, 51, 103, 187, 189, 202, 338, 984, 1158, 1228, 1451, 1602, 1707
Tupaia belangeri 13132 103, 205, 338, 984, 1228, 1451
Tursiops truncatus 8861 103, 205, 338, 459, 537, 690, 699, 727, 1230
Xenopus tropicalis 1473 250, 282, 313, 339, 361, 984, 1228, 1451
Xenopus tropicalis 1478 984, 1228, 1451
Xenopus tropicalis 2244 733, 790, 814, 984, 1228, 1451
Xenopus tropicalis 2247 107, 205, 338, 915, 1039

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 9649 ENSACAT00000009028 100564600 ENSACAG00000008989 ugt3a2 anoCar1
Bombyx mori 12014 BGIBMGA010287-TA v2.0
Bombyx mori 13385 BGIBMGA010100-TA v2.0
Bos taurus 12729 ENSBTAT00000003497 537188 ENSBTAG00000002701 LOC537188 bosTau4
Bos taurus 12730 ENSBTAT00000029097 ENSBTAG00000039454 bosTau4
Caenorhabditis elegans 14340 Y37E11AR.5, NM_068009 177139 Y37E11AR.5 ugt-45 ce6
Caenorhabditis elegans 25270 T19H12.9, NM_071908 178880 WBGene00020592 ugt-12 ce6
Callithrix jacchus 45121 ENSCJAT00000035926 100396365 ENSCJAG00000018354 LOC100396365 calJac3
Canis familiaris 22015 ENSCAFT00000029747 100855676 ENSCAFG00000023144 LOC100855676 canFam2
Canis familiaris 22019 ENSCAFT00000029750 489231 ENSCAFG00000018738 canFam2
Choloepus hoffmanni 10632 ENSCHOT00000010625 ENSCHOG00000010607 choHof1
Dasypus novemcinctus 14729 ENSDNOT00000008619 ENSDNOG00000008622 dasNov2
Dipodomys ordii 7215 ENSDORT00000008362 ENSDORG00000008362 dipOrd1
Echinops telfairi 13652 ENSETET00000013292 ENSETEG00000013293 TENREC
Equus caballus 14190 ENSECAT00000009115 ENSECAG00000008900 equCab2
Equus caballus 14192 ENSECAT00000010690 100067792 ENSECAG00000010396 LOC100067792 equCab2
Equus caballus 14193 ENSECAT00000011007 ENSECAG00000010718 equCab2
Felis catus 38352 ENSFCAT00000001017 101099779 ENSFCAG00000001017 felCat3
Fugu rubripes 4293 ENSTRUT00000042925 101079999 ENSTRUG00000016713 UGT3A1 fr2
Gasterosteus aculeatus 19940 ENSGACT00000008110 ENSGACG00000006107 UGT3A1 gasAcu1
Gorilla gorilla 244 ENSGGOT00000008701 101141633 ENSGGOG00000008662 UGT3A1 gorGor3
Gorilla gorilla 249 ENSGGOT00000003126 101142258 ENSGGOG00000003108 UGT3A2 gorGor3
Homo sapiens 68741 ENST00000274278 133688 ENSG00000145626 UGT3A1 hg19,GRCh37
Homo sapiens 68743 ENST00000282507 167127 ENSG00000168671 UGT3A2 hg19,GRCh37
Loxodonta africana 24713 ENSLAFT00000000414 100665586 ENSLAFG00000000415 loxAfr3
Microcebus murinus 7068 ENSMICT00000006567 ENSMICG00000006575 micMur1
Microcebus murinus 19157 ENSMICT00000017827 ENSMICG00000017827 micMur1
Mus musculus 13539 ENSMUST00000022861 105887 ENSMUSG00000072664 Ugt3a1 mm9
Ochotona princeps 6294 ENSOPRT00000010044 ENSOPRG00000010049 OchPri2.0
Ornithorhynchus anatinus 12628 ENSOANT00000005718 100087188 ENSOANG00000003603 ornAna1
Oryctolagus cuniculus 2791 ENSOCUT00000011416 100353356 ENSOCUG00000011414 LOC100353356 oryCun2.0
Otolemur garnettii 7502 ENSOGAT00000007232 100959234 ENSOGAG00000007228 LOC100959234 otoGar1
Pan troglodytes 29694 ENSPTRT00000031177 461920 ENSPTRG00000016793 UGT3A2 panTro2
Pan troglodytes 29695 ENSPTRT00000031175 471571 ENSPTRG00000016792 UGT3A1 panTro2
Pongo abelii 21971 ENSPPYT00000017898 ENSPPYG00000015398 UGT3A1 ponAbe2
Pteropus vampyrus 14496 ENSPVAT00000001517 ENSPVAG00000001518 pteVam1
Rattus norvegicus 18092 ENSRNOT00000033513 294793 ENSRNOG00000025010 Ugt3a2 rn4
Rhesus macaque 31907 ENSMMUT00000009651 700115 ENSMMUG00000006907 UGT3A1 rheMac2
Rhesus macaque 31909 ENSMMUT00000009654 700238 ENSMMUG00000006910 UGT3A2 rheMac2
Tarsius syrichta 7332 ENSTSYT00000006578 ENSTSYG00000006598 tarSyr1
Tarsius syrichta 4797 ENSTSYT00000004742 ENSTSYG00000004761 tarSyr1
Tupaia belangeri 13132 ENSTBET00000013133 ENSTBEG00000013144 tupBel1
Tursiops truncatus 8861 ENSTTRT00000008267 ENSTTRG00000008271 turTru1
Xenopus tropicalis 1473 ENSXETT00000013403 100488328 ENSXETG00000006082 xenTro2
Xenopus tropicalis 1478 ENSXETT00000019852 448540 ENSXETG00000009055 ugt3a2 xenTro2
Xenopus tropicalis 2244 ENSXETT00000013408 ENSXETG00000006085 xenTro2
Xenopus tropicalis 2247 ENSXETT00000019855 ENSXETG00000009060 xenTro2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Anolis carolinensis 8691 ENSACAP00000008837 100564600 ENSACAG00000008989 ugt3a2 anoCar1
Bombyx mori 10100 BGIBMGA010100-PA v2.0
Bombyx mori 10287 BGIBMGA010287-PA v2.0
Bos taurus 11330 ENSBTAP00000003497 537188 ENSBTAG00000002701 LOC537188 bosTau4
Bos taurus 1528 ENSBTAP00000029097 ENSBTAG00000039454 bosTau4
Caenorhabditis elegans 17034 Y37E11AR.5 177139 Y37E11AR.5 ugt-45 ce6
Caenorhabditis elegans 22531 T19H12.9 178880 WBGene00020592 ugt-12 ce6
Callithrix jacchus 36381 ENSCJAP00000034007 100396365 ENSCJAG00000018354 LOC100396365 calJac3
Canis familiaris 23400 ENSCAFP00000027646 100855676 ENSCAFG00000023144 LOC100855676 canFam2
Canis familiaris 24633 ENSCAFP00000027648 489231 ENSCAFG00000018738 canFam2
Choloepus hoffmanni 9385 ENSCHOP00000009376 ENSCHOG00000010607 choHof1
Dasypus novemcinctus 13029 ENSDNOP00000006672 ENSDNOG00000008622 dasNov2
Dipodomys ordii 6771 ENSDORP00000007847 ENSDORG00000008362 dipOrd1
Echinops telfairi 10765 ENSETEP00000010779 ENSETEG00000013293 TENREC
Equus caballus 6958 ENSECAP00000006900 ENSECAG00000008900 equCab2
Equus caballus 8385 ENSECAP00000008280 100067792 ENSECAG00000010396 LOC100067792 equCab2
Equus caballus 8683 ENSECAP00000008558 ENSECAG00000010718 equCab2
Felis catus 3951 ENSFCAP00000000947 101099779 ENSFCAG00000001017 felCat3
Fugu rubripes 42781 ENSTRUP00000042781 101079999 ENSTRUG00000016713 UGT3A1 fr2
Gasterosteus aculeatus 7779 ENSGACP00000008091 ENSGACG00000006107 UGT3A1 gasAcu1
Gorilla gorilla 232 ENSGGOP00000008467 101141633 ENSGGOG00000008662 UGT3A1 gorGor3
Gorilla gorilla 237 ENSGGOP00000003058 101142258 ENSGGOG00000003108 UGT3A2 gorGor3
Homo sapiens 19076 ENSP00000274278 133688 ENSG00000145626 UGT3A1 hg19,GRCh37
Homo sapiens 19345 ENSP00000282507 167127 ENSG00000168671 UGT3A2 hg19,GRCh37
Loxodonta africana 7368 ENSLAFP00000000353 100665586 ENSLAFG00000000415 loxAfr3
Microcebus murinus 6005 ENSMICP00000005999 ENSMICG00000006575 micMur1
Microcebus murinus 16234 ENSMICP00000016236 ENSMICG00000017827 micMur1
Mus musculus 35592 ENSMUSP00000022861 105887 ENSMUSG00000072664 Ugt3a1 mm9
Ochotona princeps 5467 ENSOPRP00000009176 ENSOPRG00000010049 OchPri2.0
Ornithorhynchus anatinus 5664 ENSOANP00000005716 100087188 ENSOANG00000003603 ornAna1
Oryctolagus cuniculus 3972 ENSOCUP00000009818 100353356 ENSOCUG00000011414 LOC100353356 oryCun2.0
Otolemur garnettii 6468 ENSOGAP00000006469 100959234 ENSOGAG00000007228 LOC100959234 otoGar1
Pan troglodytes 13983 ENSPTRP00000028797 461920 ENSPTRG00000016793 UGT3A2 panTro2
Pan troglodytes 14000 ENSPTRP00000028795 471571 ENSPTRG00000016792 UGT3A1 panTro2
Pongo abelii 15172 ENSPPYP00000017199 ENSPPYG00000015398 UGT3A1 ponAbe2
Pteropus vampyrus 13655 ENSPVAP00000001429 ENSPVAG00000001518 pteVam1
Rattus norvegicus 24690 ENSRNOP00000035070 294793 ENSRNOG00000025010 Ugt3a2 rn4
Rhesus macaque 23767 ENSMMUP00000009066 700115 ENSMMUG00000006907 UGT3A1 rheMac2
Rhesus macaque 23771 ENSMMUP00000009068 700238 ENSMMUG00000006910 UGT3A2 rheMac2
Tarsius syrichta 6718 ENSTSYP00000006019 ENSTSYG00000006598 tarSyr1
Tarsius syrichta 4386 ENSTSYP00000004335 ENSTSYG00000004761 tarSyr1
Tupaia belangeri 11390 ENSTBEP00000011375 ENSTBEG00000013144 tupBel1
Tursiops truncatus 8370 ENSTTRP00000007829 ENSTTRG00000008271 turTru1
Xenopus tropicalis 14011 ENSXETP00000013408 ENSXETG00000006085 xenTro2
Xenopus tropicalis 14016 ENSXETP00000019855 ENSXETG00000009060 xenTro2
Xenopus tropicalis 26895 ENSXETP00000013403 100488328 ENSXETG00000006082 xenTro2
Xenopus tropicalis 26913 ENSXETP00000019852 448540 ENSXETG00000009055 ugt3a2 xenTro2

multiple sequence alignment in CLUSTALW format


Bombyx_mori|13385              ------------------------------------------------------------
Bombyx_mori|12014              ATGGCGGATGATCTT---------------------------------------------
Gasterosteus_aculeatus|19940   CAAACTCTCTTACAC------------GGAATCCAGTTTGGAACGATTTTGGCAGGACTT
Fugu_rubripes|4293             TCTAATAACAGAATG---------AAGACTCAATTATGGATGTTTCCGCTTCTGGTTCTT
Xenopus_tropicalis|2247        ATGGCTGCAGGAAGG---------AAGAGCCTGACCCTTGGCTTGTTGGTGCAACACTTT
Xenopus_tropicalis|2244        ------------------------------------------------------------
Xenopus_tropicalis|1478        ------------------------------------------------------------
Xenopus_tropicalis|1473        ------------------------------------------------------------
Dipodomys_ordii|7215           ATGACTGGCCTGAGG---------ATGCTGAATCTAATCACCTTCTTTCTTCCTGGGATA
Anolis_carolinensis|9649       ------------------------------------------------------------
Ornithorhynchus_anatinus|12628 ------------------------------------------------------------
Echinops_telfairi|13652        ------------ATG---------GCTGTGCGAGCGCTTTCTCTCCTGGTGACCGGGCCC
Tupaia_belangeri|13132         ATGGCTGGGCAACGC---------ACGCTGCTTTTCCTGGGCTTTCTTCTCCCTGCAGTC
Felis_catus|38352              ATGGCGGGGCAGCGG---------GTGCTGCTGCTAGCTGGCTTCCTTCTGCCCGGGTTC
Bos_taurus|12730               ------------------------AAATATTTCCCTGTTGGTGTTTTCTTAGAT------
Tarsius_syrichta|7332          ATGGCTGGGCGGCGG---------GCGCTGCTTCTGGTGGGCTTCCTTCTC---GGGGTC
Dasypus_novemcinctus|14729     ------------------------------------------------------------
Choloepus_hoffmanni|10632      ATGCCTGGGCAGCCG---------GCGCTGCTTCTCGTCTGCTTGCTGCTGCGTGGGGTC
Mus_musculus|13539             ATGGCTGCACATCGG---------AGTTGGCTTCTTGTGAGCTTCTTTCTCCTTGAGGTT
Rattus_norvegicus|18092        ------------------------------------------------------------
Pteropus_vampyrus|14496        ATGGCTGGGCAGCGGGAGCCGCTTCTACTGCTTCTAGCTGGCCTCCTTCTACCTGAGCTC
Otolemur_garnettii|7502        ATGGCTGGGCAGCGG---------GTGCTGCTTCTAGTGGGCTTCTTTTACCCTGGGATC
Microcebus_murinus|7068        ------------------------------------------------------------
Microcebus_murinus|19157       ATGGCTGGGCGTTGG---------GTGCTGCTTCTAGTGGGCTCCCTTCTCCCTGGGATC
Tarsius_syrichta|4797          ATGGCTGGGCAGCAG---------GCGCTGCTTCTGGTGGGCTTCCTTCTCCCTGGGGTC
Rhesus_macaque|31907           ATGGCTGGGCAGCGG---------GTGCTGCTTCTAGTGGGCTTCCTTCTCTCTGGGGTC
Homo_sapiens|68741             ATGGTTGGGCAGCGG---------GTGCTGCTTCTAGTGGCCTTCCTTCTTTCTGGGGTC
Gorilla_gorilla|244            ATGGCTGGGCAGCGG---------GTGCTGCTTCTAGTGGCCTTCCTTCTTTCTGGGGTC
Pongo_abelii|21971             ATGGCTGGGCAGCGG---------GTGCTGCTTCTAGTGGCCTTCCTTCTTTCTGGGGTC
Pan_troglodytes|29695          ATGGCTGGGCAGCGG---------GTGCTGCTTCTAGTGGCCTTCCTTCTTTCTGGGGTC
Callithrix_jacchus|45121       ATGGCTGGGCAGCGC---------GTGCTGCTTCTAGTGGGGTTCCTTCTCCCTGGGGTC
Rhesus_macaque|31909           ATGGCTGGGCAGCGG---------GTGCTGCTTCTAGTGGGCTTCCTTCTCTCTGGGGTC
Gorilla_gorilla|249            ATGGCTGGGCAGCGA---------GTGCTTCTTCTAGTGGGCTTCCTTCTCCCTGGGGTC
Homo_sapiens|68743             ATGGCTGGGCAGCGA---------GTGCTTCTTCTAGTGGGCTTCCTTCTCCCTGGGGTC
Pan_troglodytes|29694          ATGGCTGGGCAGCGA---------GTGCTTCTTCTAGTGGGCTTCCTTCTCCCTGGGGTC
Loxodonta_africana|24713       ATGGCTGCGCCGCAG---------GCACTGTTTCTCCTCTGCTTCTTTCTGCCTGGGGCC
Oryctolagus_cuniculus|2791     ATGGATGGGCAGCGG---------GCGCTGCTTCTAGGGGGCTTCCTTCTCTCCGGGACC
Ochotona_princeps|6294         AAGGCTGGGCACAGG---------ATGCTGCTTCTGGGGTGCTTCCTTCTCTCTGGGGCC
Tursiops_truncatus|8861        ATGGCGGGGCAGCAG---------GCGCTGCTTCTAGTCGGATTCCTACTGCCTAGCCTC
Bos_taurus|12729               ATGGCAGGGCAGCAG---------GCACTGCTTCTATTTGGATTTATACTGCCTGGGCTC
Equus_caballus|14193           ------------------------------------------------------------
Equus_caballus|14192           ATGATGAGGCCACGG---------GTGCTGCTTCTCATCTGCTTCCTCCTACCTGGGCTC
Equus_caballus|14190           ATGGGGAGCCTGCGG---------GCGCTGCTTCTCATCTCCTCCCTTCTGCCTGGGCTC
Canis_familiaris|22019         ATGGCCAGACAGTGG---------GCGCTGCTGCTAGCCTGCCTCCTCCTGTCTGGGTTC
Canis_familiaris|22015         ACCATGGCCGGGCGC---------GCGCTGCTGCTCGGCGGCCTCCTTCTGCCGGGGGTC
Caenorhabditis_elegans|25270   ATGAGGTTAGGAACA---------TTTATTTTTCTTTTAACTTTCCTGTTT------TTT
Caenorhabditis_elegans|14340   ATGCGGGTC---------------TTGGTATTTCTCCTCCTGTTCGTACTACCAGCAGCT
                                                                                           

Bombyx_mori|13385              ------------------------------------------------------------
Bombyx_mori|12014              ------------------AAAGTTGCTATTGAAGAAATCTTTTCAAATCCAAGATATAAG
Gasterosteus_aculeatus|19940   GCAGTGCTTGAGTCTGCCAAGATCCTGACTGTCAGTCTGATTGGAGGAAGCCACTACTTG
Fugu_rubripes|4293             CCACTGCTTCAGTCTGCCAAAATCCTGACCGTCTGTCTAATTGGAGGAAGCCATTACCTA
Xenopus_tropicalis|2247        GTCCTGCTTCAAGGAGCCAAAATCTTGACAGTAAACTTTTTTGGTAAAAGCCATTATCTC
Xenopus_tropicalis|2244        ------------------------------------------------------------
Xenopus_tropicalis|1478        ------------------------------------------------------------
Xenopus_tropicalis|1473        ------------------------AAACTTCTTATGTTTGTAGGTGGGAGTCATTACCTG
Dipodomys_ordii|7215           CTGTTCTCAGAATCTGCTAAAATTCTGACAATGTCTGTGTTGGNNNNNNNNNNNNNNNNN
Anolis_carolinensis|9649       ------------------------------------------------------------
Ornithorhynchus_anatinus|12628 ------------------------------------------------------------
Echinops_telfairi|13652        CTGCTCTCGGAGGCCGCCCAAATCCTGACCTTGTCTTTACTGGGGGGTAGCCATTATCTA
Tupaia_belangeri|13132         CAGTTCTCAGAGACCGCCAAAATCCTCACTTTAGTCACAGTTGGTGGGAGCCATTACCTA
Felis_catus|38352              CTGCTCTCTGAGGCCGCCAAGATCCTAACCCTGTCTTTGGTGGGTGGGAGCCATCATCTG
Bos_taurus|12730               ------------------------------------------------------------
Tarsius_syrichta|7332          CTGCTCTTAGAGGCCACCAAAATCCTGACAATCTCTTCTGCGGGTGGAAGCCATTATCTT
Dasypus_novemcinctus|14729     ---------------------------------------------GGAAGCCATTATCTA
Choloepus_hoffmanni|10632      CTGCTCTCAGAGTTCCCCCAAATCCTGTTCTGGGTGGNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|13539             CTTCTCTTGGAGGCTGCAAAAATCCTGACTATATCTACACTGAGTGCCAGTCATTATATA
Rattus_norvegicus|18092        ------------------------------------------------------------
Pteropus_vampyrus|14496        CTGCTCTCAGAGGCAGCCAAAATCTTTACTATGACCTTGCTTGGTGGAAGCCATTACCTA
Otolemur_garnettii|7502        CTGCTCTCAGAGGCTGCCAAAATCCTGACAGTATCTACAATGGGTGGAAGCCATTATCTG
Microcebus_murinus|7068        ------------------------------------------------------------
Microcebus_murinus|19157       CTGCTTTCAGAGGCTGCGGAAATCCTGACAATGTCTACACTGGGTGGAAGCCATTATCTG
Tarsius_syrichta|4797          CTGCTCTCAGAGGCCGCCAAAATCCTGACAATCTCTACAGTGGGTGGAAGTCATTATCTA
Rhesus_macaque|31907           CTGCTCTCAGAGGCTGCCAAAATCCTGACAATATCTACACTGGGTGGAAGCCATTACCTA
Homo_sapiens|68741             CTGCTCTCAGAGGCTGCCAAAATCCTGACAATATCTACACTGGGTGGAAGCCATTACCTA
Gorilla_gorilla|244            CTGCTCTCAGAGGCTGCCAAAATCCTGACAATATCTACACTGGGTGGAAGCCATTACCTA
Pongo_abelii|21971             CTGCTCTCAGAGGCTGCCAAAATCCTGACAATATCTACACTGGGTGGAAGCCATTACCTA
Pan_troglodytes|29695          CTGCTCTCAGAGGCTGCCAAAATCCTGACAATATCTACACTGGGTGGAAGCCATTACCTA
Callithrix_jacchus|45121       CTGCTCTCAGAGGCCGCCAAAATCCTGACAATATCTACAGTA------------------
Rhesus_macaque|31909           TTGCTCTCAGAGGCTGCCAAAATCCTGACAGTATCTACAGTAGGTGGAAGCCATTATCTA
Gorilla_gorilla|249            CTGCTCTCAGAGGCTGCCAAAATCCTGACAATATCTACAGTAGGTGGAAGCCATTATCTA
Homo_sapiens|68743             CTGCTCTCAGAGGCTGCCAAAATCCTGACAATATCTACAGTAGGTGGAAGCCATTATCTA
Pan_troglodytes|29694          CTGCTCTCAGAGGCTGCCAAAATCCTGACAATATCTACAGTAGGTGGAAGCCATTATCTA
Loxodonta_africana|24713       CTGCTCTCAGAGGCCGCCAAAATCCTGACTGTGTCCCTGATTGGTGGAAGCCATTATCTA
Oryctolagus_cuniculus|2791     CTGCTCTCAGAGGCCGCCAAAATCCTAACTGTGTCAACACTGGGTGGAAGCCATTACCTA
Ochotona_princeps|6294         CTGTTCTCAGACGCCGCCAAAATCCTGACCGTGGCCACTCTGGGTGGAAGCCATTACCTC
Tursiops_truncatus|8861        CTCCTCTCAGAGGCTGCCAAAATCCTAACTCTGTCCCTGGTGGGTGGAAGCCATTTTCTA
Bos_taurus|12729               CTGTTTTCAGAGGCTGCCAAAATCCTAACTGTGTCCCTGGTGGGTGGAAGCCATTTTCTA
Equus_caballus|14193           ------------------------------------------------------------
Equus_caballus|14192           CTGCCCTCAGAGGCTGCCAAAATACTGACTGTGTCCTTGGTGGGTGGAAGCCATCATCTA
Equus_caballus|14190           CTGCTCTCAGAGGCCGCCAAAATCCTGACTCTGTCCTTGCTGGGTGGAAGCCATTTTCTA
Canis_familiaris|22019         CTGCTCTCAGAGGCCGCCAAAATCCTGACTGTATCCTCACTGGGTGGAAGCCATTATTTA
Canis_familiaris|22015         CTGCTTTCCGAGGCCGCCAGGATCCTGACCGTGTCTTTGGTGGGTGGAAGCCATCATCTA
Caenorhabditis_elegans|25270   GAGTGTTATTCATCTAAAATTTTGATTTTCAATCCAATTTTTGGATTTAGCCATGTCAAA
Caenorhabditis_elegans|14340   TCATGTTACAAAATC------CTAGTGAGCGTCCCGAAATTCGGGTTCAGTCACATGCAG
                                                                                           

Bombyx_mori|13385              ------------------------------------------------------------
Bombyx_mori|12014              GAGATAGCAAAGGAAACATCGTTGATATATCAC---------------------------
Gasterosteus_aculeatus|19940   TTGTTAGATGAGATTTCTAACAATCTACACCAGCGCGGCCATGAGGTCCGCATGCTTCTG
Fugu_rubripes|4293             TTACTCGATGAAATATCTCAAAACCTACACCAGCATGGCCATGATGTTCGCATGCTCTTA
Xenopus_tropicalis|2247        TGGATGGACGGAATCTCTCGTATTCTACACAACCACGGCAATGAAGTAACAATGTTCCGG
Xenopus_tropicalis|2244        ------------------------------------------------------------
Xenopus_tropicalis|1478        ------------------------------------------------------------
Xenopus_tropicalis|1473        TGGATGGATGAGATCTCCCGGATTCTGCACAACCACGGCCACCAAATAACAATGTTCCTT
Dipodomys_ordii|7215           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Anolis_carolinensis|9649       ------------------------------------------------------------
Ornithorhynchus_anatinus|12628 ------------------------------------------------------------
Echinops_telfairi|13652        CTGATGGATCAAGTGTCTCAAATTCTTCAAGATCATGGTCATAATGTGACCATGTTGCAA
Tupaia_belangeri|13132         CTGATGGACCGGGTATCTCAGATTCTTCAAGATCATGGTCATAATGTCTCCATGCTTCTC
Felis_catus|38352              CTGCTGGACCGGGTGTCTCAGATTCTTCAAGATCATGGTCATAATGTCACCATGCTTCAC
Bos_taurus|12730               ------------------------------------------------------------
Tarsius_syrichta|7332          CTAATGGACCGGGTGTCTCAGATTCTTCAAGAGCATAGCCATCGGGTGACCATGCTTCTT
Dasypus_novemcinctus|14729     CTGATGGACCGGATATCTCAGATTCTTCAAGATTATGGTCATGATGTGACTATGCTTAAA
Choloepus_hoffmanni|10632      NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|13539             CTGATGAACCGTGTGTCGCAAATTCTGCAAGGTGGTGGCCACGATGTAATCAAACTTCTT
Rattus_norvegicus|18092        ------------------------------------------------------------
Pteropus_vampyrus|14496        CTGATGAGCCAGGTGTCTCAGGTTCTCCAAGATCACGGTCATAACGTCACCATGTTTCAC
Otolemur_garnettii|7502        CTGATGGACCGGGTGTCTCAGATTCTGCAAGATCATGGTCACAATGTCACCATGCTTAAC
Microcebus_murinus|7068        ------------------------------------------------------------
Microcebus_murinus|19157       CTGATGGGCCGGGTCGCTGAGATTCTTCAAGATCATGGTCATCATGTCACCATGCTTCGT
Tarsius_syrichta|4797          CTGATGGACCGGGTGTCACAGATTCTTCAAGATCACGGTCATAATGTCACCATGCTTAAC
Rhesus_macaque|31907           CTGTTGAACCGGGTGTCTCAGATTCTTCAAGAGCATGGTCATAATGTGACTATGCTTCCT
Homo_sapiens|68741             CTGTTGGACCGGGTGTCTCAGATTCTTCAAGAGCATGGTCATAATGTGACTATGCTTCAT
Gorilla_gorilla|244            CTGTTGGACCGGGTGTCTCAGATTCTTCAAGAGCATGGTCATAATGTGACTATGCTTCAT
Pongo_abelii|21971             CTGTTGGACCGGGTGTCTCAGATTCTTCAAGAGCATGGTCATAATGTGACTATGCTTCAT
Pan_troglodytes|29695          CTGTTGGACCGGGTGTCTCAGATTCTTCAAGAGCATGGTCATAATGTGACTATGCTTCAT
Callithrix_jacchus|45121       ------------------------------------------------------------
Rhesus_macaque|31909           CTGATGGACCGGGTTTCTCAGATTCTTCAAGATCACGGCCATAATATCACCATGCTTAAC
Gorilla_gorilla|249            CTGATGGACCGGGTTTCTCAGATTCTTCAAGATCACGGTCATAATGTCACCATGCTTAAC
Homo_sapiens|68743             CTGATGGACCGGGTTTCTCAGATTCTTCAAGATCACGGTCATAATGTCACCATGCTTAAC
Pan_troglodytes|29694          CTGATGGACCGGGTTTCTCAGATTCTTCAAGATCACGGTCATAATGTCACCATGCTTAAC
Loxodonta_africana|24713       CTGATGGACCAGGTGTCTCAGATTCTACAGGATCATGGTCATAATGTGACCTTATTTCAA
Oryctolagus_cuniculus|2791     CTGGTGGACCGGGTGTCCCAGATTCTTCAAGATCATGGTCATAATGTCACCATGCTTCAT
Ochotona_princeps|6294         CTGGTGGCCCGGGTGTCCCAGATTCTCCAAGATCATGGCCATAATGTCACCATGCTTCAT
Tursiops_truncatus|8861        CTGGTGAATCAGGTCTCTCAGATTCTTCAAGATCATGGTTGTAATGTCACCATGCTTCTC
Bos_taurus|12729               CTGATGCATCAGATCTCTCAGATTCTTCAAGATCATGGTCATAATGTCACCATGCTTCTC
Equus_caballus|14193           ------------------------------------------------------------
Equus_caballus|14192           CTAATGGACCGAGTGTCTCAGATTCTTCAAGATCATGGTCATAATGTCACTGTGCTTCTC
Equus_caballus|14190           CTAATGGACCGAGTGTCTCAGATTCTTCAAGATCACGGTCATAATGTCACCATGCTTCTC
Canis_familiaris|22019         CTGCTGGACCGGGTATCTCAGATTCTTCAAGATCATGGACATAATGTCACCATGCTTCTT
Canis_familiaris|22015         CTGATGGACCAGGTGTCTCAGATTCTTCAAGATCATCATCATAATGTCATCATGCTTCAC
Caenorhabditis_elegans|25270   TTTATTAGCAAAATGGCGGATATTATCGCGGATCATGGTCATCATGTGACTTTATTCCAA
Caenorhabditis_elegans|14340   ACAATGGGCAAGCTGGCAGATATTCTCGTGGAGGCCGGGCATGATGTGACATTCCTAATG
                                                                                           

Bombyx_mori|13385              ------------------------------------------------------------
Bombyx_mori|12014              ---------------------------------GATCGGCCAGTGTCTCCTGGTGCTGAA
Gasterosteus_aculeatus|19940   CAACTGGGAAACCCTGTTATTACAGGGTTTTCCTATGCAGGCCGCGCAGACAGTTACCAG
Fugu_rubripes|4293             CAACTGGGCAATCCTGTGATCACGGGTTTTTCCTATGTGGGCGGTGCAGACAGTTACCAG
Xenopus_tropicalis|2247        CAGATTGCAGATGGATTGCTACCAGAT------TACCAGATGCAGGAGAGCCCTTACAGA
Xenopus_tropicalis|2244        ------------------------------------------------------------
Xenopus_tropicalis|1478        ------------------------------------------------------------
Xenopus_tropicalis|1473        CAGATTGGAGATGGAATGCTACCAGGC------AAGTGTATTTTAAAGGGATTCTGTCAT
Dipodomys_ordii|7215           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNN
Anolis_carolinensis|9649       ------------------------------------------------------------
Ornithorhynchus_anatinus|12628 ---------------------------------------AAGAGGTCCGGAACGTACCAA
Echinops_telfairi|13652        CAAGATGGAATTTCTTTGATTTCAGNN------NNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|13132         AGAAGAGGAAATTCTTTGATATCAGAT------TTCAAAGAGGGGCAGAAATCATATGAA
Felis_catus|38352              CAGAGAGGGAATTCATTCATATCAGAT------TTTAAAGAGAAGGAGATATCATACCAA
Bos_taurus|12730               ---------------------------------TTAGAAAAGGAGGAACACTCATTCCAG
Tarsius_syrichta|7332          CACGATGGACTTGTGTTAACTTNN---------NNNNNNNNNNNNNNNNNNNNNNNNNNN
Dasypus_novemcinctus|14729     CAGGACGCACTTTTGATGTCA------------GNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|10632      NNNNNNNNNNNNNNNNNNNAC------------TTCAAAGAGGAGGAAAAATCATACCAA
Mus_musculus|13539             TATGAAGGTGGTGATATCCCAGAT---------TTTAGAAAGGAAAACTCATCATACCAG
Rattus_norvegicus|18092        ------------------------------------------------------------
Pteropus_vampyrus|14496        CTGAAAGAAGGTTTATTGATGTCAGGT------TTTAAAGAGGTGGAAAAATCATACAAA
Otolemur_garnettii|7502        AAGAGAGGAAATTCTTTGATGTCAGAT------TTTAAAGAGGAGGAA---TCATATCAA
Microcebus_murinus|7068        ------------------------------------------------------------
Microcebus_murinus|19157       CAGGGAGGAAATTCTTTAATATCAGAT------TTTAAAGAGGAAGAAAAATCATACCAA
Tarsius_syrichta|4797          CAGGAGGGAAATTCTTTGATGACAGAT------TTTAAAAAGGAGGAAAAATCATACCAA
Rhesus_macaque|31907           CAGAGTGGAAACCTTTTAATCCCAGAT------ATTAAAGAGGAGGAAAAATCATACCAA
Homo_sapiens|68741             CAGAGTGGAAAGTTTTTGATCCCAGAT------ATTAAAGAGGAGGAAAAATCATACCAA
Gorilla_gorilla|244            CAGAGTGGAAAGTTTTTAATCCCAGAT------ATTAAAGAGGAGGAAAAATCATACCAA
Pongo_abelii|21971             CAGAGTGGAAAGTTTTTAATCCCAGAT------ATTAAAGAGGAGGAAAAATCATACCAA
Pan_troglodytes|29695          CAGAGTGGAAAGTTTTTGATCCCAGAT------ATTAAAGAAGAGGAAAAATCATACCAA
Callithrix_jacchus|45121       ------------------------GAT------TTTAAAAAGGAGGAAAAATCTTACCAA
Rhesus_macaque|31909           CACAAAAGAGGTCCTTTTATGCCAGAT------TTTAAAAAGGAGGAAAAATCGTATCAA
Gorilla_gorilla|249            TACAAAAGAGGTCCTTTTATGCCAGAT------TTTAAAAAGGAAGAAAAATCATATCAA
Homo_sapiens|68743             CACAAAAGAGGTCCTTTTATGCCAGAT------TTTAAAAAGGAAGAAAAATCATATCAA
Pan_troglodytes|29694          CACAAAAGAGGTCCTTTTATGCCAGAT------TTTAAAAAGGAAGAAAAATCATATCAA
Loxodonta_africana|24713       CAGGAAGGACTTTCTTTGTTGTCAGAT------TTTAAAGAGGAAAAAAAGACATACCAA
Oryctolagus_cuniculus|2791     CAGCGAGGAAATTCTCTGATGTCAGAT------TTTAAAGAGGAGCCCAAATCATACCAA
Ochotona_princeps|6294         CAGGGAGGAAACTCTTTGATGGCAGGT------TTTAAGGAAGAGGAAAAATCATANNNN
Tursiops_truncatus|8861        CAGAGAGGAAATTTATTGCCACCAGGT------TTTACAGAGGAGGAGAAATCATACAAA
Bos_taurus|12729               CAAAAGGGAAATTTATTGCTACCAGGT------TTTAAAGAGGAGGAGAAATCATACAAA
Equus_caballus|14193           ------------------------------------AAAGAGGAAGAAAAATCATATCAA
Equus_caballus|14192           CAGGAAGGAAATGTATTGATACCAGGT------TTTAAAGAGGAGGAAAAATCATACCAA
Equus_caballus|14190           CAGAGAGCAAATTTATTAATACCAGGT------TTTAAAGAGGAGGAAAAATCATATCAA
Canis_familiaris|22019         TATGGAGGAGATTATTTAATCCCAAaCATT---TTAGAAGAGAAGGAAAGTGTATACCAC
Canis_familiaris|22015         CAGAAAGGAAATTCATTGATAACAGAT------TTTACAGAGAAGGAAACATCATACCAA
Caenorhabditis_elegans|25270   CCATATCATATTGCTCTGAAAAACCTG------GATGGGTTGGTTAAAAACAAAAATATA
Caenorhabditis_elegans|14340   CCAGTCGACGTGCCA------------------ATCCCTCAAAATGGAACTGAACTTGCC
                                                                                           

Bombyx_mori|13385              ------------------------------------------------------------
Bombyx_mori|12014              CTGGTCCACTGGGTGGAGCACGTC---------------GTCAAGACTAGG---------
Gasterosteus_aculeatus|19940   ATGACCACCTGGTCCATGGGAGAGGATTACGTCACAGAGTACAACGGCTGG---------
Fugu_rubripes|4293             AAGAGCGCCTGGTCGTTAGGGGATAAATACATTAAGGAATACAATGACTGG---------
Xenopus_tropicalis|2247        CTGGTCACCTGGTCCCTGGATGAAAATTATCTTAAAGAATATGGTGAATTT---------
Xenopus_tropicalis|2244        ------------------------------------------------------------
Xenopus_tropicalis|1478        ------------------------------------------------------------
Xenopus_tropicalis|1473        GATTTTTATGctgagctttcagaaggagccagcgctacacatAAAGAAAGA---------
Dipodomys_ordii|7215           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------
Anolis_carolinensis|9649       ------------------------------------------------------------
Ornithorhynchus_anatinus|12628 ATTACAACTTGGTCTTCCAGTGAGGACTATAAAAGAAAGTACTTAAAAGAT---------
Echinops_telfairi|13652        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAGATTTATGAATTAT---------
Tupaia_belangeri|13132         GTTATCAGTTGGTTTCCACCTGAAGATAATCAAAAAGAATTTAACAAATGT---------
Felis_catus|38352              GTTATCCCTTGGCTTCCACCTGAAGACTGTAACAAAGGATTGAAGAATAAT---------
Bos_taurus|12730               GTTATCAGTTGGCATTCACCTGGAGATCTTGAAAATGAAATAAGGAAACGT---------
Tarsius_syrichta|7332          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------
Dasypus_novemcinctus|14729     NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------
Choloepus_hoffmanni|10632      ATGATCACTTGGCATCCACCTGAATATTATAGAAAAGAATTTATGAAGCAT---------
Mus_musculus|13539             GTTATTAATTGGCGTCTACCTGAAGATCAGCAAAAGACATTTGAAAATAGA---------
Rattus_norvegicus|18092        ------------------------------------------------------------
Pteropus_vampyrus|14496        GTTATTACTTGGCTTGCACCTGAAGATTGTAACAGAGAACTTAAGAAGAGT---------
Otolemur_garnettii|7502        GTTATCAGTTGGCTTGCACCTGGAGCTCATCAAAGAGAAATT------------------
Microcebus_murinus|7068        ------------------------------------------------------------
Microcebus_murinus|19157       GTTATTAGTTGGTTTCCACCTGAAGACTATCAAAAGGAATTTGAAAAGGTT---------
Tarsius_syrichta|4797          GTTATCAGTTGGCTTCCACCTAAAGATCATCAAAAAAAGTTTAATAAGTAT---------
Rhesus_macaque|31907           GTTATCAGGTGGTTTTTACCTGAAGATAATCAAAAAAGAATTACGAAGCAT---------
Homo_sapiens|68741             GTTATCAGGTGGTTTTCACCTGAAGATCATCAAAAAAGAATTAAGAAGCAT---------
Gorilla_gorilla|244            GTTATCAGGTGGTTTTCACCTGAAGATTATCAAAAAAGAATTAAGAAGCAT---------
Pongo_abelii|21971             GTTATCAGGTGGTTTTCACCTGAAGATTATCAAAAAAGAATTAAGAAGCAT---------
Pan_troglodytes|29695          GTTATCAGGTGGTTTTCACCTGAAGATTATCAAAAAAGAATTAAGAAGCAT---------
Callithrix_jacchus|45121       GTTATCAGTTGGCTTGCACCCGAAGATCATCAAAGAGAATTTAAGAAGAGT---------
Rhesus_macaque|31909           GTTATCAGTTGGCTTGCACCTGAAGATCATCAAAGAGAATTTAAGAAGAGT---------
Gorilla_gorilla|249            GTTATCAGTTGGCTTGCACCTGAAGATCATCAAAGAGAATTTAAGAAGAGT---------
Homo_sapiens|68743             GTTATCAGTTGGCTTGCACCTGAAGATCATCAAAGAGAATTTAAAAAGAGT---------
Pan_troglodytes|29694          GTTATCAGTTGGCTTGCACCTGAAGATCATCAAAGAGAATTTAAAAAGAGT---------
Loxodonta_africana|24713       ATCATCAAATGGCTTCCGCCTGAAGATTATAAAAAAGAATTTATGAAGTAT---------
Oryctolagus_cuniculus|2791     GTTATTACTTGGCTTCCACCCCAAGACCATCGAAAAGAATTTAAGAAGTGC---------
Ochotona_princeps|6294         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---------
Tursiops_truncatus|8861        GTTATTAACTGGTTTCTACCTGAAGACGATAACAAAGAATTTAAGAAGTCT---------
Bos_taurus|12729               GTTTTTAACTGGTTTCTGCCTGAAGACTGTAATGAAGAATTTAAGAGGTCT---------
Equus_caballus|14193           GCTATCACTTGGCTTCCACCTGAAGATTATAACAAAGAATTTAAGAAATAT---------
Equus_caballus|14192           ATTGTCACTTGGTTTCCACCTGAAGATGATTTCAAAGAATTTTTGAAGTTT---------
Equus_caballus|14190           GTTATCACTTGGCTTCCACCTGAAGATTATAACAAAGAATTTATGAATTTT---------
Canis_familiaris|22019         GTTATCAGTTGGCTTCTATCTGAGGAACATGAAAAAGAATTAAAGAAATAT---------
Canis_familiaris|22015         GTTATTCCTTGGTTTCCACCTGAAGATTACAACAAAAGATTGAAGGAGTAT---------
Caenorhabditis_elegans|25270   GAAATTTTAAACTACCACCCCACTCACTACGAAGAGTTGCTGAAGGCTGAACCACAAACT
Caenorhabditis_elegans|14340   AAGGTGGTCCTGGTGCCGACTACCGACGCTATTAATGAGATTATGGGACATGCTATGAAA
                                                                                           

Bombyx_mori|13385              ---------------------------------------------ATGAACCACATATTT
Bombyx_mori|12014              GGAGCTCTCCATCTGCGCTCACCAGCACTGCAAATGCCCTTGTACCAGAAGTTATACTTA
Gasterosteus_aculeatus|19940   TTCATGGAGCAACAAACACAGTTTTTGCTGGGA---AGGGACAACTTTACCACCTTCCTA
Fugu_rubripes|4293             TTTCTGGAGCAACAAACACAGTTTCTACTGGGA---AGAGAAACCTTCAATAATTTTCTC
Xenopus_tropicalis|2247        ------TTCAGAAACAGCAAATACAACTTAAAGGGCAGTGATGAAGTTTCTTCTCATTTG
Xenopus_tropicalis|2244        ------------------------------------------------------------
Xenopus_tropicalis|1478        ------------------------------------------------------------
Xenopus_tropicalis|1473        AAAAACTTCTTATATTGGGGATGGAATGCTACC---AGGGCAAACAGTTATGTGCTGCTG
Dipodomys_ordii|7215           NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Anolis_carolinensis|9649       ------------------------------------------------GAGGCTTACCTT
Ornithorhynchus_anatinus|12628 TTTGAGGACTACCAAGAAGATTTTCTGCAGGGC---AGAAATTACTTTAGCCGTTTTTTG
Echinops_telfairi|13652        TTCAATTTCTTTGTCGAAGAAGCTTTCAATGGC---AGNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|13132         TTTGATTTCTTTATGGAAGAAGCTTTGAATGGC---AGNNNNNNNNNNNNNNNNNNNNNN
Felis_catus|38352              TTTGATTTTTTTATTGAAGAAGCTTTGGGTGGC---AGNNNNNNNNNNNNNNNNNNNNNN
Bos_taurus|12730               CTGGATTTGTTTGTGACAGAAGCTTTGCACAAC---AGAAAAAAATCTGAACACTTTGTA
Tarsius_syrichta|7332          NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNAGAAACATTTGAAAACCTTTTA
Dasypus_novemcinctus|14729     NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTAACATTTGAACATTTTTTA
Choloepus_hoffmanni|10632      TTAAATTTATTTTTGGAAGAAGCTTTGCATAGC---AGATTAACATTTGAAGACTTTTTA
Mus_musculus|13539             TGGCATCGACTTATAGACGAATATGCTTATGGG---AGGTCCAAATATCACACCCTACTA
Rattus_norvegicus|18092        ------------------------------------AGGTTCGAGCATCACACCATTGTA
Pteropus_vampyrus|14496        GTTGAATTTATTATAGGAGAAGGTTTGGAAGGC---AGAGGCAGGTTTGAGAACATGTTC
Otolemur_garnettii|7502        TTAGAGTTTCATTTCTTAGAAGCTTTCAATGGC---AGAGGAATATTTGAAAACTTATTG
Microcebus_murinus|7068        ---------------------------------------GGAAAATTTTCAAAACTATTA
Microcebus_murinus|19157       TCAAGTTTGTTTGTGGAAGAAGGTTACAATGAA---AGGGAAACATTTCAAACCTTTTTA
Tarsius_syrichta|4797          TTTGATTTCTTTATGGAAGAAGCTTTGCATGGC---AGAGGAATATCTGAAAACTTTTTA
Rhesus_macaque|31907           TTCAATAGCTACATAGAAACAGCATTGGATGGC---AGAGACGAATTTGAATGCCTTCTA
Homo_sapiens|68741             TTTGATAGCTACATAGAAACAGCATTGGATGGC---AGAAAAGAATCTGAAGCCCTTGTA
Gorilla_gorilla|244            TTTGATAGCTACATAGAAACAGCATTGGATGGCAGCAGAAAAGAATTTGAAGCCCTTGTA
Pongo_abelii|21971             TTCGATAGTTACATAGAAACAGCATTGGATGGC---AGAAAAGAATTTGAAGTCTTTGTA
Pan_troglodytes|29695          TTTGATAGCTACATAGAAACAGCATTGGATGGC---AGAAAAGAATTTGAAGTCTTTGTA
Callithrix_jacchus|45121       TTCAATTTCTTTCTGGAAGAAACTTTATCTGGA---AGAGAAAAATTTGAAAACTTATTA
Rhesus_macaque|31909           TTTGATTTCTTTCTGGAAGAAACTTTAGGTGGC---AGAGGAAATTTTGAAAACTTATTA
Gorilla_gorilla|249            TTTGATTTCTTTCTGGAAGAAACTTTAGGTGGC---AGAGGAAAATTTGAAAACTTATTA
Homo_sapiens|68743             TTTGATTTCTTTCTGGAAGAAACTTTAGGTGGC---AGAGGAAAATTTGAAAACTTATTA
Pan_troglodytes|29694          TTTGATTTCTTTCTGGAAGAAACTTTAGGTGGC---AGAGGAAAATTTGAAAACTTATTA
Loxodonta_africana|24713       TTTGATTTCTTTATTGAAGAATCTTTTCATGGC---AGGGGAACATTTGAAAAATATTTA
Oryctolagus_cuniculus|2791     TTTGATTTCTTTATGGAAGAAGCCCTGCATGGC---AGAGGAAGTTTTGAAAACTTTTTA
Ochotona_princeps|6294         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNAGGAACTTTCGAAAACTTGCTA
Tursiops_truncatus|8861        TTTCATTTCTTTATGGAAGAAACTTTTGAGGGC---AGAAGCACATTTGAACACGTTTTA
Bos_taurus|12729               TTTCATTCCTTTATGGAGAAAACTTTTGGGGGC---AGATGCAAATTTGAACACTTTTTA
Equus_caballus|14193           TTTGATTTCTTTCTGAAAGAAGCTTTGGCTGGC---AGAGACACATTTGAAAACTTTTTA
Equus_caballus|14192           TGTGAGTTCTTTATGGAAGAAGCTTTGGCTGGC---AGAGACAAATTTGAAAACTTTTTA
Equus_caballus|14190           TTTGATTCCTTTATGAAAGACGCTTTGGATGGG---AGAGACTCATTTGCAGACTTTTTA
Canis_familiaris|22019         TTTGATTTCTTTATGCAAGAAGCTTTGCAGGGCAGCAGAGAAGCATTTGACAACCTTGTA
Canis_familiaris|22015         GTAGATTATTTTATAGAAGAAGCTTTGAATGGC---AGACACACATTTGGAAAATTTTTA
Caenorhabditis_elegans|25270   TTTTCATTCTTTTGGGACTCTTATTTGGTTGGA---AATCCAGTTATTGGAGCATTTCTG
Caenorhabditis_elegans|14340   AGCGGTGCTGTCGCGAATTTGTGGACTCACTCGGCAAACTCAAAGCAAGGAATTATGTGG
                                                                                           

Bombyx_mori|13385              GAT---------CTACAAAATATTACTATCGCAAACGCTTTGATGACATTCGAAAACGAA
Bombyx_mori|12014              GAT---------CTCCTCACTGTTGTTTTAGTATTATTGATTGTGATCTATAAAATTGTA
Gasterosteus_aculeatus|19940   AAC---------TTCATGGGGCACCTGTCCTATCAGTGTGACCGGCTGCTAGGGGACCAA
Fugu_rubripes|4293             AAG---------TTCATGGGACACCTGTCTCACCAGTGTGACAAGCTGTTAGAAAACAAA
Xenopus_tropicalis|2247        GGT---------CTCTTTACCCATCTGTCACGCCAGTGCAAGATGATATTTAACCAGACG
Xenopus_tropicalis|2244        ---------------------CATCTGTCACGCCAGTGCAAGATGATATTTAACCAGACG
Xenopus_tropicalis|1478        ------------------------------------TGCAAGATGATATTTAACCAGACA
Xenopus_tropicalis|1473        GCT---------TTCGTGGGCCAAATGTCACGCCAGTGCAAGATGATATTTAACCAGACG
Dipodomys_ordii|7215           NNN---------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Anolis_carolinensis|9649       GAC---------CTGATGGGCCACCTGGCATCCCAGTGCAATTTCGTCCTGAACTCATCA
Ornithorhynchus_anatinus|12628 GAG---------TTTATGGGGCATCTTGCCACCCAGTGCAGTTTCATCTTAAACAACTCG
Echinops_telfairi|13652        NNN---------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|13132         NNN---------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Felis_catus|38352              NNN---------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Bos_taurus|12730               AAT---------TTAATGGAAACACTTGGGACTCGATGCAGTTATCTGCTAAGGAGACGT
Tarsius_syrichta|7332          AAG---------TTAATGGAACGCTTCGGGACTCGATGTGGGCATTTTCTAAGCAGAAAA
Dasypus_novemcinctus|14729     AAG---------TTTATGGGACAATTAGGGACTCAGTGCAATCATTTCCTGAGGAGGAAG
Choloepus_hoffmanni|10632      AAT---------TTTATGGGACAACTTGGGAGTCAGTGCAATGTTTTTCTAAGGAGGAAG
Mus_musculus|13539             AAG---------ATTCATCAATACTTTGCGGACTTATGCAGTCACTTATTAAGCAGAAAG
Rattus_norvegicus|18092        AAG---------ATTCATCGGCACTTTGGGGACTTGTGCAATCACTTATTAAGCAGAAAG
Pteropus_vampyrus|14496        GAA---------TATTTGAAATCATTGGCCCTTCAGTGCAAACATTTGCTA---AGAAGC
Otolemur_garnettii|7502        AAG---------GTGAAGGAACAACTGGGGTTTCAGTGCAGTCATTTGCTAAGCAGAAGG
Microcebus_murinus|7068        AAG---------CTTGTGGAACAACTGGGATTTCAGTGCAGTCATTTGCTAAACAGAAGG
Microcebus_murinus|19157       AAG---------ATAATGGAAGAACTGGGATTTCAGTGCAGTCATTTGTTAAGCAAAACG
Tarsius_syrichta|4797          AAA---------TTTGTGGAACAAATGGGGTTTCAGTGCAGTCATTTGCTAAGGAGAAGG
Rhesus_macaque|31907           AAG---------TTAATGGAAATATTTGGGATTCAATGTAGTTATTTGCTAAGCAGAAAG
Homo_sapiens|68741             AAG---------CTAATGGAAATATTTGGGACTCAATGTAGTTATTTGCTAAGCAGAAAG
Gorilla_gorilla|244            AAG---------CTAATGGAAATATTTGGGACTCAATGTAGTTATTTGCTAAGCAGAAAG
Pongo_abelii|21971             AAG---------CTAATGGAAATATTTGGGACTCAATGTAGTTATTTGCTAAGCAGAAAG
Pan_troglodytes|29695          AAG---------CTAATGGAAATATTTGGGACTCAATGTAGTTATTTGCTAAGCAGAAAG
Callithrix_jacchus|45121       AAC---------ATTCTAGAATACTTGGCGTTGCAGTGCAGTCATTTTTTAAGGAGAAAG
Rhesus_macaque|31909           AAA---------GTTCTAGAATACTTGGCGTTGCAGTGCCATCATTTTTTAAGGAGAAAG
Gorilla_gorilla|249            AAT---------GTTCTAGAATACTTGGCGTTGCAGTGCAGTCATTTTTTAAGTAGAAAG
Homo_sapiens|68743             AAT---------GTTCTAGAATACTTGGCGTTGCAGTGCAGTCATTTTTTAAATAGAAAG
Pan_troglodytes|29694          AAT---------GTTCTAGAATACTTGGCGTTGCAGTGCAGTCATTTTTTAAATAGAAAG
Loxodonta_africana|24713       AAG---------TTAATGGAACAACTTGGGATTCATTGCAGTCATTTGCTAAGAAGAAGG
Oryctolagus_cuniculus|2791     AAA---------GTAATGGAACAGCTGGGGTTTCAGTGCAGTCACTTGCTAAGGAGGAGG
Ochotona_princeps|6294         AAG---------TTAATGGAACAACTGGGGTTTCAGTGCAGTCATTTGCTTAGGAGAAGG
Tursiops_truncatus|8861        GCT---------ATTTTGGAGCAACTAGGGCTTCCGTGCAGTCATTTGCTAAGGAGAAAT
Bos_taurus|12729               AAT---------ATTATGGAACTACTAGGGCATCACTGCAGTCATTTGCTAAGGAGAAAG
Equus_caballus|14193           AAG---------TATATGGAACTACAGGGACTTCAGTGCAGTCATTTGCTAAAGAGAAAT
Equus_caballus|14192           AAA---------TTCATGGAACTACTGGGACTTCAGTGCAGTCATTTGCTAAAGAGAAAT
Equus_caballus|14190           AAG---------TTGATGGAACTATTGAGTCTTCAGTGCAGTCATTTGCTAAAGAGAAAT
Canis_familiaris|22019         AAG---------TTAATGGAACAATTGGGGATTCAATGCAGTAATTTGCTAAGGAGAAGT
Canis_familiaris|22015         GAC---------TTTATGAAACTACTGGGGCTTCAGTGCAGTCATTTTTTAAGGAGAAAG
Caenorhabditis_elegans|25270   ATGCCGAAATTGCTCGGTGGAGAGTTCAAAAAAACTGCAATGGAGGTTCTCAGCGATCAG
Caenorhabditis_elegans|14340   TCAACTGATATGATTGGACAAGTTTCTTATCATAACACAAAAAACCTAATCGACAATAAG
                                                                                           

Bombyx_mori|13385              GACGTAAAGAAGTTAATACAAAACACGAATGAAAGTTTTGATGTGGTCATTGCAGAT---
Bombyx_mori|12014              ACGTATATAACCGCGTTTCCC------GAGGAAAGTTCAGACCCGAACCTCACACAAATT
Gasterosteus_aculeatus|19940   GAGATGATGACTTTCCTCCAG------AAGGAGCGCTACGACATCACAATCCTTGAT---
Fugu_rubripes|4293             GAGATAATAACTTTTCTTCAG------CATGAGAACTATGACGTCATCATCCTCGAT---
Xenopus_tropicalis|2247        TCCATCTTGAACTTATTAAAG------GAGGAGAAGTATGACATTGCGGTGATAGAT---
Xenopus_tropicalis|2244        TCCATCTTGAACTTATTAAAG------GAGGAAAAGTATGATATTGCGGTGATAGAT---
Xenopus_tropicalis|1478        TCCATCATAAACTTATTAAAG------GAGGAGAAGTATGACATTGCGGTGATAGAT---
Xenopus_tropicalis|1473        TCCATCTTGAACTTATTAAAG------GAGGAGAAGTATGACATTGCGGTGATAGAT---
Dipodomys_ordii|7215           NNNNNNNNNNNNNAGAATGTG------ACCGATGATTTTGAT------------------
Anolis_carolinensis|9649       AAGACTCTCATCTCTCTGAAG------AATGAGAAATTTCACCTTGCCGTGATAGAT---
Ornithorhynchus_anatinus|12628 GATGTCTTGGACTTCCTTAAG------AACCAGAAGCTGGACCTGCTGGTCCTGGAT---
Echinops_telfairi|13652        NNNNNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---
Tupaia_belangeri|13132         NNNNNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---
Felis_catus|38352              NNNNNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---
Bos_taurus|12730               GATATCATGGATTCCTTAAAG------AATGAGAACTTTGACCTGATAGTTGTTGAT---
Tarsius_syrichta|7332          GATATCATGGATTCCTTAAAG------AATGAGAATTTT---------------------
Dasypus_novemcinctus|14729     GATATCTTGGAATCTTTAAAG------AATGAGAACTTTGACCTGGTGGTGGCTGAA---
Choloepus_hoffmanni|10632      GATATCATAGATTCTCTAAAG------AATGAAAACTTTGACCTGGTGATAGTTGAA---
Mus_musculus|13539             GACATCATGGAGTTATTACAA------AAGGAGAACTTTGACCTAGTACTTCTTGAT---
Rattus_norvegicus|18092        GACATCATGGAATTCTTAAAA------AATGCGAACTTTGACCTAGTACTTTTTGAG---
Pteropus_vampyrus|14496        GATATCGTGGATTCCTTAAAG------AATGAGAACTTTGACCTGTTGGTGGTTGAA---
Otolemur_garnettii|7502        GATATCATGGATTCCTTAGAG------AATGAGAACTTCGAACTGGTGATAATTGAA---
Microcebus_murinus|7068        GATATCATGGATTCCTTAAAG------AATAAGAACTTCGACCTGGTGATAGTTGAA---
Microcebus_murinus|19157       GAGATCATGGATTCCTTAAAG------AATGAGAACTTCGACCTGGTGATAGTTGAA---
Tarsius_syrichta|4797          GATATCATGGATTCCTTAAAG------AATGAGAACTTCGACATGGTGATAGTTGAA---
Rhesus_macaque|31907           GATATAATGGATTCCTTAAAG------AATGAGAACTTTGATCTGGTATTTGTTGAA---
Homo_sapiens|68741             GATATAATGGATTCCTTAAAG------AATGAGAACTATGATCTGGTATTTGTTGAA---
Gorilla_gorilla|244            GATATAATGGATTCCTTAAAG------AATGAGAACTATGATCTGGTATTTGTTGAA---
Pongo_abelii|21971             GATATAATGGATTCCTTAAAG------AATGAAAACTTTGATCTGGTATTTGTTGAA---
Pan_troglodytes|29695          GATATAATGGATTCCTTAAAG------AATGAGAACTTTGATCTGGTATTTGTTGAA---
Callithrix_jacchus|45121       GATATCATGGATTCCTTAAAG------AATGAGAACTTCGACATGGTGATAGTTGAA---
Rhesus_macaque|31909           GATATCATGGATTCCTTAAAG------AATGAGAACTTCGACATGGTGATAGTTGAA---
Gorilla_gorilla|249            GATATCATGGATTCCTTAAAG------AATGAGAACTTCGACATGGTGATAGTTGAA---
Homo_sapiens|68743             GATATCATGGATTCCTTAAAG------AATGAGAACTTCGACATGGTGATAGTTGAA---
Pan_troglodytes|29694          GATATCATGGATTCCTTAAAG------AATGAGAACTTCGACATGGTGATAGTTGAA---
Loxodonta_africana|24713       GATATCGTGGATTCCTTAAAG------AATGAGAACTTTGAACTGGTAGTAGTGGAA---
Oryctolagus_cuniculus|2791     GATATTGTGGAATCCCTGAAG------AGTGAGAACTTCGACCTGGTGATAATTGAA---
Ochotona_princeps|6294         GATATCCTGGAGTCCCTGAGG------AGTGAGAACTTCGACCTGATAGTCGTGGAG---
Tursiops_truncatus|8861        GATACTGTGAATTCTTTAAAG------AATGAGAACTTTGACCTGGTGATAGTGGAA---
Bos_taurus|12729               GATGTCATGAAGTCTTTAAAG------AATGAGAACTTCGACCTGGTGATAGTGGAA---
Equus_caballus|14193           GATATCATGGACTCTTTAGAG------AATGAGAACTTTGACCTGTTATTTGTTGAC---
Equus_caballus|14192           GATATCATGGACTCCTTAAAG------AATGAGAACTTTGACTTGTTATTTGTTGAA---
Equus_caballus|14190           GATATCATGGACTCCTTAAAG------AATGAGAACTTCGACCTGGTGATAGTTGAA---
Canis_familiaris|22019         GACATCATGGATTCCTTAAAA------AATGAGAATTTTGACTTGGTATTTGTTGAA---
Canis_familiaris|22015         GATATCATGGACATCTTAAAG------AATGAGAACTTTGATCTAGTGATAATTGAG---
Caenorhabditis_elegans|25270   AAATTGATTAACGAACTCAAA------GATCGAAAGTTCGATTTAGTCATTGCGGAA---
Caenorhabditis_elegans|14340   GCTTTGGTGCAGCAGATGAAG------GATGAGAAGTTCGACATTGGAATTACTGAG---
                                                                                           

Bombyx_mori|13385              ------TACATAGATACAGAAGTTTATGCCGCTTTCTCAGCACTG---TATGGATGTCCT
Bombyx_mori|12014              GACGTCAGCAGCAACATGGTAGCTCTTCCTAAATCCTATAAGGAA------TCGTTAAAT
Gasterosteus_aculeatus|19940   ------GCGTTCAACCCCTGCTCCTTCATCCTGGCACGCAAACTCGGTACAGGTATCGAC
Fugu_rubripes|4293             ------GCGTTTAATCCCTGTTCCTTCATCCTGGCGCGCAAACTT------GGCGTCCAG
Xenopus_tropicalis|2247        ------TCTTGCAATCCCTGCTCCTTTCTGGTTTCTGAGAAGTTA------GGAATCCCC
Xenopus_tropicalis|2244        ------TCTTTCAATCCCTGCTCCTTTTTGGCTTCTGAGAAGTTA------GGAATCCCC
Xenopus_tropicalis|1478        ------TCTTTCAATCCCTGCTCCTTTCTGGTGTCTGAGAAGTTA------GGAATCCCC
Xenopus_tropicalis|1473        ------TCTTTCAATCCCTGTTCCTTTCTGGTGTCTGAGAAGTTA------GGCATCCCC
Dipodomys_ordii|7215           ------TCAGTAGAATTCTGCTCT---TGCATTGCTGAGAAACTT---------AAACCA
Anolis_carolinensis|9649       ------GCATTCAACCCTTGCTCTTTCTTGGTCGCAGAAAAATTA------GGACTACCC
Ornithorhynchus_anatinus|12628 ------GCCTTTGATCCTTGCACCTTCCTGATTGCTGAGAAAATC------GGGCGTCCC
Echinops_telfairi|13652        ------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNNNNNNNN
Tupaia_belangeri|13132         ------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNNNNNNNN
Felis_catus|38352              ------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNNNNNNNN
Bos_taurus|12730               ------GCCTTTGACTTCTGTTCATTTCTAATTGCTGAGAAACTC------GGGAAGCTG
Tarsius_syrichta|7332          ------------------------------------------------------------
Dasypus_novemcinctus|14729     ------ACTTTTGACTGCTGTTCTTTCCTGATTGCTGAGAAACTT------GGGAAACCA
Choloepus_hoffmanni|10632      ------ACTTTTGACTACTGTCCTTTACTGGTTGCTGAGAAGCTT------GGGAAACCA
Mus_musculus|13539             ------TCAATGGATCTCTGTTCTTTCCTGATTGTTGAAAAGCTT------GGGAAACGA
Rattus_norvegicus|18092        ------TCAGTAGACTATTGTTCTTCACTGATTGTTGAAAAGCTT------GGGAAACAA
Pteropus_vampyrus|14496        ------GGTTTTGATTTCTGTGGTTTCCTGGTTGCTGAGAAGCTT------GGGAAGCCA
Otolemur_garnettii|7502        ------AGTTTTGACTACTGTCCTTTCCTGATCACTGAGAAGCTT------CGGAAGCCA
Microcebus_murinus|7068        ------AGTTTTGACTACTGCCATTTCCTGATTGCTGAGAAGCTT------GGCAAGCCA
Microcebus_murinus|19157       ------AGTTTTGACTATTGTCATTTTCTGATCGCTGAGAAGCTT------GGCAAGCCA
Tarsius_syrichta|4797          ------GCTTTTGACTTCTGTCCTTTCCTGATTGCTGAGAAGCTT------GGGAAGCCA
Rhesus_macaque|31907           ------GCATTTGATTTCTGTTCTTTCCTGATTGCTGAGAAGCTT------GTGAAACCA
Homo_sapiens|68741             ------GCATTTGATTTCTGTTCTTTCCTGATTGCTGAGAAGCTT------GTGAAACCA
Gorilla_gorilla|244            ------GCATTTGATTTCTGTTCTTTCCTGATTGCTGAGAAGCTT------GTGAAACCA
Pongo_abelii|21971             ------GCATTTGATTTCTGTTCTTTCCTGATTGCTGAGAAGCTT------GTGAAACCA
Pan_troglodytes|29695          ------GCATTTGATTTCTGTTCTTTCCTGATTGCTGAGAAGCTT------ATGAAACCA
Callithrix_jacchus|45121       ------ACTTTTGACTATTGTCCTTTCCTGATTGCTGAGAAGCTT------GAGAAGCGA
Rhesus_macaque|31909           ------ACTTTTGACTACTGTCCTTTCTTGATTGCTGAGAAGCTC------AGTAAGCCA
Gorilla_gorilla|249            ------ACTTTTGACTACTGTCCTTTCCTGATTGCTGAGAAGCTT------GGGAAGCCA
Homo_sapiens|68743             ------ACTTTTGACTACTGTCCTTTCCTGATTGCTGAGAAGCTT------GGGAAGCCA
Pan_troglodytes|29694          ------ACTTTTGACTACTGTCCTTTCCTGATTGCTGAGAAGCTT------GGGAAGCCA
Loxodonta_africana|24713       ------ACCTTTGACTACTGTCCTTTCCTGATTGCTGAGAAGCTT------GGGAAACCA
Oryctolagus_cuniculus|2791     ------ATTTTTGACTACTGTCCTCTCCTGATCGCTGAGAAGCTC------GGGAAGCCA
Ochotona_princeps|6294         ------ATCTTTGACTACTGTCCTCTTCTGCTTGCTGAGAAGCTT------GGGAAGCCG
Tursiops_truncatus|8861        ------ATTTTTGACTACTGGCCTTTCTTGCTTGCTGAGAAGCTT------GGAAAG---
Bos_taurus|12729               ------ATGTTTGACTACTGTCCTTTCTTGGTTGCTGAGAAGCTT------GGGAAGCCA
Equus_caballus|14193           ------GCATTTGACTTGTGTTCTCCCCTGGTTGCTGAGAAGCTT------GGGAAGCCA
Equus_caballus|14192           ------GGATTTGACTTGTGTTCTCTCCTGGTTGCTGAGAAGCTT------GGGAAACCG
Equus_caballus|14190           ------AGTTTTGACTTCTGTCCTTTCCTAGTTGCTGAGAAGCTT------GGGAAACCA
Canis_familiaris|22019         ------GCATTTGACTTCTGTTCTTTCCTGATTGCTGAGAAGCTT------GGGAAGCCA
Canis_familiaris|22015         ------AATTTTGACTACTGTTCTTTCCTGGTTGCTGAGAAGCTT------GGAAAACCA
Caenorhabditis_elegans|25270   ------ACTTTTGAGTTGACTGGATTTTACCTCGCTCACCTTCTG------GATGTCCCA
Caenorhabditis_elegans|14340   ------CTCTTCGATTTTTCGGGCCTCGCATTTTTCGAGGTTATC------GGCTTGAAA
                                                                                           

Bombyx_mori|13385              TTGATA---------TGGCTGTCTTCG---CTGAGGACTAATTGGCAGACTCTACGTTTG
Bombyx_mori|12014              TTAAAA---GCGGTTCTCGAAGGTAAA---GCG---ATACCGCTC---GATTTTGACATA
Gasterosteus_aculeatus|19940   TACATA---GCTTTCCACCCCGGCACT---CTGAACAGTCCTCTG---TCCATGGCGCTC
Fugu_rubripes|4293             TATGTT---GCTTTTTACCCCGGCAGT---CTGAACGGTCCTCTG---TCCATCACTCTG
Xenopus_tropicalis|2247        TTCATT---GCTACTCACCCCTTTGCA---CTAAAAAATGCTTGG---CATTCAGGAATA
Xenopus_tropicalis|2244        TTCATT---GCTACTCACCCCTTTGCA---GTAAAGAGTCCTTGG---CATTCAGGAATA
Xenopus_tropicalis|1478        TTCATT---GCTACTCACCCCTTTGCA---CTAAAAAATGCTTGG---CATTCAGGAATA
Xenopus_tropicalis|1473        ATCATT---GCTACTCACCCATTAGCA---CTTAGGAGTTCCTGG---CATACAGGTATT
Dipodomys_ordii|7215           TTTTGT---ACTTCCACA------------------GCATTTTGG---CAACTTGGGTTC
Anolis_carolinensis|9649       TTTATT---GCCGTCTATCCAGGGACT---TTTGTTAATGCACCA---CGGGCTGGAATC
Ornithorhynchus_anatinus|12628 TCCGTC---GCCATCCTGTCCACCTCG---TTC---AACTACCTC---CCGGTTTGGCAT
Echinops_telfairi|13652        NNNNNN---NNNNNNNNNNNNNNNNNN---NNN---NNNNNNNNN---NNNNNNNNNNNN
Tupaia_belangeri|13132         NNNNNN---NNNNNNNNNNNNNNNNNN---NNN---NNNNNNNNN---NNNNNNNNNNNN
Felis_catus|38352              NNNNNN---NNNNNNNNNNNNNNNNNN---NNN---NNNNNNNNN---NNNNNNNNNNNN
Bos_taurus|12730               TTTGTG---TCCATTCTTTCCACATTA---GTT---AGCAGACTG---GACTTTGGCCTG
Tarsius_syrichta|7332          ------------------------------------------------------------
Dasypus_novemcinctus|14729     TTTGTG---TCTGTCATCTCCTCGTCA---TTT---GGTGTGGTG---GACTTTGGGCTA
Choloepus_hoffmanni|10632      TTTGTG---TTCATCTTTCCCAATGCG---TTT---GGTGTAGTG---GACTTTGGGCTA
Mus_musculus|13539             TTTGTG---TCCTTTCTTCCCTTTCAA---TTT---AGCTATATG---GACTTTGGGTTA
Rattus_norvegicus|18092        TTCGTG---TTATTTCTTGCCTTTCAA---CTT---GGCTTTATG---GACTTCGAGTTA
Pteropus_vampyrus|14496        TTTGTG---ACCACTCTCCCTTGCACA---TTT---GGCACTTTG---GATTTTGGACTA
Otolemur_garnettii|7502        TTTGTG---TCCATTCTCACCACCTCA---TTT---GCCATTTTG---GACTTTGGGCTA
Microcebus_murinus|7068        TTTGTG---TCCATTCTTCCTACCACA---TTT---GGCACTGTG---CACTTTGGGCTC
Microcebus_murinus|19157       TTTGTG---TCCATTCTTACCACCTCA---TTT---GGCAGATTG---GACTTCGGGCTC
Tarsius_syrichta|4797          TTTGTG---TCCATTCTTGCCTCTTCA---TTT---GGCTCTTTG---GACATTGGGCTA
Rhesus_macaque|31907           TTTGTG---GCCATTCTTCCCACCAGA---TTC---GGCTCTTTG---GAATTTGGGCTA
Homo_sapiens|68741             TTTGTG---GCCATTCTTCCCACCACA---TTC---GGCTCTTTG---GATTTTGGGCTA
Gorilla_gorilla|244            TTTGTG---GCCATTCTTCCCACCACA---TTC---GGCTCTTTG---GATTTTGGGCTA
Pongo_abelii|21971             TTTGTG---GCCATTCTTCCCACCACA---TTC---GGCTCTTTG---GATTTTGGGCTA
Pan_troglodytes|29695          TTTGTG---GCCATTCTTCCCACCACA---TTT---GGCTCTTTG---GATTTTGGGCTA
Callithrix_jacchus|45121       TTTGTG---GCCATTCTTCCCACCTCA---TTC---AGCTCTGTG---GAATTTGGGCTA
Rhesus_macaque|31909           TTTGTG---GCCATTCTTTCCACCTCA---TTT---GGCTCTTTG---GAATTTGGGCTA
Gorilla_gorilla|249            TTTGTG---GCCATTCTTTCCACTTCA---TTC---GGCTCTTTG---GAATTTGGGCTA
Homo_sapiens|68743             TTTGTG---GCCATTCTTTCCACTTCA---TTC---GGCTCTTTG---GAATTTGGGCTA
Pan_troglodytes|29694          TTTGTG---GCCATTCTTTCCACTTCA---TTC---GGCTCTTTG---GAATTTGGGCTA
Loxodonta_africana|24713       TTTGTA---TCCATTCTTCCTTCCTCG---TTC---GGCCCTGTG---GATTTTGGGCTA
Oryctolagus_cuniculus|2791     TTTGTG---TCTCTTCTTTCCTCCTCA---TTT---GGCACTTTG---GACTTTGGGCTC
Ochotona_princeps|6294         TTTGTG---TCTCTTCTAGCCTCCTCA---TTT---GGCGCCTTG---GATTTTGGGCTT
Tursiops_truncatus|8861        ------------------------------------------------------------
Bos_taurus|12729               TTTGTG---GCCATTCTCCCTTCCGCA---CTG---GGCACCGTG---GACTTTGGGCTA
Equus_caballus|14193           TTTGTG---TCTGTTCTTCCCACCACG---TTT---GGCTATATG---GACTTTGGACTA
Equus_caballus|14192           TTTGTC---TCCATTATTTCCACCTCG---TTT---GGCTTTATT---GATTTTGGACTA
Equus_caballus|14190           TATGTG---TCCATTCTCCCCTCCTCG---TTT---GATGCTGTG---GACTTTGGACAA
Canis_familiaris|22019         TTTGTG---TCAATTCTTCCCACCCCC---TTT---GGCAGTGTG---GACCTTGGGCTA
Canis_familiaris|22015         TTTGTG---TCCATTCTCTCTTCCTCG---TTT---GGTACTATA---GATTTTGGACTA
Caenorhabditis_elegans|25270   TGCATT---CCTATGATGTCAGCTGTCAGATATCCCATTTTTAATGATCAGTTTGGTCAA
Caenorhabditis_elegans|14340   AATGTGATGGGAGCCCATACGACAAGTGTCTTTGAGGGAACACTCATGGCTACCGGAGCC
                                                                                           

Bombyx_mori|13385              ATCGACGAACCAACA---AATCCCGCTTATACAGTCAGC---------------------
Bombyx_mori|12014              ---------ATCCACAACTTGATGAACGCGGTCGAGATGAACACATATCAAATTGAGAAT
Gasterosteus_aculeatus|19940   ---------CCCAGC---CCGGTCTCCTACATCCCGGTC---------------------
Fugu_rubripes|4293             ---------CCCAGC---TCCATCGCCTCTGTTCCAGTC---------------------
Xenopus_tropicalis|2247        ---------CCGAAC---CTGCTGTCCATTATGCCAGCG---------------------
Xenopus_tropicalis|2244        ---------CCGAAC---CTGCTGTCCATTATGCCAGCG---------------------
Xenopus_tropicalis|1478        ---------CCGAAC---CAGCTGTCCTATGTGCCAGTG---------------------
Xenopus_tropicalis|1473        ---------TCCAGC---CTGCTGTCCTATATGCCAGTG---------------------
Dipodomys_ordii|7215           ---------CCAAGT---CCATTGTCATATGTTCCAGTA---------------------
Anolis_carolinensis|9649       ---------CCAAGC---CCTCTGTCCTATGTCCCTCGG---------------------
Ornithorhynchus_anatinus|12628 ---------CCCAGC---CCGCTGTCTTACGTGCCCGTT---------------------
Echinops_telfairi|13652        ---------NNNNNN---NNNNNNNNNNNNNNNNNNNNN---------------------
Tupaia_belangeri|13132         ---------NNNNNN---NNNNNNNNNNNNNNNNNNNNN---------------------
Felis_catus|38352              ---------NNNNNN---NNNNNNNNNNNNNNNNNNNNN---------------------
Bos_taurus|12730               ---------CCAAGC---CCCTTGTCTTATGTTCCAGTA---------------------
Tarsius_syrichta|7332          ------------------------------------------------------------
Dasypus_novemcinctus|14729     ---------CCTCGC---CCTGTGTCTTATGTTCCAGTC---------------------
Choloepus_hoffmanni|10632      ---------CCTCAA---CCCATCTCTTATGTTCCAGTC---------------------
Mus_musculus|13539             ---------CCAAACGCCCCCTTGTCATATGCTCCAGTG---------------------
Rattus_norvegicus|18092        ---------CAAAGAGTCCCCTTGTCCTATGTTCCAGTG---------------------
Pteropus_vampyrus|14496        ---------CCCAGC---CCCATATCTTATGTGCCAGTA---------------------
Otolemur_garnettii|7502        ---------CCAAGT---CCCTTGTCTTATGTTCCAGTG---------------------
Microcebus_murinus|7068        ---------CCAAAC---TCCTTGTCTTATGTTCCAGTA---------------------
Microcebus_murinus|19157       ---------CCAAGC---CCCTTGTCTTATGTTCCAGTA---------------------
Tarsius_syrichta|4797          ---------CCAAGT---CCTTTGTCTTATGTTCCAGTA---------------------
Rhesus_macaque|31907           ---------CCAAGC---CCCTTGTCTTATGTTCCAGTA---------------------
Homo_sapiens|68741             ---------CCAAGC---CCCTTGTCTTATGTTCCAGTA---------------------
Gorilla_gorilla|244            ---------CCAAGC---CCCTTGTCTTATGTTCCAGTA---------------------
Pongo_abelii|21971             ---------CCAAGC---CCCTTGTCTTATGTTCCAGTA---------------------
Pan_troglodytes|29695          ---------CCAAGC---CCCTTGTCTTATGTTCCAGTA---------------------
Callithrix_jacchus|45121       ---------CCAAGC---CCTCTGTCTTATGTGCCAGTA---------------------
Rhesus_macaque|31909           ---------CCAATC---CCCTTGTCTTATGTTCCAGTA---------------------
Gorilla_gorilla|249            ---------CCAATC---CCCTTGTCTTATGTTCCAGTA---------------------
Homo_sapiens|68743             ---------CCAATC---CCCTTGTCTTATGTTCCAGTA---------------------
Pan_troglodytes|29694          ---------CCAATC---CCCTTGTCTTATGTTCCAGTA---------------------
Loxodonta_africana|24713       ---------CCCAGC---CCCCTGTCTTATGTTCCAACA---------------------
Oryctolagus_cuniculus|2791     ---------CCTAGT---CCCCTGTCTTACGTTCCTGTA---------------------
Ochotona_princeps|6294         ---------CCAAGC---CCGCTGTCTTATGTGCCAGTG---------------------
Tursiops_truncatus|8861        ------------AGC---CCCCTGTCTTATGTGCCAGTA---------------------
Bos_taurus|12729               ---------CCAAGC---CCTCTGTCTTATGTGCCAGTG---------------------
Equus_caballus|14193           ---------CCAAGC---CCCCTCTCTTATGTGCCAGTA---------------------
Equus_caballus|14192           ---------CCAAGC---CCCCTCTCTTATGTGCCAGTA---------------------
Equus_caballus|14190           ---------CCAAGA---CCTCTGTCTTATGTGCCAACG---------------------
Canis_familiaris|22019         ---------CCAAGC---CCTGTGTCTTATGTTCCAGTA---------------------
Canis_familiaris|22015         ---------CCATGC---CCCCTGTCTTATGTCCCAGTA---------------------
Caenorhabditis_elegans|25270   ---------CCATCA---TTGCTTGGGCATGTACCCCAA---------------------
Caenorhabditis_elegans|14340   ---------CCAATT---CTTCCGTCTTTTGTTCCAGCT---------------------
                                                                                           

Bombyx_mori|13385              TCGATATCAATGAACTATCCGCCTTTGAACTTTAAACAGCGAATTGAGGAACTGTGGGCC
Bombyx_mori|12014              GTTTCTAAATTACTCAATGATCCAGAACAGAAGTTTGATGTCGTCATTGCCGAGTGGATG
Gasterosteus_aculeatus|19940   TTTGGCTCCCAGCTCTCCGACCAAATGAACACTTGGGGTCGAGCAAAGAACCTCTTTTAT
Fugu_rubripes|4293             TTCGGCTCCCAGCTGTCTGACCACATGAACCTCTGGGGACGTGCACAGAACCTCTTTTAT
Xenopus_tropicalis|2247        TATCAGTCCCAACTAACTGACCACATGAACTTCTTTGAACGGGTAAAAAATGTTTTTTTT
Xenopus_tropicalis|2244        TATCAGTCCCAATTAAGTGACCACATGAACTTTTTTGAAAGGGTAAAAAATGTTTTTTTT
Xenopus_tropicalis|1478        TTCCAAACCCAACTAACCGACCACATGGACTTCTTTGAACGGGTGAAGAATGTTCTTATG
Xenopus_tropicalis|1473        GCTCACTCCCAACTGACCGACCACATGGACTTCTTTAAACGGGTGAAGAATGTTTTTGCA
Dipodomys_ordii|7215           TACTATCCACTGATGAGTGGAGAAATGGCCTTCTGGGGC---GTAAAGAACATTCTAAAG
Anolis_carolinensis|9649       GCCCAATCCCTTCTAACGGACCGCATGGATTTCTGGGAACGTCTGAAAAACTGTCTAATG
Ornithorhynchus_anatinus|12628 CAACATTCCTCCTTAACCGACCGTATGGGATTCTGGGGGAGAGTGAAGAACTGCCTGATG
Echinops_telfairi|13652        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|13132         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Felis_catus|38352              NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTCTGATG
Bos_taurus|12730               TTTCAGTCTTTCCTAACTGACCATATGGACTTCTGGGGTAGAGTGAAGAATTTTCTGATG
Tarsius_syrichta|7332          ------------------------------------------------------------
Dasypus_novemcinctus|14729     TTCAATTCCTTACTAACTGACCGCATGGACTTTTGGGGCCGAGTGAAGAACTTCCTGATG
Choloepus_hoffmanni|10632      TTCGATTCCTTACTAACTGACCGCATGGACTTCTGGGGCCGAGTGAAGAACTTTCTGATG
Mus_musculus|13539             TATGGTTCTGGTCTAACTGACCAAATGGACTTTTGGGGCCGAGTGAAGAACATTCTGATG
Rattus_norvegicus|18092        TATGGTTCTGGTCTAACTGACCAAATGGACTTCTGGGGCCGAGTGAAGAACTTCCTGATG
Pteropus_vampyrus|14496        TTCACCTCCTTCCTAACTGACCAGATGGACTTCTGGGGCCGAGTAAAGAATTTTCTGATG
Otolemur_garnettii|7502        TACAGTTCCTTGTTAACTGACCACATGGACTTCTGGGGCCGAGTGAGGAACTTTGTGACT
Microcebus_murinus|7068        TTCCATTCCTCCTTAACTGACCACATGGACTTCTGGGGCCGAGTGAAGAACTTTCTGACT
Microcebus_murinus|19157       TACAATTCCTTGTTAACTGACCACATGGACTTCTGGGGCCGAGTGAAGAACTTTCTGGCT
Tarsius_syrichta|4797          TTTGGTTCCTTGTTGACTGACCACATGGACTTCTGGAGCCGAGTGAAGAATTTCCTGATG
Rhesus_macaque|31907           TTCCATTCCTTGTTGACTGATCACATGGACTTCTGGGGCCGAGTGAAGAATTTTCTGATG
Homo_sapiens|68741             TTCCCTTCCTTGCTGACTGATCACATGGACTTCTGGGGCCGAGTGAAGAATTTTCTGATG
Gorilla_gorilla|244            TTCCATTCCTTGCTGACTGATCACATGGACTTCTGGGGCCGAGTGAAGAATTTTCTGATG
Pongo_abelii|21971             TTCCATTCCTTGCTGACTGATCACATGGACTTCTGGGGCCGAGTGAAGAATTTTCTGATG
Pan_troglodytes|29695          TTCCATTCCTTGCTGACTGATCACATGGACTTCTGGGGCCGAGTGAAGAATTTTCTGATG
Callithrix_jacchus|45121       TTCCATTCCTTTCTGACTGATCACATGGACTTCTGGGGCCGAGTAAAGAATTTTCTGATG
Rhesus_macaque|31909           TTCCGTTCCTTGCTGACCGATCACATGGACTTCTGGGGCCGAGTGAAGAATTTCCTGATG
Gorilla_gorilla|249            TTCCGTTCCTTGCTGACTGATCACATGGACTTCTGGGGCCGAGTGAAGAATTTTCTGATG
Homo_sapiens|68743             TTCCGTTCCTTGCTGACTGATCACATGGACTTCTGGGGCCGAGTGAAGAATTTTCTGATG
Pan_troglodytes|29694          TTCCGTTCCTTGCTGACTGATCACATGGACTTCTGGGGCCGAGTGAAGAATTTTCTGATG
Loxodonta_africana|24713       TTCCATTCCTTGCTAACTGACCGCATGGACTTCTGGGGACGAATGAAGAACCTTCTGATG
Oryctolagus_cuniculus|2791     TTCAGTTCTTTGCTGACTGACCACATGAGCTTCTGGGGCCGGATGAAGAATTTCCTAATG
Ochotona_princeps|6294         TTCAGTTCTTTGCTGACCGACCACATGAACTTCTGGGGCCGGGTGAAGAATTTCCTAACC
Tursiops_truncatus|8861        TTCTATTCCTTGTTAACTGACCACATGGAC---TGGGGC---GTGAAGAATTCCCTGATG
Bos_taurus|12729               TTCTACTCCTTGTTAACGGACCAGATGGACTTCTGGGGCCGAGTAAAGAACTTCCTGATG
Equus_caballus|14193           TTCAATTCCTTGCTATCCGACCGCATGGGCTTCTGGGACCGAGTGAAGAACTTCTTGATG
Equus_caballus|14192           TTTGATTCCTTGCTAAGCGACCGCATGGACTTCTGGGACAGAGTGAGGAACTTCCTGAAA
Equus_caballus|14190           TTACATTCCTTCCTGACTGACCATATGGATTTCTGGGGCCGACTAAAGAATTTTCTGATG
Canis_familiaris|22019         TTCCATTCCTTGTTAACTGACTGCATGGATTTCTGGAGCCGAGTGAAGAATTTTCTGATG
Canis_familiaris|22015         TTCCATTCCCTTCTAACTGACCACATGGACTTCTGGGGCCGAGTGAAGAATTTTCTGATG
Caenorhabditis_elegans|25270   ATTGGGTCCGCAGTGGCGGGAGAAGCTGGATTTTACGATCGACTCAACGATATGTTCCGA
Caenorhabditis_elegans|14340   TCGCAGACTTTTACAGATGATAGTGGAAGTATACTATCTAGACTGAACAACTTGTACATG
                                                                                           

Bombyx_mori|13385              CAGTGGAAATGGCAAATAGTTAAA---AGACTCTATATTGTTTCACAAGAGGAAAAGATT
Bombyx_mori|12014              TTTACTGAGATCTGTGTCGGGACAAAAGGTCGCCAAGAAACATTGTACGCTAATGAAATA
Gasterosteus_aculeatus|19940   TCTCTCTTAGCTCCCATAGGCCAGGAACTTGTATGGTCGACTTTT------AGGGAAGTA
Fugu_rubripes|4293             TCCTTCATGGCCCCTGTAGGTCAGAAACTCGTGTGGTCAACGTTT------GCGGACGTC
Xenopus_tropicalis|2247        TACATTGACTCAGCTGTATTTGACTGCAAAATTCACTCATTATTT------GATGATGTT
Xenopus_tropicalis|2244        TACATTGACTCAGGTGAGTGCTCTTTTCTTGTTGCGATATTCCTA------TTTAGTTAT
Xenopus_tropicalis|1478        TACATTGGATCACGTGTAGAGGAGAGTAAAATTCACTCATTATTT------GATGATGTT
Xenopus_tropicalis|1473        TACATTGGCTCAGTTGTCGTGGAGAGCAAAATTCACTCATTATTT------GATGATGTT
Dipodomys_ordii|7215           TCTGTTGCTTTTTCTATGAAGCAAAAGAAAAAGTACTCTACCTTT------GACAACACC
Anolis_carolinensis|9649       TCATTGTTGTCATTAGCAATTAATAATCAGATCTACGACAAGTTT------GACAGTGTT
Ornithorhynchus_anatinus|12628 TTCCTTTCTTTCCCTGTGACACAACGTCAGATCCAGGCTCAGTTT------GACGAAGTC
Echinops_telfairi|13652        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNNNNNNNN
Tupaia_belangeri|13132         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNNNNNNNN
Felis_catus|38352              TTCTTTGATTTCACCATGAAGCAAAGGCAAATCCAGTCTGCATAT------GACAATACC
Bos_taurus|12730               TCACTTGTTTTCTCTGTGGAGCAGTGGAAAATACACTCTACCTTT------GACAACACC
Tarsius_syrichta|7332          ------------------------------------------------------------
Dasypus_novemcinctus|14729     TCCTTTGATTTTTCCGTGAAACAATGGCGAATCCACTCTCAGTAT------GAGGAAGCC
Choloepus_hoffmanni|10632      TTCTTTGATTTTTCCATGAAGCAAAGGCAAATCCAGGCTCAGTAT------GATGATGCC
Mus_musculus|13539             TTCTTTCATTTCACCAAGAAGCGAAGGGACATCTTTTCTCAATAT------GGCAATACT
Rattus_norvegicus|18092        TTCTTTGATTTATCCAGGAAGCAAAGGGAAATACTTTCTCAATAT------GACAGTACC
Pteropus_vampyrus|14496        TTCATTGATTTATTCATGAAGCAATGGCAGCTTCTCTCTACATAT------GAAGATATC
Otolemur_garnettii|7502        TTCTTCACTTTCTCCAGGCGACAATGGCAAGTTCAGTCTATGTTT------GACAACACC
Microcebus_murinus|7068        TTCTTTACTTTCTCCAGGAGGCAATGGCAAGTTCAGTCTATGTAT------GACAACATC
Microcebus_murinus|19157       TTCTTTACTTTCTCCAGGAGGCAATGGCAAGTTCAGTCTATGTAT------GACAACACC
Tarsius_syrichta|4797          TTCTTTCATTTCACCAGGAGGCAATGGCAAATGCACTCTAAGTTT------GACAACACC
Rhesus_macaque|31907           TTCTTTAGTTTCTCCAGAAGCCAATGGGACTTGCTGTCTACATTT------GACAACACC
Homo_sapiens|68741             TTCTTTAGTTTCTCCAGGAGCCAATGGGACATGCAGTCTACATTT------GACAACACC
Gorilla_gorilla|244            TTCTTTAGTTTCTCCAGGATCCAATGGGACATGCAGTCTACATTT------GACAACACC
Pongo_abelii|21971             TTCTTTAGTTTCTCCAGGAGCCAATGGGACATGCAGTCTACATTT------GACAACACC
Pan_troglodytes|29695          TTCTTTAGTTTCTCCAGGAGCCAATGGGACATGCAGTCTACATTT------GACAACACC
Callithrix_jacchus|45121       TTCTTTAGTTTCTGCAGGAGGCAATGGCACAAGCAGTCTACATTT------GACAACACC
Rhesus_macaque|31909           TTCTTTAGTTTCTGCAGGAGGCAATGGCACATGCAGTCTACATTT------GACAACGCC
Gorilla_gorilla|249            TTCTTTAGTTTCTGCAGGAGGCAACAGCACATGCAGTCTACATTT------GACAACACC
Homo_sapiens|68743             TTCTTTAGTTTCTGCAGGAGGCAACAGCACATGCAGTCTACATTT------GACAACACC
Pan_troglodytes|29694          TTCTTTAGTTTCTGCAGGAGGCAACAGCACATGCAGTCTACATTT------GACAACACC
Loxodonta_africana|24713       TTCTTTGGTTTTTCTATGAAGCAAAGGCAAATCCACTCTCAGTAT------GACAACACC
Oryctolagus_cuniculus|2791     TTCTTTGGTTTCTCCATGAAGCAATGGCAAATACAGTCTAAGTTT------GACAACAGC
Ochotona_princeps|6294         TTTTTTGGTTTCTCCATGAAGCAACGAAAATTGCAGTCTATGTTC------GATAACAGC
Tursiops_truncatus|8861        TTCTTTGGT---------------------------------------------------
Bos_taurus|12729               TTCTTTGAGTTCTTCAAGAAGCAGTGGAAAATCCAGTCTGCATAT------GATGACACC
Equus_caballus|14193           TTTTTTGATTTCTCTGTGAAGCAATGGCAAACCCACTCTACATTT------GACAACATC
Equus_caballus|14192           TTTTTTGATTTCTCCATGAAGCAATGGCAAATTCACTCTACATTT------GACAACACC
Equus_caballus|14190           TTTTTAAATTTCTCCATGAGGCAACGGCAAATCCACTCTAAATTT------GACAACACC
Canis_familiaris|22019         TTCTTTGATTTCTTCATGAAACAATGGCAAATCCAATCTACGTTT------GACAAGACC
Canis_familiaris|22015         TTCTTCAATTTCTCCAGAAAACAATGGCAAATCCAGTCTTCTTAT------GACAACGCC
Caenorhabditis_elegans|25270   TTCTTTTTTATGGGAATTTCTCAAGAGCAACTCAACAAATATCAA------AATTATTTT
Caenorhabditis_elegans|14340   ACTTATTGGTCATACCAGTTTCAGAATAAGATTCAAAGTTTTGCG------CAGAAGGCG
                                                                                           

Bombyx_mori|13385              TATGACAATCATTTCGTACCTTTTATAAGGAAAAGAGGTATTAAGCCGCCAAATTATGAA
Bombyx_mori|12014              GTACCAATAATAAAGAAG---------AGA------GGTCTGGTGCCACCTTCATTCAAT
Gasterosteus_aculeatus|19940   GCCGAACGCCACTTTGAT---------TCT------GACTCGCCCCCTGGAGGTCTGGAG
Fugu_rubripes|4293             GCTGAACGCCACCTGGAG---------------------TCTCCTCCTGATGGCCTGAAA
Xenopus_tropicalis|2247        ATTGAAGAGCATTTCCCA---------GTA------GGTTCCAGACCAACC---TTTGTG
Xenopus_tropicalis|2244        TACACAGAAGTATATTCC---------AAAGCAGTAGGTTCTAGACCATCC---TTTGCG
Xenopus_tropicalis|1478        ATTGAGGAACATTTCCCA---------GCA------GGTTCCAGACCAACC---TTTGTG
Xenopus_tropicalis|1473        ATTGAGGAACATTTCCCA---------GCA------GGTTCTAGACCAACC---TTTGTG
Dipodomys_ordii|7215           ATCAAGCAGCATTTCGCA---------GAA------GGCTCTAGGCCAGTT---TTGGCT
Anolis_carolinensis|9649       ATTAGGGACCATTTCCCA---------GCC------AGGTCCAGACCTGCT---CTCCCT
Ornithorhynchus_anatinus|12628 ATTAAGGAACATTTCCCA---------TCA------GGGGCCAGACCTTCG---CTGCCA
Echinops_telfairi|13652        NNNNNNNNNNNNNNNNNN---------NNN------NNNNNNNNNNNNNNN---NNNNNN
Tupaia_belangeri|13132         NNNNNNNNNNNNNNNNNN---------NNN------NNNNNNNNNNNNNNN---NNNNNN
Felis_catus|38352              ATCAAGGAGCATTTCCCG---------GAA------GACTCTAGGCCGGTT---TTGTCT
Bos_taurus|12730               ATCAAAGAACATTTCCAG---------GAA------GGTTCTAGGCCAGTT---TTATCT
Tarsius_syrichta|7332          ------------------------------------------------------------
Dasypus_novemcinctus|14729     ATCAGGGAACATTTCCCA---------GAA------GGATCAAGGCCAGTG---TTGTCT
Choloepus_hoffmanni|10632      ATCAGGGAGCACTTCCCA---------GAA------GGCTCTAGGCCAGTG---TTGTCT
Mus_musculus|13539             GTCCAGGAGCATTTTGCG---------GAA------GGCTCTCAGCCAGTG---TTGTCT
Rattus_norvegicus|18092        ATCCAGGAGCATTTTGCA---------GAA------GGCTCTCGGCCAGTT---TTGTCT
Pteropus_vampyrus|14496        ATCAAGGAGCATTTTCAA---------GAA------GGCTCTAGGCCAGTT---TTGTCT
Otolemur_garnettii|7502        ATCAAGGAGCACTTCCCA---------GAA------GGCTCGAGGCCGGTT---TTATCT
Microcebus_murinus|7068        ATTAAGGAGCATTTCCCA---------GAA------GGCTCGAGGCCAGTT---CTGTCT
Microcebus_murinus|19157       ATCAGGGAGCATTTCCCA---------GAA------GGCTCGAGGCCAGTT---CTGTCT
Tarsius_syrichta|4797          ATCAAGGAGCATTTCTCA---------GAA------GGCTCGAGGCCAGTT---TTATCT
Rhesus_macaque|31907           ATCAAGGAGCATTTCCCA---------GAA------GGCTCTAGGCCAGTT---TTGTCT
Homo_sapiens|68741             ATCAAGGAGCATTTCCCA---------GAA------GGCTCTAGGCCAGTT---TTGTCT
Gorilla_gorilla|244            ATCAAGGAGCATTTCCCA---------GAA------GGCTCTAGGCCGGTT---TTGTCT
Pongo_abelii|21971             ATCAAGGAGCATTTCCCA---------GAA------GGCTCTAGGCCGGTT---TTGTCT
Pan_troglodytes|29695          ATCAAGGAGCATTTCCCA---------GAA------GGCTCTAGGCCAGTT---TTGTCT
Callithrix_jacchus|45121       ATCCAGGAGCATTTCACA---------GAA------GACTCTAGGCCTGTT---TTGTCT
Rhesus_macaque|31909           ATCAAGGAGCATTTCCCA---------GAA------GGCTCTAGGCCAGTT---TTGTCT
Gorilla_gorilla|249            ATCAAGGAGCATTTCACA---------GAA------GGCTCTAGGCCAGTT---TTGTCT
Homo_sapiens|68743             ATCAAGGAACATTTCACA---------GAA------GGCTCTAGGCCAGTT---TTGTCT
Pan_troglodytes|29694          ATCAAGGAGCATTTCACA---------GAA------GGCTCTAGGCCAGTT---TTGTCT
Loxodonta_africana|24713       ATCAGGGAACATTTTCCA---------GAA------GGCTCTAGACCAGTG---TTGTCT
Oryctolagus_cuniculus|2791     ATCAAGGAGCATTTCCAG---------GAG------GGCTCTAGGCCAGTT---CTGTCT
Ochotona_princeps|6294         ATCAAGGAGCATTTCCGG---------GAA------GGCTCCAGGCCAATT---CTGTCT
Tursiops_truncatus|8861        ------------------------------------------------------------
Bos_taurus|12729               ATCAAGGAGCATTTCCCG---------GAC------GACTCTAGGCCAGTT---TTGTCT
Equus_caballus|14193           ATCAAGGAGCATTTTCCT---------GAA------GGCTCTAGGCCAGTT---TTGTCT
Equus_caballus|14192           ATCAAGGAGCATTTCCCC---------GAA------GGCTCTAGGCCAGTT---TTGTCT
Equus_caballus|14190           ATCAAGGAGCATTTCCCC---------GAA------GGGTCTAGGCCAGTT---TTGTCT
Canis_familiaris|22019         ATCAAGGAACATTTCCCG---------GAA------GGTGCTAGGCCAGTT---TTGTCT
Canis_familiaris|22015         ATCAAGGAACATTTCCCA---------GAA------GGCTCTAGGCCAGTG---TTGTCT
Caenorhabditis_elegans|25270   ATCGAGGAAGCAATTGGA------------------CGTCCTGTACCTTTC---TGGAAG
Caenorhabditis_elegans|14340   CTGGATGAGCATTATGAG---------AAG------GGCAAGGCGCCAAAG---ATTTGG
                                                                                           

Bombyx_mori|13385              GACCTGATCTATAATGCTTCGCTGGTGCTAGCAAACGATCACCACTCATTAGGAAATTTG
Bombyx_mori|12014              GATTTACTATACAATAGTTCTTTGGTGCTCAGTAATACTCACGTTTCCTATGCGGCAGCG
Gasterosteus_aculeatus|19940   GAGCTGCATCAAGGAGCTGAACTATGGGCCTTCAACACCGACTTCTCCCTGGAGTTCCCC
Fugu_rubripes|4293             GATCTACACGAAGGAGCTGAGCTCTGGGCATTCAACACCGACTTTTCACTGGAGTTCCCC
Xenopus_tropicalis|2247        GAACTCTACAAGAAAACAGCACTCTGGATGTATAATACAGACTTTACCATTGAATTTCCC
Xenopus_tropicalis|2244        GAACTCTACAAGAAAGCAGCACTGTGGATGTATAATACAGACTTTACCATTGAATTTCCC
Xenopus_tropicalis|1478        GAACTCTACAAGAAAACTGCACTCTGGATGTATAATACAGACGTTACTTTAGAATTTTCT
Xenopus_tropicalis|1473        GAACTCTACAAGAAAACATCTCTCTGGATGTATAATACAGACTTTACCATTGAGTTTCCC
Dipodomys_ordii|7215           CATCTTCCCCAGAAAACAGAGTTTTGGTTTGTGAATTCGGATTTTGCCTTGGATTTTGTC
Anolis_carolinensis|9649       GAGCTGTACTTGAAAGCGGAGCTCTGGATTTATGACACCGACTTCTCCATTGAGTTTGCA
Ornithorhynchus_anatinus|12628 GATCTTTACCGAAAACCAGAGCTGTGGATGGTTAATTCTGACTTTTCTTTTGAGTTTACT
Echinops_telfairi|13652        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tupaia_belangeri|13132         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Felis_catus|38352              CATCTTCTGAAGAAAGCAGAGCTGTGGTTTGTTAACTCTGACTTTGCCCTTGAATTTGCT
Bos_taurus|12730               CATCTTCTAAAGAAAGCAGAGCTGTGGTTTGTCAGTTCTGACTTTGCCTTTGAATTTGCT
Tarsius_syrichta|7332          ------------------------------------------------------------
Dasypus_novemcinctus|14729     CATCTTCTACTGAAAGCAGAGTTGTGGTTTATTAACTCTGACTTTGCCTTTGATTTTTCT
Choloepus_hoffmanni|10632      CATCTTCTACTGAAAGTAGAGCTGTGGTTTGTTAACTCTGACTTTGCTCTTGATTTTGCT
Mus_musculus|13539             GACCTTCTACTGAAAGCTGAGCTGTGGTTTGTCAACTCTGACTTTGCCTTGGATTTTGCT
Rattus_norvegicus|18092        GACCTTTTACTGAAAGCTGAGCTGTGGTTTGTTAACTGTGACTTTGCCTTTGAATTTGCT
Pteropus_vampyrus|14496        CATCTTCTAAGGAAAGCGGAGCTGTGGTTTGTTAACTCTGACTTTGCCTTTGAATTTGCT
Otolemur_garnettii|7502        CATCTTCTACTGAAAGCAGAGCTGTGGTTTGTTAACTCTGACTTTGCCTTTGATTTTGCC
Microcebus_murinus|7068        CAACTCCTACTGAAGGCAGAGCTGTGGTTTGTTAACTCTGACTTTGCCTTTGACTTTGCC
Microcebus_murinus|19157       CAACTCCTACTGAAAGCAGAGCTGTGGTTTGTTAACTCTGACTTTGCCTTTGACTTTGCC
Tarsius_syrichta|4797          CATCTCCTACGGAAATCAGAGCTGTGGTTTGTGAACTCTGACTTTGCCTTTGATTTTTCC
Rhesus_macaque|31907           CATCTTCTACTGAAAGCAGAGTTGTGGTTTGTTAACTCTGATTTTGCCTTTGATTTTGCC
Homo_sapiens|68741             CATCTTCTACTGAAAGCAGAGTTGTGGTTTGTTAACTCTGATTTTGCCTTTGATTTTGCC
Gorilla_gorilla|244            CATCTTCTACTGAAAGCAGAGTTGTGGTTTGTTAACTCTGATTTTGCCTTTGATTTTGCC
Pongo_abelii|21971             CATCTTCTACTGAAAGCAGAGTTGTGGTTTGTTAACTCTGATTTTGCCTTTGATTTTGCC
Pan_troglodytes|29695          CATCTTCTACTGAAAGCAGAGTTGTGGTTTGTTAACTCTGATTTTGCCTTTGATTTTGCC
Callithrix_jacchus|45121       CATCTTCTATTGAAAGCAGAGTTGTGGTTCGTTAACTCTGACTTTGCCTTTGATTTTGCT
Rhesus_macaque|31909           CATCTTCTACTGAAAGCAGAATTGTGGTTCATTAACTCTGACTTTGCCTTTGATTTTGCT
Gorilla_gorilla|249            CATCTTCTACTGAAAGCAGAGTTGTGGTTCATTAACTCTGACTTTGCCTTTGATTTTGCT
Homo_sapiens|68743             CATCTTCTACTGAAAGCAGAGTTGTGGTTCATTAACTCTGACTTTGCCTTTGATTTTGCT
Pan_troglodytes|29694          CATCTTCTACTGAAAGCAGAGTTGTGGTTCATTAACTCTGACTTTGCCTTTGATTTTGCT
Loxodonta_africana|24713       CAGCTTCTACAGAAAGCAGAGTTATGGTTTGTTAACTCTGACTTTGCCTTTGATTTTGCT
Oryctolagus_cuniculus|2791     CATCTTCTACAGAAAGCCGAGCTCTGGTTTGTTAACTCTGACTTTGCTTTTGAATTTGCT
Ochotona_princeps|6294         CATCTTTTAGAGAAAGCAGAGCTCTGGTTTGTGAACTCTGATTTTGCCTTTGAATTTGCC
Tursiops_truncatus|8861        ------------------------------------------------------------
Bos_taurus|12729               CATCTTCTAACAAAAGCAGGGCTGTGGTTTGTTAACACCGACTTTGCCTTTGATTTTGCT
Equus_caballus|14193           CATCTTCTAAAGAAAGCAGAGTTGTGGTTTGTTAACACTGACTTTGCCTTTGATTTTGCT
Equus_caballus|14192           CATCTCCTAAAGAAAGCAGAGCTGTCGTTAGTTAACTCTGACTTTGCCTTTGATTTTGCT
Equus_caballus|14190           CATCTCCTAAAGAAAGCAGAGTTGTGGTTTGTGAACTCTGACTTTGCCTTTGATTTTGCT
Canis_familiaris|22019         CATCTTCTAAAGAAAGCAGAGCTGTGGTTTGTTAACTCTGACTTTGCCCTTGAATTTGCT
Canis_familiaris|22015         AATCTTCTAAAGAAAGCAGAACTATGGTTTGTTAACTCTGACTTTGCATTTGATTTTGCT
Caenorhabditis_elegans|25270   GATCTAGTCAAACAGTCTCCAATTTATATCACAAACTCGAATCCATATTTGGACTATGCG
Caenorhabditis_elegans|14340   AATCTCGTTAGCGACATCACATGGTTCTTCGTCAACTCGGATCCGATCTTCGATTTCCCG
                                                                                           

Bombyx_mori|13385              CCTAAAACACCACAAAATTTCAAACAAGTTGGAGGCTTTCATATAAGT------------
Bombyx_mori|12014              ACGCGATTGCCGCAAAACTACAAACCCATTGGTGGATTCCACATCGAT------------
Gasterosteus_aculeatus|19940   CAGCCTCTCATGCCCTACACTGTCCTGGTGGGAGGTCTGCTG---AAT------------
Fugu_rubripes|4293             CAGCCTCTCCTACCCTTCACTGTGCTGGTGGGGGGGCTGCTG---AAC------------
Xenopus_tropicalis|2247        CATGCTTTTTTTCCATGTTCTGTACATTGG------------------------------
Xenopus_tropicalis|2244        CATGCTTTTTTTCCAAATGTTCTGTATATTGGAGGTGTATTG---GCA------------
Xenopus_tropicalis|1478        CATCCTTTTTTTCCAAATGTTCTGTACATTGGAGGCTTATTG---GCA------------
Xenopus_tropicalis|1473        CACCCCCTTCTTCCACATGTTCTGTATATTGGAGGTCTATTG---ACA------------
Dipodomys_ordii|7215           AGGCCCCTGTTTCCTAACACTGTTTATATTGGAGGCATCCTG---GAC------------
Anolis_carolinensis|9649       CGGCCTCTTCTTCCCAACACAGTGTATATTGGGGGCTTATTG---GCG------------
Ornithorhynchus_anatinus|12628 CAGCCTCTTCTTCCAAACACGGTTTATATTGGAGGCCTAATG---GCA------------
Echinops_telfairi|13652        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNN------------
Tupaia_belangeri|13132         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNN------------
Felis_catus|38352              AGGCCCCTGCTTCCCAACACTGTGTATGTTGGAGGCTTAATG---GCC------------
Bos_taurus|12730               CGGCCTCTGTTTCCAAACACTGTGAATGTTGGAGGCTTAATG---GTC------------
Tarsius_syrichta|7332          ------------------------------------------------------------
Dasypus_novemcinctus|14729     CGGCCCCTGCTTCCGAACACTGTTTATATCGGAGGCATAATG---GCC------------
Choloepus_hoffmanni|10632      CGGCCCCTGCTTCCCAACACTGTTTATATTGGAGGCTTAACG---GCC------------
Mus_musculus|13539             CGTCCCCTGTTTCCCAACACAGTCTATGTGGGAGGTTTACTG---GAC------------
Rattus_norvegicus|18092        CGTCCTCTGTTTCCCAATATTGTCTATGTGGGAGGCTTACTG---GAC------------
Pteropus_vampyrus|14496        CGGCCTCTGTTGCCCAACACTGTGTATATTGGAGGTTTAATG---GCC------------
Otolemur_garnettii|7502        CGGCCCCTACTTCCCAACACTGTCTATGTTGGAGGCTTAATG---GCC------------
Microcebus_murinus|7068        CGGCCCCTACTTCCCAACACCGTTTATGTTGGAGGCTTAATG---GCC------------
Microcebus_murinus|19157       CGGCCCCTACTTCCCAACACCATTTATGTTGGAGGCTTAATA---GCC------------
Tarsius_syrichta|4797          CGGCCTCTGCTTCCCAACACTGTTTATGTTGGAGGCTTAATG---GCC------------
Rhesus_macaque|31907           CGGCCCCTGCTTCCCAACACTGTTTATGTTGGAGGCTTGATG---GAA------------
Homo_sapiens|68741             CGGCCCCTGCTTCCCAACACTGTTTATATTGGAGGCTTGATG---GAA------------
Gorilla_gorilla|244            CGGCCCCTGCTTCCCAACACTGTTTATATTGGAGGCTTGATG---GAA------------
Pongo_abelii|21971             CGGCCCCTGCTTCCCAACACTGTTTATATTGGAGGCTTGATG---GAA------------
Pan_troglodytes|29695          CGGCCCCTGCTTCCCAACACTGTTTATATTGGAGGCTTGATG---GAA------------
Callithrix_jacchus|45121       CGGCCCCTGCTTCCCAACACTGTTTATGTTGGGGGCTTGATG---GAA------------
Rhesus_macaque|31909           CGACCTCTGCTTCCCAACACTGTTTATGTTGGAGGCTTGATG---GAA------------
Gorilla_gorilla|249            CGACCTCTGCTTCCCAACACTGTTTATGTTGGAGGCTTGATG---GAA------------
Homo_sapiens|68743             CGACCTCTGCTTCCCAACACTGTTTATGTTGGAGGCTTGATG---GAA------------
Pan_troglodytes|29694          CGACCTCTGCTTCCCAACACTGTTTATGTTGGAGGCTTGATG---GAA------------
Loxodonta_africana|24713       CGGCCCCTGCTTCCTAATACTGTTTATGTTGGAGGTTTAATG---GCC------------
Oryctolagus_cuniculus|2791     CGGCCCCTGAATCCCAACACTGTGTATATTGGAGGATTAATG---GTC------------
Ochotona_princeps|6294         CGGCCCCTGAATCCCAACACTGTTTATGTTGGAGGATTAATG---GTG------------
Tursiops_truncatus|8861        ------------------------------------------------------------
Bos_taurus|12729               CGGCCCCTGCTTCCCAACACTGTGTGTATTGGAGGTTTAATG---TCC------------
Equus_caballus|14193           CAGCCTCTGCTTCCCAACACTGTGTATGTTGGAGGCTTAATG---GCC------------
Equus_caballus|14192           CGGCCTCTGCTCCCCAACACTGTGTATGTTGGAGGCTTAATG---GCC------------
Equus_caballus|14190           CGGCCTCTGCTCCCCAACACTGTGTATGTTGGAGGCTTAATG---GCC------------
Canis_familiaris|22019         CGGCCCCTGCTCCCCAACACTGTGTATGTTGGAGGCTTAATG---GTC------------
Canis_familiaris|22015         CGCCCCCTGCTTCCCAACACTGTGTATGTTGGAGGCTTAATG---GCC------------
Caenorhabditis_elegans|25270   GTTCCTTCAACTGCAGCGATAGTTCAAGTTGGCGGGATTACAATGGATTTGAAAAAATTG
Caenorhabditis_elegans|14340   AAACCTCTTCCCCAAAATATCGTAGAAATCGCCGGGATTTCA---GTG------------
                                                                                           

Bombyx_mori|13385              AGTGTTGTGAAGCCTTTGGATAAG---GTGCTACAAAACATAATGGACTCCTCGAAAGAC
Bombyx_mori|12014              GAAGAGGTCAAACCTTTGCCAGAG---GTAAGAAAT------------------------
Gasterosteus_aculeatus|19940   AAGCCGGCGCAGCCTCCAGAGCAG---GACATTGAGTTGTGGATCTCCAATTTTGGAGAG
Fugu_rubripes|4293             CAGCCCGCCAAGCCTCCCGAACAG---GATCTTGAGTTGTGGATTTCCAGTTTTGGAGAT
Xenopus_tropicalis|2247        AGGTGTATTGGCAAAACCAGCAAA------------------------------------
Xenopus_tropicalis|2244        AAACCAGCAAAGCCTGTCTCACAG---GAATTGGAACACTTTATCTCTCAGTCAGGAGAG
Xenopus_tropicalis|1478        AAACCAGCAAATCCTGTCTCACAG---GAATTGGAAGATTTTATCTCCCAGTCAGGAGAG
Xenopus_tropicalis|1473        AAACCAGCAAAGCCTGTCTCACAG---GAATTGGAACATTTTATCTCTCAGTCAGGGGAG
Dipodomys_ordii|7215           AAACCTGTAATGCCAATACCACAA---GAATTGGAGAACTTCATTTCTAACTTT---AAT
Anolis_carolinensis|9649       AAACCCGCAAAACCCTTGCCACAG---GAGTTTGAAGACTTTATTGAAAGAACAGGGGAA
Ornithorhynchus_anatinus|12628 AAACCTGGCAAACCATTACCTCAG---GAATTTGAAGACTTCATAGCCAGCTCTGGAGAA
Echinops_telfairi|13652        NNNNNNNNNNNNNNNNNNNNNNNN---GACCTTGAGAATTTCATAGCCAAGTTTGGAGAC
Tupaia_belangeri|13132         NNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Felis_catus|38352              AGACCTGTAACACCAGTACCACAA---GAATTTGAGAATTTCATTGCTAAGTTTGGAGAC
Bos_taurus|12730               AAACCTATTAAACCAGTACCACAG---GCA------------------------------
Tarsius_syrichta|7332          ------------------AGCCGG---GACTTAGAGGACTTCATCGCCAAGTTTGGGGAC
Dasypus_novemcinctus|14729     AAAACTAGTAAACCAGTGTCGCAA---GATTTTGAGAACTTCATTGCCAAGTTTGGAGAC
Choloepus_hoffmanni|10632      AAAGCTACTAAACCAGTACCGCAA---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|13539             AAACCTGTTCAGCCAATACCCCAA---GACTTGGAGGATTTTATCTCTCAGTTTGGAGAC
Rattus_norvegicus|18092        AAACCTGTTCAGTCAATACCCCAA---GACTTGGAGAATTTTATCACTCAGTTTGGAGAC
Pteropus_vampyrus|14496        AAACCTACTAAAGCAGTACCACAA---GAATTTGAGACATTCATTGCCAAGTTTGGAGAC
Otolemur_garnettii|7502        AAACCTACTAAACCAGTACCACAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|7068        AAACCCACCAAACCAGTACCACAA---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Microcebus_murinus|19157       AAACCCACTAAACCAGTACCACAA---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Tarsius_syrichta|4797          AGACCTNNNNNNNNNNNNNNNNNN---GACTTGGAGGACTTCATTGCCAAGTTTGGGGAC
Rhesus_macaque|31907           AAACCTATTAAACCAGTACCACAA---GACTTGGAGAACTTCATTGCCAACTTTGGGGAT
Homo_sapiens|68741             AAACCTATTAAACCAGTACCACAA---GACTTGGACAACTTCATTGCCAACTTTGGGGAT
Gorilla_gorilla|244            AAACCTATTAAACCAGTACCACAA---GACTTGGAGAACTTCATTGCCAACTTTGGGGAT
Pongo_abelii|21971             AAACCTATTAAACCAGTACCACAA---GACTTGGAGAACTTCATTGCCAACTTTGGGGAT
Pan_troglodytes|29695          AAACCTATTAAACCAGTACCACAA---GACTTGGAGAACTTCATTGCCAACTTCGGGGAT
Callithrix_jacchus|45121       AAACCTATTAAACCAGTTCCGCAA---GACTTGGAGAACTTCATTGCCAAGTTTGGGGAC
Rhesus_macaque|31909           AAACCTATTAAACCAGTACCACAA---GACTTGGAGAACTTCATTGCCAAGTTTGGGGAC
Gorilla_gorilla|249            AAACCTATTAAACCAGTACCACAA---GACTTGGAGAACTTCATTGCCAAGTTTGGGGAC
Homo_sapiens|68743             AAACCTATTAAACCAGTACCACAA---GACTTGGAGAACTTCATTGCCAAGTTTGGGGAC
Pan_troglodytes|29694          AAACCTATTAAACCAGTACCACAA---GACTTGGAGAACTTCATTGCCAAGTTTGGGGAC
Loxodonta_africana|24713       AAGCCCATTAAGCCAGTACCACAA---GACCTTGAGAACTTCATAGCCAAGTTTGGAGAC
Oryctolagus_cuniculus|2791     AAACCCATTAAGCCAGTATCACAA---GACTTAGAGAACTTCATTGCTAAGTATGGGGAC
Ochotona_princeps|6294         AAACCTATTAAGCCAATACCACAA---GACTTGGAGAACTTCATCGCTAAGTTTGGGGAC
Tursiops_truncatus|8861        ------------------------------------------------------------
Bos_taurus|12729               AAACCTGTTAAACCAGTATCACAA---GAATTTGAGAATTTCATCACCAAATTTGGAGAC
Equus_caballus|14193           AAACCTGTTAAAGCAGTACCACAG------------------------------------
Equus_caballus|14192           AAACCTGTTAAAGCAGTACCACCA---GAATTTGAGAATTTCATTGCCAAGTTTGGAGAC
Equus_caballus|14190           AAACCTGTTAAGGCAGTACCTCAA---GAATTTGAGAATTTCATTGCCAAGTTTGGAGAC
Canis_familiaris|22019         AGACCTGTTAAACCAGTGCCACAA---GAATTTGAGAATTTCATTGCCAAGTTTGGAGAC
Canis_familiaris|22015         AGACCTGTTAAACCAGTGCCACAA---GAATTTGAGAATTTCATCGCCAAATTTGGAGAC
Caenorhabditis_elegans|25270   AAGCAAGTAGGGGAACTACCAGAG---GAATATGAGAATATCTTGAAGGAGAGGGAATCT
Caenorhabditis_elegans|14340   CCAGAAATCAAGCCAGTTGGCAAG---GAGTGGGATGAAATTTTGAGCAAACGATCGAAA
                                                                                           

Bombyx_mori|13385              ---GGAGTTGTCTACTTCAGTATGGGATCGGCCTGGCAAAGCAAAGACATA---CCGGAG
Bombyx_mori|12014              ---------------------------------------------------------AGT
Gasterosteus_aculeatus|19940   GCCGGTTTCGTTGTCGTGACTCTGGGATCGATGGTCTCTTCGGTCTCTGTG------GAC
Fugu_rubripes|4293             GCAGGTTTTATTATTGTGACTCTGGGGTCAATGGTGTCGTCCATCTCTGTG------GAC
Xenopus_tropicalis|2247        ------GCCTGTCTCACAGGAATTGGAGCACTTTATCTCTCAGTCAGGAGA---------
Xenopus_tropicalis|2244        CATGGATTTATCCTTGTGACATTTGGCTCCATGATACCATCCAATCCACTC------ACT
Xenopus_tropicalis|1478        CACGGGTTTATCATTGTGGCATTTGGCTCGATGGTATCTTCCAGTCCTTTC------ACT
Xenopus_tropicalis|1473        CACGGGTTTATCATTGTGGCATTTGGCTCCATGATGGCGTCCTCTCCTTAC------ACT
Dipodomys_ordii|7215           TCTGTTTTTGTTCTTGTGTCCCTGGGCTCAATACTGAACTGGTTTCAGAGC------CAA
Anolis_carolinensis|9649       GCAGGTTTCATCATTGTGACCCTGGGGTCTATGCTATCATCAATCCCATTT------CCA
Ornithorhynchus_anatinus|12628 GCTGGCTTCATCCTTGTGACCCTGGGTTCCATGGTTGCTTCTTTCCGGGTC------TTG
Echinops_telfairi|13652        TCTGGTTTTATCCTTGTGACCCTGGGCTCCATGCTACATAACTATCAGATC------CAG
Tupaia_belangeri|13132         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNN
Felis_catus|38352              TCTGGTTTTGTCCTTGTGGCCCTGGGCTCCATGGTGAGCACCTTTCAATCC------CAG
Bos_taurus|12730               ------------------------------------------------------------
Tarsius_syrichta|7332          TCTGGTTTTGTTCTTGTGGCCCTGGGCTCCTCGGTGAACCTCTATCAGACT------CAG
Dasypus_novemcinctus|14729     TCTGGTTTTGTGCTTGTGGCTCTGGGCTCCATGTCAAGCACTTACCAGTCC------CAG
Choloepus_hoffmanni|10632      NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNN
Mus_musculus|13539             TCAGGTTTTGTCCTTGTGGCCCTGGGCTCTGTAGTGAGCATGATTCAGTCC------AAG
Rattus_norvegicus|18092        TCAGGTTTTGTCCTTGTGGCCCTGGGCACCGTAGCGACCAAGTTTCAGACC------AAG
Pteropus_vampyrus|14496        TCCGGTTTTGTCCTTGTGGTCCTGGGCTCCATGGTGGACAGTTTTCAGTCC------CAG
Otolemur_garnettii|7502        NNNNNNNNNGCGCTGGTGACTATGGGCTCCAAGGTGAACATCCACTTC---------AAG
Microcebus_murinus|7068        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTACAG
Microcebus_murinus|19157       NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNN
Tarsius_syrichta|4797          TCTGGTTTTGTTCTTGTGGCCCTGGGTTCCATAGTGAGCCTCTATCAGATT------CAG
Rhesus_macaque|31907           GCTGGGTTTGTCCTTGTGGCCTTTGGCTCTACATTGAACACCCAGCAGTCC------CAG
Homo_sapiens|68741             GCAGGGTTTGTCCTTGTGGCCTTTGGCTCCATGTTGAACACCCATCAGTCC------CAG
Gorilla_gorilla|244            GCAGGGTTTGTCCTTGTGGCCTTTGGCTCCGTGTTGAACACCCATCAGTCC------CAG
Pongo_abelii|21971             GCTGGGTTTGTCCTTGTGGCCTTTGGCTCCACGTTGAACACCCATCAGTCC------CAG
Pan_troglodytes|29695          GCTGGGTTTGTCCTTGTGGCCTTTGGCTCCACATTGAACACCCATCAGTCC------CAG
Callithrix_jacchus|45121       TCTGGTTTTGTCCTTGTGACCTTGGGCTCCATGGTGAACACCTGTCAGAAT------CGG
Rhesus_macaque|31909           TCTGGTTTTGTCCTCGTGACCTTGGGCTCCATGGTGAACACCTGTCAGAAT------CCG
Gorilla_gorilla|249            TCTGGCTTTGTCCTTGTGACCTTGGGCTCCATGGTGAACACCTGTCAGAAT------CCG
Homo_sapiens|68743             TCTGGTTTTGTCCTTGTGACCTTGGGCTCCATGGTGAACACCTGTCAGAAT------CCG
Pan_troglodytes|29694          TCTGGTTTTGTCCTTGTGACCTTGGGCTCCATGGTGAACACCTGTCAGTAT------CCG
Loxodonta_africana|24713       TCTGGTTTTATCCTTGTGTCCATGGGCTCCATGTTAAGTACCTATCAGACC------CAG
Oryctolagus_cuniculus|2791     TCTGGTTTTGTCCTTGTGGCCCTTGGTTCCATGGTGAGCACCTACCAGACC------TGG
Ochotona_princeps|6294         TCGGGTTTCATTCTTGTGGCCCTTGGGTCCATGGTGAGCACCTATGAGACC------CAG
Tursiops_truncatus|8861        ------------------------------------------------------------
Bos_taurus|12729               TCTGGTTTTGTCCTTGTAAGCCTGGGGTCCATGGTGAGTTTCATTCGGTCC------CAG
Equus_caballus|14193           ------------------------------------------------------------
Equus_caballus|14192           TCTGGTTTCATCCTTGTGGCCCTGGGCTCTGTGGTGAACATCTTTCAGTCC------CAG
Equus_caballus|14190           TCTGGTTTTGTTCTTGTGGCCCTGGGCTCCATGATCAGTGGCTCTTCATCC------CAA
Canis_familiaris|22019         TCTGGTTTTGTCCTTGTGGCTCTGGGCTCCCTGGTCAATCTCTATCAGTCC------CAG
Canis_familiaris|22015         TCTGGTTTTGTTCTTGTAGCCCTGGGCTCCATGGTGAGCACCGTTCAAACT------CAG
Caenorhabditis_elegans|25270   ACA------GTTCTTATATCGTTTGGATCTGTGATTAGATCATATGAAATG---CCTGAA
Caenorhabditis_elegans|14340   AAT------GTGCTCGTTTCATTTGGATCTATAGCTTCACCTACTACGATG---CCTGAA
                                                                                           

Bombyx_mori|13385              CACATCGTGAATGAATTGCTCAAAGTATTCGGGAATCTTAAACAA---ACGGTTATATGG
Bombyx_mori|12014              GAAACAGAGATTCAGAATCACAATGGGGCAGCT---------------------------
Gasterosteus_aculeatus|19940   TCCCTGCTTGTAGAGCTGGTGGCGGGCTTCTCTAGGATCCCTCAG---GGGGTAATCTGG
Fugu_rubripes|4293             CCTCTGCTGACAGAGCTGGTGGCTGGATTCTCTCAAGTCCCACAG---GGTGTACTATGG
Xenopus_tropicalis|2247        ------------------------------------------------------GCATGG
Xenopus_tropicalis|2244        GAGTTTGTGAAGGAAATGAACGACGGTTTTGCAAAAATCCCGCAA---AAAGTCATCTGG
Xenopus_tropicalis|1478        GAGTTTGTGAAGGAAATGAACGACGGTTTCGCAAAAATCCCACAA---AAAGTCATCTGG
Xenopus_tropicalis|1473        GAGTTTGTGAAGGAAATGAACGACGGTTTTGCAAAAATCCCGCAA---AAAGTCATCTGG
Dipodomys_ordii|7215           ACATTACTGGAGGAGATGAACAACACCTTGGCCCTTCTTCCTCAA---GGGTTGATATGG
Anolis_carolinensis|9649       CATCTACTAAAAGAGATCAATAATGGCTTCGCACAACTTCCCCAA---GGTGTCCTTTGG
Ornithorhynchus_anatinus|12628 GAAGTCATGAAGGAGATGAACGCTGGGTTTGCGCTCCTTCCCCAG---GCGGTCATTTGG
Echinops_telfairi|13652        GATATCCTCAAGGAGATGAACAAGGCCTTTGCTCATCGTCCTCAA---GGAGTGATATGG
Tupaia_belangeri|13132         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNN
Felis_catus|38352              GAACTTCTCAGGGAGATGAACAGTGCCTTTGCTCATCTCTCTCAA---GGAGTCATATGG
Bos_taurus|12730               ---------GAAGGAGAAGAGGCTGTTTATACT---------------------------
Tarsius_syrichta|7332          GAAATTCTCAAGGAAATGAACAGTGCCTTTTCCCACCTTCCCCAA---GGGGTCATATGG
Dasypus_novemcinctus|14729     GAGATTCTC---GAGATGAACAGTGCTTTTGCTCNNNNNNNNNNN---NNNNNNNNNNNN
Choloepus_hoffmanni|10632      NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNN
Mus_musculus|13539             GAAATTATTAAGGAGATGAACAGTGCCTTTGCTCACCTCCCTCAA---GGGGTGCTATGG
Rattus_norvegicus|18092        GAAATTATTAAGGAGATGAACAACGCCTTTGCTCACCTCCCTCAG---GGGGTGATATGG
Pteropus_vampyrus|14496        AATGTTCTTAAGGAGATGAACAGTGCCTTTGCTCATCTCCCTCAA---GGAGTGATATGG
Otolemur_garnettii|7502        GAAGTCCTTAAGGAGCTGAACCGTGCCTTTCCCCACCTTCCCCAA---GGGGTGATATGG
Microcebus_murinus|7068        GAAGTCCTTAAGGAGATGAACAGTGCCTTTGCCCACCTCCGCCAA---GGGGTGATATGG
Microcebus_murinus|19157       NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNNATGG
Tarsius_syrichta|4797          AAAATTCTCAAGGAAATGGACAGTGCCTTTGCCCACCTTCCACAA---GGGGTCATATGG
Rhesus_macaque|31907           GAAGTCCTCAAGAAGATGCACAGTGCCTTTTCCCACCTCCCTCAA---GGAGTGATATGG
Homo_sapiens|68741             GAAGTCCTCAAGAAGATGCACAATGCCTTTGCCCACCTCCCTCAA---GGAGTGATATGG
Gorilla_gorilla|244            GAAGACCTCAAGAAGATGCACAGTGCCTTTGCCCACCTCCCTCAA---GGAGTGATATGG
Pongo_abelii|21971             GAAGACCTCAAGAAGATGCACAGTGCCTTTGCCCACCTCCCTCAA---GGAGTGATATGG
Pan_troglodytes|29695          GAAGACCTCAAGAAGATGCACAGTGCCTTTGCCCACCTCCCTCAA---GGGGTGATATGG
Callithrix_jacchus|45121       GAAATCTTCGAGGAGATGAACAATGCCTTTGCCCACCTATCCCAA---GGGGTGATATGG
Rhesus_macaque|31909           GAAATCTTCAAGGAGATGAACAATGCCTTTGCCTACCTACCCCAA---GGGGTGATATGG
Gorilla_gorilla|249            GAAATCTTCAAGGAGATGAACAATGCCTTTGCCCACCTACCCCAA---GGGGTGATATGG
Homo_sapiens|68743             GAAATCTTCAAGGAGATGAACAATGCCTTTGCTCACCTACCCCAA---GGGGTGATATGG
Pan_troglodytes|29694          GAAATCTTCAAGGAGATGAACAATGCCTTTGCCCACCTACCCCAA---GGGGTGATATGG
Loxodonta_africana|24713       GAGATTATCAAGGAGATGAACAGTGCCTTTGCTCACCTTCCCCAA---GGAGTAATATGG
Oryctolagus_cuniculus|2791     GAAGTCCTCCAGGAGATGAACAGTGCCTTTGCCCAGCTCTCACAA---GGGGTAATATGG
Ochotona_princeps|6294         GAAATACTCAAGGAAATGAACAGTGCCTTTGCCCAGCTCTCACAA---GGGGTAATATGG
Tursiops_truncatus|8861        ------------------------------------------------------------
Bos_taurus|12729               GAGGTTCTCAAAGAGATGAATGCTGCCTTTGCTCATCTCCCTCAA---GGGGTGATATGG
Equus_caballus|14193           ------------------------------------------------------------
Equus_caballus|14192           TATGTTTTCAAGGAGATGAACAGGGCCTTTGCTCATCTACCTCAA---GGGGTGATATGG
Equus_caballus|14190           GAATTTCTCAAGGAGATGAACACTGCCTTTGCTCATCTCCCTCAA---GGGGTCTTATGG
Canis_familiaris|22019         GAAGTCCTCAGGGAGATGAACGATGCCTTTGCTCATCTGTCTCAA---GGGGTGATATGG
Canis_familiaris|22015         GAACTTCTCAGAGAGATGAATGGTGCCTTTGCTAATCTCTCGCAA---GGGGTTATATGG
Caenorhabditis_elegans|25270   AGTTTTAAAGCAGGACTTATCAAGGTGTTCGAATCACTCCCAGATGTCACATTTATCTGG
Caenorhabditis_elegans|14340   GCCGTCAAAAAATCGATTGTAGACGCGTTTGCGGCGTTCCCCGATGTTACATTCATCTGG
                                                                                           

Bombyx_mori|13385              AAATTTGAAAAAAATCTG------------AACGATTTACCAAAGAATGTTCACATTGTT
Bombyx_mori|12014              ------------------------------------------------------------
Gasterosteus_aculeatus|19940   AGGTATGACCCAGAGCGATGGCCGTCTCACCTGGACAGACCTCCCAACCTGAGGCTGATG
Fugu_rubripes|4293             CGGTATGATCCTCAGCGATGGCCGTCGCATCTGGACAGACCTTCAAATCTCAGACTGGTG
Xenopus_tropicalis|2247        GTTTATCCTTGTGACATTTGGCTCCATGATACCATCCAATCCACTCAC------------
Xenopus_tropicalis|2244        AGATACCGAATATCAGAGTGGCCGAAAGAACTACAGTTGGCCCCAAATGTGAAAATAATG
Xenopus_tropicalis|1478        AGATACCGAATATCAGAGTGGCCGAAAGAAGTGCAGTTGGCCCCAAATGTGAAAATAATG
Xenopus_tropicalis|1473        AGATACCGAATATCAGAGTGGCCGAAAGAACTACAGTTGGCCCCAAATGTGAAAATAATG
Dipodomys_ordii|7215           AACTGT---AGTTCTCTTTGGCCCAACAATTTCAAATTGGCTACAAATGTCAAAATCATG
Anolis_carolinensis|9649       AGGTATCAGGCCTCTCGCTGGCCAAAGGAGATTAAGCTGGCTCCAAATGTGAAACTTGCA
Ornithorhynchus_anatinus|12628 AGATTCCAGCTTTCCCAATGGCCTAAAGAGGTTCCGTTGGCCACCAACGTGAAGATTGTG
Echinops_telfairi|13652        AGATACAAGACTTCGGAGTGGCCCAAAGATGTGCAATTGGCAGCAAATGTGAAACTTGTG
Tupaia_belangeri|13132         NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Felis_catus|38352              AAGTATAAGCCATCTCACTGGCCCAAAGACGTCAAATTGGCAGCAAATGTGAAAATCGTG
Bos_taurus|12730               ------------------------------------------------------------
Tarsius_syrichta|7332          AATTGTCAGCATTCTCAT---CCCAATGATGTCAACTTGTCTGCAAATGTGAAAATCATG
Dasypus_novemcinctus|14729     NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Choloepus_hoffmanni|10632      NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Mus_musculus|13539             ACATGTAAGAGTTCTCATTGGCCCAAAGATGTCAGTTTGGCCCCAAATGTCAAAATCATG
Rattus_norvegicus|18092        GCATGTAAGGACTCTCATTGGCCTAAAGATGTCACATTGGCCCCAAATGTCAAAATCATG
Pteropus_vampyrus|14496        AGGTATAAATCTTCTCATTGGCCCAAAGACATCAAATTGTCAGCAAATGTGAAAATGGTG
Otolemur_garnettii|7502        AGGTGTAAGCATTCCCATTGGCCCAAAGATGTCAACGTGGCCCCAAATGTGAAACTCATG
Microcebus_murinus|7068        AAGTGTAAGCATTCTCACTGGCCCAAAGATGTCAACGTGTCCACAAATGTGAAACTCATG
Microcebus_murinus|19157       AAGTGTAAGCATTCTCACTGGCCCAAAGATGCCAACGTGTCCACAAATGTGAAACTAATG
Tarsius_syrichta|4797          AATTGCCAGAATTCTCTTTGGCCTAATGATGTCAACTTGTCCTTAAACGTGATAATCAAT
Rhesus_macaque|31907           AAATGTCAGAGTTCTCATTGGCCCAAAGATGTTCATTTAGCCACAAATGTGAAAATCGTG
Homo_sapiens|68741             ACATGTCAGAGTTCTCATTGGCCCAGAGATGTTCATTTGGCCACAAATGTGAAAATTGTG
Gorilla_gorilla|244            ACATGTCAGAGTTCTCATTGGCCCAGAGATGTTCATTTGGCCACAAATGTGAAAATCGTG
Pongo_abelii|21971             AAATGTCAGAGTTCTCATTGGCCCAAAGATGTTCATTTGGCCACAAATGTGAAAATCGTG
Pan_troglodytes|29695          AAATGTCAGAGTTCTCATTGGCCCAAAGATGTTCATTTGGCCACAAATGTGAAAATCGTG
Callithrix_jacchus|45121       AAGTGTCAGTATTCTCATTTGCCCAAAGATGTCCACCTGGCTGCAAATGTGAAAATTGTG
Rhesus_macaque|31909           AAGTGCCAGTGTTCTCATTGGCCCAAAGAAGTCCAGCTGGCTGCAAATGTGAAAATTGTG
Gorilla_gorilla|249            AAGTGTCAGTGTTCTCATTGGCCTGAAGATGTCCACCTGGCTGCAAATGTGAAAATTGTG
Homo_sapiens|68743             AAGTGTCAGTGTTCTCATTGGCCCAAAGATGTCCACCTGGCTGCAAATGTGAAAATTGTG
Pan_troglodytes|29694          AAGTGTCAGTGTTCTCATTGGCCCAAAGATGTCCACCTGGCTGCAAATGTGAAAATTGTG
Loxodonta_africana|24713       AGATACAAGCATTCACATTGGCCCAAAGATGTGCAATTGGCAGCAAATGTGAAAATTGTG
Oryctolagus_cuniculus|2791     AAGTGTAAGCATTCTCACTGGACCAAAGGTGTCAAGTTGGCTGAAAATGTGAAAATTATG
Ochotona_princeps|6294         AAATGTAAGCATTCACATTGGAACAAAGATGTCAAGTGGGCTCCCAATGTGAAAGTCATG
Tursiops_truncatus|8861        ------------------------------------------------------------
Bos_taurus|12729               AAGTATAATCCTTCTCATTGGCCCAAAGACATCAAATTGGCCCCAAATGTGAAAATTGTG
Equus_caballus|14193           ------------------------------------------------------------
Equus_caballus|14192           AAGTGTAATCCTTCTCATTGGCCTGAAGACATCAAATTGGCAGAAAATGTGAAAATTGTG
Equus_caballus|14190           AGGTGTAAGCCTTCTCATTGGCCCAAAGACATCAAATTAGCAGCAAATGTGAAAATTGTG
Canis_familiaris|22019         AAGTGCAATCCTTCTCATTGGCCCAAAGATGTCAAATTGGCAGCAAATGTGAAGATTGTG
Canis_familiaris|22015         AAGTGTAATCCT---TATTGGCCCAAAGAGATCAAATTGGCAGCAAATGTGAAAATTGTG
Caenorhabditis_elegans|25270   AAATATGAGAAAGATGACCTGGAATTCCAGAAGAGGCTCCCAAAGAATGTTCATTTAAAG
Caenorhabditis_elegans|14340   AAATACGACGATACGGAATCAAAGTTGACCGCCCATCTTGAT---AATGTTCATATTGTC
                                                                                           

Bombyx_mori|13385              CAGTGGGCACCACAAACAAGCATTTTAGCTCATCCAAATTGCCTCCTATTTATATCGCAT
Bombyx_mori|12014              ------------------------------CATCCAAATTGCGTGCTTTTCATCACACAC
Gasterosteus_aculeatus|19940   GACTGGTTGCCTCTCAATGATCTGCTGGGCCACAAAAAGGTGCGTGTCTTTGTCACCCAC
Fugu_rubripes|4293             GACTGGCTGCCTCTTAATGACTTGCTGGGCCACACAAAAGCGCGTCTCTTCATCACCCAC
Xenopus_tropicalis|2247        ------------------------------------------------------------
Xenopus_tropicalis|2244        AATTGGATTCCTCAGAATGATCTCCTGGGACACCCCAAGGCTCGTCTTCTGGTCACTCAT
Xenopus_tropicalis|1478        GATTGGATTTCTCAGAATGATCTCCTGGGACACCCCAAGGCTCGTCTTCTGGTCACTCAC
Xenopus_tropicalis|1473        AATTGGATTCCTCAGAATGATCTCCTGGGACACCCCAAGGCTCATCTTCTGGTCACTCAC
Dipodomys_ordii|7215           GATTGGATTCCGCAGAATGACCTCTTGGCACACCCTAGCATCCGTGTGTTTGTTACACAT
Anolis_carolinensis|9649       GAATGGCTTCCTCAGAATGACTTGCTAGGACACCCAAAGGTTCAGCTCTTCGTCACTCAC
Ornithorhynchus_anatinus|12628 GAGTGGCTCCCCCAGAATGATCTACTAGCTCATCCAAAGGCCAAACTTCTCGTGACTCAC
Echinops_telfairi|13652        GACTGGCTTCCCCAGAGCGACCTCCTGGCTCATCCTAGCATCCGTCTTTTTGTCACCCAC
Tupaia_belangeri|13132         NNNNNNNNNNNNNNNNNNNNNNNNNNNNCTCACTCTAGCATCCGTCTTTTTGTTACTCAT
Felis_catus|38352              GACTGGCTTCCTCAGAATGACCTCCTGGCTCACCCACGCATCCGTCTTTTTGTCACCCAT
Bos_taurus|12730               ---------------ACAGATCCCATATGTCACAGCAGTGTACAC---------------
Tarsius_syrichta|7332          GACTGGTTTCCTCAGTCTGACCTCCTGGCTCACCCCAACATACATCTTTTTGTCACCCAC
Dasypus_novemcinctus|14729     NNNNNNNNNNNNNNNNNNNNNNNNNNNNCTCACCCTAGCATCCGTCTTTTTGTCACCCAT
Choloepus_hoffmanni|10632      NNNNNNNNNNNNNNNNNNNNNNNNNNNNCTCACCCCAGCATCCGTCTTTTTGTCACCCAT
Mus_musculus|13539             GATTGGCTTCCACAGATTGACCTTCTAGCTCACCCTAGCATTCGTCTGTTTGTCACCCAT
Rattus_norvegicus|18092        GATTGGCTTCCACAAACTGACCTTCTGGCTCACCCTAGCATTCGTCTGTTTGTCACCCAT
Pteropus_vampyrus|14496        GACTGGCTTCCTCAGAATGACCTCCTGGCTCACCCTCGCATCCGTCTTTTTGTCACCCAT
Otolemur_garnettii|7502        GAGTGGCTTCCTCAGAGTGACCTCCTGGCT------------------------------
Microcebus_murinus|7068        GACTGGCTTCCTCAGAGTGACCTCCTGGCTCACCCCAGCATCCGTCTGTTTGTCACCCAT
Microcebus_murinus|19157       GACTGGCTTCCTCAGAGAGACCTCCTGGCTCACCCCAGCATCCGTCTGTTGGTCACCCAT
Tarsius_syrichta|4797          GACTTGCTTTCTCAGACTGACCTCCTGGCTCACCCCAGAATTTGGCTTTTTGTCATCCAT
Rhesus_macaque|31907           GACTGGCTTCCTCAGAGTGACCTCCTGGCTCACCCCAGCATCCGTCTTTTTGTCACTCAT
Homo_sapiens|68741             GACTGGCTTCCTCAGAGTGACCTCCTGGCTCACCCCAGCATCCGTCTTTTTGTCACTCAT
Gorilla_gorilla|244            GACTGGCTTCCTCAGAGTGACCTCCTGGCTCACCCCAGCATCCGTCTTTTTGTCACTCAT
Pongo_abelii|21971             GATTGGCTTCCTCAGAGTGACCTCCTGGCTCACCCCAGCATCTGTCTTTTTGTCACTCAT
Pan_troglodytes|29695          GACTGGCTTCCTCAGAGTGACCTCCTGGCTCACCCCAGCATCCGTCTTTTTGTCACTCAT
Callithrix_jacchus|45121       GACTGGCTTCCTCAGAGTGACCTCCTGGCTCACCCCAGCATCCGTCTATTTGTCACTCAT
Rhesus_macaque|31909           GACTGGCTTCCTCAGAGTGACCTCCTGGCTCACCCCAGCATCCGTCTGTTTGTCACCCAT
Gorilla_gorilla|249            GACTGGCTTCCTCAGAGTGACCTCCTGGCTCACCCAAGCATCCGTCTGTTTGTCACCCAC
Homo_sapiens|68743             GACTGGCTTCCTCAGAGTGACCTCCTGGCTCACCCAAGCATCCGTCTGTTTGTCACCCAC
Pan_troglodytes|29694          GACTGGCTTCCTCAGAGTGACCTCCTGGCTCACCCAAGCATCCGTCTGTTTGTCACCCAC
Loxodonta_africana|24713       GACTGGCTTCCTCAGAGTGACCTCCTGGCACATTCTAGCATTCGTCTTTTTGTCACCCAT
Oryctolagus_cuniculus|2791     GACTGGCTTCCTCAGAATGACCTCCTAGCTCACCCTAACATTCGTCTGTTTGTCACTCAT
Ochotona_princeps|6294         GATTGGCTTCCTCAGAGTGACCTCCTAGCTCACCCTAGCATCCGTCTGTTTGTCACTCAT
Tursiops_truncatus|8861        ---------------------------TCCCACCCTCACGTCCACCTTTTTGTCACTCAT
Bos_taurus|12729               CACTGGCTTCCTCAGAATGACCTTCTGGGGCACCCTCGCATCCGCCTCTTTGTCAGCCAT
Equus_caballus|14193           ------------------------------------------------------------
Equus_caballus|14192           GACTGGCTTCCTCAGAGTGACCTCCTGGCTCACCCTCGCATCCGTCTCTTTGTCACCCAT
Equus_caballus|14190           GACTGGCTTCCTCAGAGTGACCTCTTGGCTCACCCTCACATCCGTCTCTTTGTCACCCAT
Canis_familiaris|22019         GACTGGCTTCCCCAGAATGACCTCTTGGCTCACCCACGCATCCGTCTTTTTGTCACCCAT
Canis_familiaris|22015         AACTGGCTTCCTCAGAATGACCTCCTGGCTCACCCACACATCCGTCTTTTTGTCACCCAT
Caenorhabditis_elegans|25270   AAATGGATTCCACAGCCTTCTTTGCTTGCTGACAAACGGGTAAAACTTTTTATTACTCAT
Caenorhabditis_elegans|14340   AAGTGGATGCCACAGAATGATCTTTTGGCCGACAAACGAATCTCAATGTTCTGGACACAT
                                                                                           

Bombyx_mori|13385              GGTGGACTTCTATCATCAACAGAAGCTATACATTTCGGGGTGCCCATTATAGGGATACCT
Bombyx_mori|12014              GGTGGATTGCTCTCGACGATTGAGAGTATTCATTTTGGTGTACCAATTATCGCAATTCCT
Gasterosteus_aculeatus|19940   GGTGGACAAAACAGCCTGTTCCAGGCAGTGTATCACGCTGTTCCTGTGCTGGGAATCCCT
Fugu_rubripes|4293             GGTGGACAAAACAGCCTCCTGCAGGCGGTGTACCATGCTGTTCCAGTGCTGGCAATCCCT
Xenopus_tropicalis|2247        ------------------------------------------------------------
Xenopus_tropicalis|2244        GGAGGGGTAAACAGCGTGCAGGAAGCTATCTATCACGGGGTACCTATGGTGGCAATACCC
Xenopus_tropicalis|1478        GGAGGGATAAACAGTGTGCAGGAAGCTATCTATCACGGGGTACCTATGGTGGCAATACCA
Xenopus_tropicalis|1473        GGAGGGATAAACAGCGTGCAGGAAGCTATCTATCACGGGGTACCTATGGTGGCAATACCC
Dipodomys_ordii|7215           GGTGGAATAAACAGTATTAATGAGGCTATCCAGCATGGCGTACCCATGGTGGGAATTCCA
Anolis_carolinensis|9649       GGAGGGCTCAACAGTTTGATGGAAGCCGTTTACCATGGTGTTCCAGTAGTAGGGATCCCT
Ornithorhynchus_anatinus|12628 GGTGGGATCAACAGCGTGATGGAGGCCATCCACCACGGGGTCCCCATGGTGGGCATCCCG
Echinops_telfairi|13652        GGTGGACAGAATAGCATCATGGAAGCCATCCAACACGGTGTGCCCGTGGTGGGGATTCCA
Tupaia_belangeri|13132         GGTGGACAGAATAGCATCATGGAGGCCATTCAGCATGGTGTGCCTATGGTGGGGATTCCT
Felis_catus|38352              GGTGGAATGAATAGCATCATGGAGGCCATCCAACATGGCGTGCCCATGGTGGGGATTCCC
Bos_taurus|12730               ------------------------------------------CCCTCTCCCTGCTTACCA
Tarsius_syrichta|7332          GGCGGGCAGAACAGCATCATGGAGACCATCCAGTATGGTGTGCCCATAGTGGGAATACCA
Dasypus_novemcinctus|14729     GGTGGGCAGAATAGCATAATGGAGGCCATCCAATATGGCGTGCCCATGGTGGGGATTCCT
Choloepus_hoffmanni|10632      GGTGGGCAGAATAGCATATTGGAGGCCATCCAACATGGCGTGCCCATGGTGGGGATTCCC
Mus_musculus|13539             GGGGGGATGAACAGTGTAATGGAGGCTGTCCATCATGGAGTACCAATGGTAGGGATTCCA
Rattus_norvegicus|18092        GGGGGAATGAACAGTGTAAATGAGGCCATCCAGCACGGTGTACCCATGGTGGGGATTCTA
Pteropus_vampyrus|14496        GGAGGGTTGAATAGCATAATGGAGGCCATCCAGCATGCTGTGCCCATAGTGGGGCTCCCC
Otolemur_garnettii|7502        ------------------------------------------------------------
Microcebus_murinus|7068        GGCGGGCAAAATAGTATCATGGAGGCCATCCGGCATGGGGTGCCCATGGTGGGCATCCCT
Microcebus_murinus|19157       GGCGGGCAGAACAGCATCATGGAGGCCATCCAGCATGGGGTGCCCATGGTGGGCATCCCT
Tarsius_syrichta|4797          GGTGGGCAGAATAGCCTCATGGAGGCCATCCAGTACGGTGTGCCCTTTGTGGGAATCCCT
Rhesus_macaque|31907           GGCGGGCAGAACAGCGTAATGGAGGCCATCCGGCATGGTGTGCCCATGGTGGGATTGCCA
Homo_sapiens|68741             GGTGGGCAGAACAGCGTAATGGAGGCCATCCGTCATGGTGTGCCCATGGTGGGATTACCA
Gorilla_gorilla|244            GGTGGGCAGAACAGCGTAATGGAGGCCATCCGTCATGGTGTGCCCATGGTGGGATTACCA
Pongo_abelii|21971             GGTGGGCAGAACAGCGTAATGGAGGCCATCCGGCATGGTGTGCCCATGGTGGGATTACCA
Pan_troglodytes|29695          GGTGGGCAGAACAGTGTAATGGAGGCCATCCGGCATGGTGTGCCCATGGTGGGATTACCA
Callithrix_jacchus|45121       GGTGGGCAGAATAGCATAATGGAGGCCATCCAGCATGGTGTGCCCATGGTGGGGATCCCT
Rhesus_macaque|31909           GGCGGGCAGAATAGCATAATGGAGGCCATTCAGCATGGTGTGCCCATGGTGGGGATCCCT
Gorilla_gorilla|249            GGTGGGCAGAATAGCATAATGGAGGCCATCCAGCATGGTGTGCCCGTGGTGGGGATCCCT
Homo_sapiens|68743             GGCGGGCAGAATAGCATAATGGAGGCCATCCAGCATGGTGTGCCCATGGTGGGGATCCCT
Pan_troglodytes|29694          GGCGGGCAGAATAGCATAATGGAGGCCATCCAGCATGGTGTGCCCATGGTGGGGATCCCT
Loxodonta_africana|24713       GGCGGGCAGAATAGCATAATGGAGGCTATCCAACACGGTGTGCCCATGGTGGGGATTCCA
Oryctolagus_cuniculus|2791     GGAGGGCAGAACAGCATAATGGAGGCCATCCAGTATGGCGTGCCCATGGTGGGGATTCCT
Ochotona_princeps|6294         GGTGGGCAGAACAGCATCATGGAGGCCATCCAGCACGGTGTGCACATGGTGGGGATTCCT
Tursiops_truncatus|8861        GGTGGGATAAATAGTGTCATGGAGGCCATCCAACATGGCCTGCCCATGGTGGAGATTCCC
Bos_taurus|12729               GGTGGGATGAATAGTATCATGGAGGCCATCCAACATGGTGTGCCCATGGTGGGGATTCCC
Equus_caballus|14193           ------------------------------------------------------------
Equus_caballus|14192           GGTGGGATAAATAGCATCATGGAAGCCATCCAACATGGTGTGCCCATGGTGGGGATTCCC
Equus_caballus|14190           GGTGGGATAAATAGCATCATGGAGGCCATCCAACATGGCGTTCCCATGGTGGGGATTCCC
Canis_familiaris|22019         GGTGGGATGAATAGCATAATGGAAGCCATCCAACATGGTGTGCCCATGGTAGGGATTCCT
Canis_familiaris|22015         GGTGGGATGAATAGCATAATGGAGGCCATCCAACATGGTGTGCCCATGGTGGGGATTCCC
Caenorhabditis_elegans|25270   GGTGGGCTGGGAAGTACAATGGAAGTAGCTTACACTGGAAAACCTGCAATAGTTGTTCCA
Caenorhabditis_elegans|14340   GGTGGAATGGGAAGCTTAATGGAAAGTGCTCAAAAGTCTGTTCCGCTCGTCGTAGTCCCG
                                                                                           

Bombyx_mori|13385              ATTTTTTACGACCAGTTTGTCAACATCCAGAAAGCCGTGATTTCTGGTTATGGTATACAA
Bombyx_mori|12014              GTGTTCGGGGATCAATTCATCAACGTTGAATGGTCCGTCAGAAAAGGATTCGGAAAAAGG
Gasterosteus_aculeatus|19940   CTTTTTGGGGACCAATTTGATAATATGGTGAGGGCTAAAACAAAGGGACTTGGCCTCACC
Fugu_rubripes|4293             CTGTTCGGGGACCAATTTGATAATGTGGTGAGAGCCGAAACAAAGGGACTTGGACTCTCC
Xenopus_tropicalis|2247        ------------------------------------------------------------
Xenopus_tropicalis|2244        CTTTTTTTTGATCAGTTTGACAATGCAGTACGGATAAAAGCAAAACATTTGGGAACATTT
Xenopus_tropicalis|1478        CTCTTTGGAGATCAGTTTGACAATGCAGTACGGATAAAAGCAAAACATTTGGGAACATTT
Xenopus_tropicalis|1473        CTCTTTGGAGATCAGTTTGACAATGCAGTACGGATAAAGGCAAAACATCTGGGAACATTT
Dipodomys_ordii|7215           GTTAATGCAGACCAGCCCATAAACATGTTCCATGTAGAAGCAAAAAATCTTGGTGTCTCA
Anolis_carolinensis|9649       CTATTTGGGGATCAACATGACAACATGATCCGAGTGGAAGCCAGAAGCATGGGCCTCTCT
Ornithorhynchus_anatinus|12628 CTCTTCGGAGACCAGTTCGACAACATGGTCCGCGTGGAGGCCAAGACCCTGGGGGTCACC
Echinops_telfairi|13652        CTCTTTGGAGACCAGCCTGAAAACTTGGTCCGAGTCGAAGCCAAACACTTAGGCGTTACT
Tupaia_belangeri|13132         CTCTTTGGAGATCAGCCTGAAAACATGGTCCGAGTAGAAGCCAGAAAGCTTGGCGTTTCT
Felis_catus|38352              CTCTTTGGAGACCAGCCAGAAAACCTGGTCCGAGTAGAAGCCAAAAAGTTTGGTGTCTCT
Bos_taurus|12730               GAGCTA------------------------------------------------------
Tarsius_syrichta|7332          GTCAATGGAGATCAGCATGACAACATGGTCCAGGTAGTAGCCAAAAATTTTGGTGTCTCT
Dasypus_novemcinctus|14729     TTCTTTGGAGACCAGCCTGACAATCTGGTTCGAGTAGAAGCCAAAAACTTTGGTGTCTCT
Choloepus_hoffmanni|10632      TTCTTTGGAGACCAGGCTGAAAACATGCTACGAGTAGAAGCCAAAAACTTTGGCGTCTCT
Mus_musculus|13539             TTTTTTGGAGACCAACCTGAAAACATGGTCCGAGTAGAAGCAAAGAACCTTGGTGTTTCT
Rattus_norvegicus|18092        TTTTTCTCTGACCAACCCGAAAACATGATCCGAGTAGAAGCAAAGACCATTGGTGTTTCT
Pteropus_vampyrus|14496        ATCTTTGCAGACCAGCCTGGAAATATGGTTCGAGTAGAAGCCAAAAAGTTCGGTGTCTCT
Otolemur_garnettii|7502        ------------------------------------------------------------
Microcebus_murinus|7068        GTTTTTGGAGACCAGCTAGAAAACATGGTCCGAGTAGAAGCCAAAAATCTTGGTGTCTCT
Microcebus_murinus|19157       GTTTTTGGAGACCAGCCAGAAAACATGGTCCGAGTAGAAGCCAAAAAGTTTGGTGTCTCT
Tarsius_syrichta|4797          GTCTTTGGAGACACA---GAAAACATAGTTCGAGTAGAAGCCAAAAAGTTTTGTGTCTCT
Rhesus_macaque|31907           GTCAATGGAGACCAGCATGGAAACATGGTCCGAGTAGTAGCCAGAAATTATGGTGTCTCT
Homo_sapiens|68741             GTCAATGGAGACCAGCATGGAAACATGGTCCGAGTAGTAGCCAAAAATTATGGTGTCTCT
Gorilla_gorilla|244            GTCAATGGAGACCAGCATGGAAACATGGTCCGAGTAGTAGCCAAAAATTATGGTGTCTCT
Pongo_abelii|21971             GTCAATGGAGACCAGCATGGAAACATGGTCCGAGTAGTAGCCAAAAATTATGGTGTCTCT
Pan_troglodytes|29695          GTCAATGGAGACCAGCATGGAAACATGGTCCGAGTAGTAGCCAAAAATTATGGTGTCTCC
Callithrix_jacchus|45121       GTCTTTGGAGACCAGCCTGAAAACATGATCCGAGTAGAAGCCAAAAAGTTTGGTGTCTCT
Rhesus_macaque|31909           CTCTTTGGAGACCAGCCTGAAAACATGGTCCGAGTAGAAGCCAAAAACTTTGGTGTCTCT
Gorilla_gorilla|249            CTCTTTGGAGACCAGCCTGAAAACATGGTCCGAGTAGAAGCCAAAAAGTTTGGTGTTTCT
Homo_sapiens|68743             CTCTTTGGAGACCAGCCTGAAAACATGGTCCGAGTAGAAGCCAAAAAGTTTGGTGTTTCT
Pan_troglodytes|29694          CTCTTTGGAGACCAGCCTGAAAACATGGTCCGAGTAGAAGCCAAAAAGTTTGGTGTTTCT
Loxodonta_africana|24713       CTCTTTGGAGACCAGCCTGAAAACCTGCTCCGGGTAGAAGCCAAAAACCTCGGCGTCTCT
Oryctolagus_cuniculus|2791     CTCTTTGGAGACCAGCCTGAAAACATTGTCAGAGTAGAAGCCAAGAAACTTGGTGTCTCT
Ochotona_princeps|6294         CTCTTTGGAGACCAACCTGAAAACATTGTCAGAATAGAAGCTAAAAAGCTTGGTGTGTCT
Tursiops_truncatus|8861        CTCTTTGGAGACCAGCCTGAAAACCTGCTCCGAGTAGATGCCAAAAATTTCGGTGTCTCC
Bos_taurus|12729               CTCTTTGGAGACCAACATGAAAACCTGCTCCGAGTTAAAGCCAAAAAGTTCGGTGTCTCT
Equus_caballus|14193           ------------------------------------------------------------
Equus_caballus|14192           TTCTTTGGTGACCAGCCTGAAAATCTGTTCCGGGTAGAAGCCAAAAACTTTGGTGTCTCT
Equus_caballus|14190           GTCTTTGGAGACCAGCCTGAAAACCTGTTCCGAGTAGAAGCCAAAAACTTTGGTGTCTCT
Canis_familiaris|22019         GTCCTTGGAGACCAGCCTGAAAACCTTGTCCGAGTAGAGGCCAAAAAGTTTGGTGTCTCT
Canis_familiaris|22015         CTATTTGGAGACCAGCCTGAAAACCTTGTCCGAGTAGAGGCCAAAAAGTTTGGTGTCTCT
Caenorhabditis_elegans|25270   ATTTTCGGAGATCAACATCATAATGCCGTTATGTTGGCAAGGCATGGAGGAGCTGTGGCA
Caenorhabditis_elegans|14340   ATTTTCGGTGACCAAATGCGCAATGCACAGATCGCGAAGAGACACGGCGTGGCACTGATC
                                                                                           

Bombyx_mori|13385              GTTAAATTGAACTACGAGCTC---CCAAAAAGCTTAGAGAAGGCTCTTGGAGAAATGCTA
Bombyx_mori|12014              GTCGATCTTTCTTACACGTTG---GCGGAAGATCTCAAAGTTGCTATCGAAGAAGTTTTC
Gasterosteus_aculeatus|19940   ATCAAGCCCACGCACATCACC---AGGGAGCTGCTCAGCTCCACCATCCAAACACTCTCG
Fugu_rubripes|4293             ATCAAACCCACACTCATCACC---CGGGAGCGGCTACGCTCCGCTATTCAAACGCTTATG
Xenopus_tropicalis|2247        ------------------------------------------------------------
Xenopus_tropicalis|2244        ATTCCATCAGATCAACTGAAA---GCTGAGAAACTGGCAAATGCTATTAGGCATGTAATA
Xenopus_tropicalis|1478        ATTCTGCCAGGTCAACTCAAG---GCTGAAGATTTTGCAAATGCTATTAGGCATGTAATA
Xenopus_tropicalis|1473        ATTCCAAAAGATCAACTCAAG---GCTGAAAAATTTGCAGACGCTATTAGGCATGTAATA
Dipodomys_ordii|7215           CTTTCACTTATCAACCTCACG---GCAGAAACATTGGCTCTGAAAGTGAAACAAGTTATA
Anolis_carolinensis|9649       GTCAGCATAGACCAGCTAGAA---GCTGACAGCTTTGGAAGTGCAATGAAACAAGTAATA
Ornithorhynchus_anatinus|12628 GTCCCGGTAACGCAGCTGAAG---GCAGAGATGTTTGCCCACACGATGAAACGAGTCATA
Echinops_telfairi|13652        ATGTCATTAAAGCAGCTCAAG---GCAGAAACATTGGCTCGCAAGATGAAACAAGTCATG
Tupaia_belangeri|13132         CTTCAGTTAAAAGAACTCAAG---GCAGACACACTGGCTCTTAAGATGAAGCAAGTTATA
Felis_catus|38352              ATCCCATTAAAGCAGATAAAG---GAAGAGACCTTGGCTGTGAAGATGAAACAAGTCATA
Bos_taurus|12730               ------------------------------------------------------------
Tarsius_syrichta|7332          ATCCAGTTAAAGCAGGTCACA---GCAGACACACTGACACTTAAGATGAAACAAGTCATA
Dasypus_novemcinctus|14729     ATCCAGTTAAAGGAGCTCAAG---GCAGAGATTTTGGTTCTCAAGATGAAACAAGTCATG
Choloepus_hoffmanni|10632      ATCCAGTTAAAGCAGCTCAAG---GCAGAGACTTTGGCTCTCAAGATGAAACAAGTCATA
Mus_musculus|13539             ATTCAGCTACAGACACTCAAG---GCAGAGTCATTTTTGCTCACCATGAAAGAAGTCATA
Rattus_norvegicus|18092        ATTCAGATACAGACGCTCAAG---GCAGAGACGTTTGCGCGCACAATGAAAGAAGTCATA
Pteropus_vampyrus|14496        ATTTCTTTCAAGCAGATCAAA---GCTGAGACATTGGCTCTGACGATGAAGCAAGTCATA
Otolemur_garnettii|7502        ------------------------------------------------------------
Microcebus_murinus|7068        ATTAATTTAAAGGAGCTGAAG---GCAGAGACATTGACTCTTAAGATGGAACAAGTCATG
Microcebus_murinus|19157       ATTAATTTAAAGGAGCTGAAG---GCAGAGACATTGGCTCTTAAGATGGAACAAGTCATA
Tarsius_syrichta|4797          ATTGAGTTACAAATGCTCAAG---GCAGAGACATTGGCTCTCAAGATGAAACAAGTCATA
Rhesus_macaque|31907           ATCCAGTTGAATCAGGTCACA---GCTGACACACTGACACTTATGTTGAAACAAGTCATA
Homo_sapiens|68741             ATCCGGTTGAATCAGGTCACA---GCCGACACACTGACACTTACAATGAAACAAGTCATA
Gorilla_gorilla|244            ATCCAGTTGAATCAGGTCACA---GCCGACACACTGACACTTACAATGAAACAAGTCATA
Pongo_abelii|21971             ATCCGGTTGAATCAGGTCACA---GCCGACACACTGACACTTATGATGAAACAAGTCATA
Pan_troglodytes|29695          ATCCGGTTGAATCAGGTCACA---GCCGACACACTGACACTTACGATGAAACAAGTCATA
Callithrix_jacchus|45121       ATTTCGTTAAAGAAGCTCAAG---GCAGAGACACTGGCTCTGAAGATGAAACAAATCATG
Rhesus_macaque|31909           ATTCAGTTAAAGAAGCTCAAG---GCAGAGACATTGGCTCTTAAGATGAAACAAATCATG
Gorilla_gorilla|249            ATTCAGTTAAAGAAGCTCAAG---GCAGAGACATTGGCTCTTAAGATGAAACAAATCATG
Homo_sapiens|68743             ATTCAGTTAAAGAAGCTCAAG---GCAGAGACATTGGCTCTTAAGATGAAACAAATCATG
Pan_troglodytes|29694          ATTCAGTTAAAGAAGCTCAAG---GCAGAGACATTGGCTCTTAAGATGAAACAAATCATG
Loxodonta_africana|24713       GTTCAGATAAATCAGCTGAAG---GCAAGGACTTTGGCTCTTAAGATGAAACAAGTCATA
Oryctolagus_cuniculus|2791     ATTCAGTTACATAACCTCAAA---GCAGAGACACTGGCACTTACAATGAAGCAAGTCATT
Ochotona_princeps|6294         ATTCAGTTGCATAACCTCAAG---GCAGAGACCTTGGCTCTTATGATGAAACAAGTCATT
Tursiops_truncatus|8861        ATCCAGTTAAAGCAGATCAAG---GCTGAGACATTAGCTCTGAACATGAAGCAAGTCATA
Bos_taurus|12729               ATCCAATTAAAGCAGATCAAG---GCTGAGACACTGGCTCTGAAGATGAAGCAAGTCATA
Equus_caballus|14193           ------------------------------------------------------------
Equus_caballus|14192           ATCCAGGTAAAGCAGATCAAG---GCTGAGACACTGGCTCTGAAGATGAAGCAAGTCATA
Equus_caballus|14190           ATCCAGTTAAAGCAGATCAAG---GCTGAGACACTGTCTCTGAAGATGAAGCAAGTCATA
Canis_familiaris|22019         ATCCAGCTACAGCAGATCAAG---GCAGAGACATTGGCTCTGAAGATGAAGCAAGTTATA
Canis_familiaris|22015         ATCCAGCTACAGCAGATCAAG---GCAGAGACATTGGCTCTGAAGATGAAGCAAGTTATA
Caenorhabditis_elegans|25270   TACGACAAGTTTGATTTGAAAAATGGAGAAAAGTTGACAGCAGTTGTTCATGAAATGATA
Caenorhabditis_elegans|14340   TACGATAAAATGGACTTGAGCAACACGAAAAAGCTCATTGGAGCATTGAAAGAAGTGCTC
                                                                                           

Bombyx_mori|13385              AGCGATAAGAAATACCGAGAAAAAGCAAAACAGCTTTCTTTGATCTTCCATGATCGTCCG
Bombyx_mori|12014              GCAAATCCTAGATACAAAGAAATAGCAAAAGAAACATCGTTGATATACCACGATCGTCCG
Gasterosteus_aculeatus|19940   CAGGACATCAGGTTCAAGTCTTCAGCTTTGTCCCTTAGCCGGATCCACAAGTCCCATCCT
Fugu_rubripes|4293             CATGACAGGAGGTTCAAGTCCTCAGCTTTGTCCCTCAGCAGGATCCACAGGTCTCATCCC
Xenopus_tropicalis|2247        ------------------------------------------------------------
Xenopus_tropicalis|2244        GAAGATAAAAGCTACAAGAACTCAGCAATGCACTTCAGCCTGATACAGAGGTCACAGCCT
Xenopus_tropicalis|1478        GAAGATGAAAGCTACAAGAACTCAGCAATGCACTTCAGCCTGATACAGAGGTCACAGCCG
Xenopus_tropicalis|1473        GAAGATAAAAGCTACAAGAAATCTATAGAGCGCTTAAACGTGATACAGAGGTCACAGCCT
Dipodomys_ordii|7215           GAAGACAAGAGGTACAAGTCTGCAGCGGTGGCAGCCAGCATCATCAGGCACTCCCAGCCC
Anolis_carolinensis|9649       AGACACCAAAGGTATAAATCTGCAGCAAAGACTTTGAGCACAATCCTCCAATCTCATCCA
Ornithorhynchus_anatinus|12628 GAAGACAGGAGGTATAAATCCTCAGCGGTGGCGGCAAGTACGATCAGGCGCTCCCACCCG
Echinops_telfairi|13652        GAGGACAAGAGGTACAAGTCGGCAGCCATGGCCGCCAGCATCATCAGGCGCTCCCACCCG
Tupaia_belangeri|13132         GAAGACAAGAGGTACAAGTCTGCAGCTGTGGCAGCCAGTGTCATCAGGCGCTCCCACCCT
Felis_catus|38352              GAAGACAAG---------------------------------------------------
Bos_taurus|12730               ------------------------------------------------------------
Tarsius_syrichta|7332          GAAGACAAGAAGCACAAGTCTGCAGCGGTGGCTGCCAGCATCATTAGGCGCTCTCACCCT
Dasypus_novemcinctus|14729     GAAGACAAGAGGTTCCGATCTGCAGCGGTGGCCGCCAGCATCATCAGGCGCTCCCACCCA
Choloepus_hoffmanni|10632      GAAGACAAG---------------------------------------------------
Mus_musculus|13539             GAAGACCAGAGGTACAAGACTGCAGCAATGGCCTCCAAGGTTATCAGGCAATCCCACCCA
Rattus_norvegicus|18092        GAAGACAAGAGGTACAAGTCTGCAGCAATGGCCTCCAAGATTATCAGGCACTCCCACCCA
Pteropus_vampyrus|14496        GAAGACAAG---------------------------------------------------
Otolemur_garnettii|7502        ------------------------------------------------------------
Microcebus_murinus|7068        GAAGACAAGAGGTACAAGTCTGCAGCAGTGGCCGCCAGTGTCATCAGACGCTCCCACCCC
Microcebus_murinus|19157       GAAGACGAGAGGTACAAGTCTGCAGCAGTGGCCGCCAGTGTCATCAGACGCTCCCACCCC
Tarsius_syrichta|4797          GAAGACCAGAGGTACAAATCCGCAGCGGTGGTCGCCAGCATCATCCGGCGCTCTCATCCC
Rhesus_macaque|31907           GAAGACAAGAGGTACAAGTCAGCAGTGGCGGCAGCTAGTGTCATCCTGCGCTCTCAGCCC
Homo_sapiens|68741             GAAGACAAGAGGTACAAGTCGGCAGTGGTGGCAGCCAGTGTCATCCTGCACTCTCAGCCC
Gorilla_gorilla|244            GAAGACAAGAGGTACAAGTCGGCAGTGGTGGCAGCCAGTGTCATCCTGCACTCTCAGCCC
Pongo_abelii|21971             GAAGACAAGAGGTACAAGTCGGCAGTGGTGGCAGCCAGTGTCATCCTGCACTCTCAGCCC
Pan_troglodytes|29695          GAAGACAAGAGGTACAAGTCGGCAGTGGTGGCAGCCAGTGTCATCCTGCACTCTCAGCCC
Callithrix_jacchus|45121       GAAGACAAGAGGTACAAATCTGCAGCAGTGGCTGCCAGCGTCATCCTGCGTTCCCACCCT
Rhesus_macaque|31909           GAAGACAAGAGGTACAAGTCTGCAGCAGTGGCTGCCAGCATCATCCTGCGCTCCCACCCG
Gorilla_gorilla|249            GAAGACAAGAGATACAAGTCCGCGGCAGTGACTGCCAGTGTCATCCTGCGCTCCCACCCG
Homo_sapiens|68743             GAAGACAAGAGATACAAGTCCGCGGCAGTGGCTGCCAGTGTCATCCTGCGCTCCCACCCG
Pan_troglodytes|29694          GAAGACAAGAGATACAAGTCCGCGGCAGTGGCTGCCAGTGTCATCCTGCGCTCCCACCCG
Loxodonta_africana|24713       GAAGAAAAGAGGTACAAGTCTGCAGCCATGGCGGCCAGCATCATCAGGCGCTCCCACCCC
Oryctolagus_cuniculus|2791     GAAGACAAGAGGTACAAGGCTGCAGCCGTGTCTGCCAGTGTCGTCAGGTGTTCCCACCCC
Ochotona_princeps|6294         GAAGACAAG---------------------------------------------------
Tursiops_truncatus|8861        GAGGACAAG---------------------------------------------------
Bos_taurus|12729               GAGGACAAGAGGTACAAATCTGCCGCAGAGGCCGCCAGCATCATCAGACGCTCGCAGCCC
Equus_caballus|14193           ------------------------------------------------------------
Equus_caballus|14192           GAAGACAAGAGGTACAAATCTGCAGCCGTGGCCGCCAGCATCATCAGGCGCTCCCACCCC
Equus_caballus|14190           GAAGACAAGAGGTACAAATCTGCAGCCGTGGCCGCCAGCATCATCAGACGCTCCCACCCC
Canis_familiaris|22019         GAAGACAAGAGGTACAAGTCAGCAGCCGTGGCTGCCAGCATCATCAGGAGCTCTCACCCC
Canis_familiaris|22015         GAAGACAAGAGGTACAAGTCAGCAGCCGTGGCTGCCAGCATCATCAGGAGCTCTCACCCC
Caenorhabditis_elegans|25270   TCGAGCACCAAGTACCAAGAAAACGCGGAGGCTCTGCAACATGTGCTATTCAATCAACCA
Caenorhabditis_elegans|14340   GAGAATCCGGAATACAAAAAATCGGCGGAACTTCTCGCGCGGATCCTTGCCACTGAGAGG
                                                                                           

Bombyx_mori|13385              GTGTCTCCGGGTGCTGAGCTGGTCCACTGGGTGGAGCACGTCGTCAAGACTAGAGGAGCT
Bombyx_mori|12014              GTGTCTCCGGGTGCTGAGCTGGTCCACTGGGTGGAGCACGTCGTCAAGACTAGAGGAGCT
Gasterosteus_aculeatus|19940   GTCCCCCCCGCCCTTCGACTCACCCAGTGGGTGGAGCACATCCTGCAGAGTGGAGGTGGG
Fugu_rubripes|4293             ATCCCTCCAGCCCTTCGACTCATTCACTGGGTGGAACACATCCTGCACAGTAGAGGGGGG
Xenopus_tropicalis|2247        ------------------------------------------------------------
Xenopus_tropicalis|2244        TTTCCCAAGGAGCAGCAAATAGTGCGATGGGTGGAGCACATTGTAACAGTGGGAGGAGCC
Xenopus_tropicalis|1478        TTTCCCAAGGAGCAGCAAATAGTGCGATGGGTGGAGCACATTGTAACAGTGGGAGGAGCC
Xenopus_tropicalis|1473        TTTCCCAAGGAGCAGCAAATAGTGCGATGGGTGGAGCATATTGTAACAGTGGGAGGAGCC
Dipodomys_ordii|7215           TTCACCCCCGTGCAGCGCCTGGTGGGTTGGATCGACCACATCCTCCAGAATAAGGGTGCA
Anolis_carolinensis|9649       TTTCCTCCGGAACAAAGACTGGCAGGATGGATAGAACACATTCTCACAGTGGGAAGTGGC
Ornithorhynchus_anatinus|12628 TTCCCGCCCGCCCAGCGGCTGGTGGGATGGATCGACCACATCCTGCAGACGGGCGGTGGG
Echinops_telfairi|13652        CTGAGCCCCTCCCAGAGGCTGGTGGGCTGGATCAACCACATCCTGCAGACAGGGAATGGG
Tupaia_belangeri|13132         GTAAGCCCCTCTCAGAAGCTGGTGGGCTGGATCGACCATATCCTCCAGACAGGGGGGGCA
Felis_catus|38352              ------------------------------------------------------------
Bos_taurus|12730               ------------------------------------------------------------
Tarsius_syrichta|7332          TTGACCCCTGCCCAGCGCCTGGTTGGCTGGACTGACCACATCCTCCAGACAAGGGGGGTG
Dasypus_novemcinctus|14729     CTGAGCCCGGCCCAGCGGCTGGTGGGCTGGATCGACCACATCCTGATGACAGGGGGTTCA
Choloepus_hoffmanni|10632      ------------------------------------------------------------
Mus_musculus|13539             CTGACCCCTGCCCAGAGGCTTGTGGGCTGGATAGATCACATCTTGCAGACAGGGGGTGCA
Rattus_norvegicus|18092        CTGACCCCTTCCCAGAGACTTGAGGGCTGGATAGATCACATTTTGCAGACAGGGGGTGCA
Pteropus_vampyrus|14496        ------------------------------------------------------------
Otolemur_garnettii|7502        ------------------------------------------------------------
Microcebus_murinus|7068        CCTGACCCCGCCCAGCGGCTGGTGGGCTGGATCGACCACATCCTGCAGACAGGGGGCGCT
Microcebus_murinus|19157       TTGACCCCCGCCCAGCGGCTGGTGGGCTGGATCGACCACATCCTGCAGACAGGGGGCTCT
Tarsius_syrichta|4797          CTGAGTCCTACCCAGCAGCTGGTGGGCTGGACAGACCACATCCTCCAGACAGGGGGAGCA
Rhesus_macaque|31907           CTGAGCCCTGCACAGCGGCTGGTGGGCTGGATTGACCACATCCTCCAGACTCAGGGGGCG
Homo_sapiens|68741             CTGAGCCCCGCACAGCGGCTGGTGGGCTGGATCGACCACATCCTCCAGACTGGGGGAGCG
Gorilla_gorilla|244            CTGAGCCCCGCACAGCGGCTGGTGGGCTGGATCAACCACATCCTCCAGACTGGGGGGGCA
Pongo_abelii|21971             CTGAGCCCCGCACAGCGGCTGGTGGGCTGGATCGACCACATCCTCCAGACTGGGGGGGCG
Pan_troglodytes|29695          CTGAGCCCCGCACAGCGGCTGGTGGGCTGGATCGACCACATCCTCCAGACTGGGGGAGCG
Callithrix_jacchus|45121       CTCAGCCCCACACAGCGGCTAGTGGGCTGGATTGACCATGTCCTCAAAACAGGCGGGGCA
Rhesus_macaque|31909           CTCAGCCCCACACAGCGGCTTGTGGGCTGGATTGACCACATCCTCCAGACAGGGGGGGCG
Gorilla_gorilla|249            CTCAGCCCCACACAGCGGCTGGTGGGCTGGATTGACCACGTCCTCCAGACAGGGGGAGCG
Homo_sapiens|68743             CTCAGCCCCACACAGCGGCTGGTGGGCTGGATTGACCACGTCCTCCAGACAGGGGGCGCG
Pan_troglodytes|29694          CTCAGCCCCACACAGCGGCTGGTGGGCTGGATTGACCACGTCCTCCAGACAGGGGGCGCG
Loxodonta_africana|24713       CTGAGCCCCTCCCAGCGACTGGTGGGCTGGATCAACCACATCCTCCAGACAGGTGGTGGG
Oryctolagus_cuniculus|2791     CTGACCCCATCCCAGAGGTTGGTGGGCTGGGTCGACCACATCCTTCAGACAAGGGGGGCA
Ochotona_princeps|6294         ------------------------------------------------------------
Tursiops_truncatus|8861        ------------------------------------------------------------
Bos_taurus|12729               CTGACCCCTGCCCAGCGGCTGGTGGGCTGGATTAACCACATCCTTCAGACAGGGGGTGCA
Equus_caballus|14193           ------------------------------------------------------------
Equus_caballus|14192           CTGACTCCTGCCCAGCGGCTGGTGGGCTGGACCAACCACATCCTGCAGACAGGGGGTGCA
Equus_caballus|14190           CTGACTCCTGCCCAGCGGCTGGTGGGCTGGACCAACCACATCCTGCAGACAGGGGGTGCA
Canis_familiaris|22019         CTGACCCCTGCCCAGAGGCTGGTGGGCTGGATCGACCACATCCTCCAGACAGGGGGTGCA
Canis_familiaris|22015         CTGACCCCTACCCAGAGGCTGGTGGGCTGGATCGATCACATCCTCCAGACAGGGGGTGCA
Caenorhabditis_elegans|25270   ATTGATCCAAAAATGAATTTTTTGAATCACTTGGATTTTGCAATCAAGTTCCCAAATCAT
Caenorhabditis_elegans|14340   TTCTCCCCGCGGCAAAAGATCATTGATACGGTGGAGATGGCTGGAAGGTTCGGGCAAATG
                                                                                           

Bombyx_mori|13385              CTCCATCTGCGCTCACCAGCACTGCACGTGCCTTTCTACCAGAAGCTGTACTTAGATCTG
Bombyx_mori|12014              CTCCATCTGCGCTCACCAGCACTATTCGTACCCTTGTACCAGAAACTGTACTTAGATGTA
Gasterosteus_aculeatus|19940   GCTCATTTAAGGCCGGCTTCGCTCACACAGCCGTGGTACCAGAGGTACCTGTTGGACTTG
Fugu_rubripes|4293             GCCCATTTAAAGCCGGCTTCACTAACGCTACCGTGGTACCAGAGATACATGTTGGACCTG
Xenopus_tropicalis|2247        ------------------------------------------------------------
Xenopus_tropicalis|2244        AATCACCTTATTCCATACTCCTACCAGCAACCCCTGTATCAGCAGTATCTTCTGGACGTC
Xenopus_tropicalis|1478        AATCACCTTATTCCATACTCCTACCAGCAACCCCTGTATCAGCAGTATCTTCTGGACGTC
Xenopus_tropicalis|1473        AATCACCTTATTCCATACTCCTACCAGCAACCCCTGTATCAGCAGTATCTTCTGGACGTC
Dipodomys_ordii|7215           GAGCACCTCAGGCCTTATACCTTCCAGCAGCCTTGGACTGAGCTGCATCTGCTCAACATC
Anolis_carolinensis|9649       GCTCACCTCCATCCCTATGCATTTCATCAGGAATGGTATCAGCAATACTTATTGGACGTT
Ornithorhynchus_anatinus|12628 GACCACCTCCGGCCCTTCGCTTTCCAGCAGCCCTGGTACGAGCAGTACATGCTGGACGTC
Echinops_telfairi|13652        GCACACCTCAAGCCCTTTGTTTTCCAGCAGCCTTGGTATGAGCAGTACCTGCTGGATGTC
Tupaia_belangeri|13132         GCCCACCTCAAGCCCTATGCCTTTCAGCAGCCCTGGCATGAGCAGTACCTGCTGGATGTC
Felis_catus|38352              ------------------------------------------------------------
Bos_taurus|12730               ------------------------------------------------------------
Tarsius_syrichta|7332          GCACACCTCAAGCCCTATGTCTTCCAGCAGCCCTGGCATGAG---TATTTGTTGGATGTC
Dasypus_novemcinctus|14729     GCACACCTCAAGCCCTACGCCTTCCAGCAGCCATGGCACGAGCAGTACCTGCTTGACGTC
Choloepus_hoffmanni|10632      ------------------------------------------------------------
Mus_musculus|13539             GCACATCTCAAGCCATATGCTTTCCAGCAGCCATGGCATGAGCAGTACATGCTGGATGTC
Rattus_norvegicus|18092        GCACATCTCAAGCCCTATGCCTTCCAGCAGCCATGGCATGAGCAGTATCTGCTGGATGTA
Pteropus_vampyrus|14496        ------------------------------------------------------------
Otolemur_garnettii|7502        ------------------------------------------------------------
Microcebus_murinus|7068        GCGCACCTCAAGCCCTATGCCTTCCAGCAGCCCTGGCATGAGCAGTACCTGCTGGATGTC
Microcebus_murinus|19157       GCGCACCTCAAGCCCTATGCCTTCCAGCAGCCCTGGCATGAGCAGTACCTGCTGGATGTC
Tarsius_syrichta|4797          ACCGACCTTAAGTCCTATGCCTTCCAGCAGTCCTGGCATGAACAGTACCTGCTTGACATC
Rhesus_macaque|31907           GCGCACCTCAAGCCCTATGCCTTCCAGCAGCCTTGGCATGAGCAGTACCTCATCGATGTC
Homo_sapiens|68741             ACGCACCTCAAGCCCTATGCCTTCCAGCAGCCTTGGCATGAGCAGTACCTCATTGATGTC
Gorilla_gorilla|244            GCGCACCTCAAGCCCTATGCCTTCCAGCAGCCTTGGCATGAGCAGTACCTCATTGACATC
Pongo_abelii|21971             GCGCACCTCAAGCCCTATGCCTTCCAGCAGCCTTGGCATGAGCAGTACCTCATTGATGTC
Pan_troglodytes|29695          GCGCACCTCAAGCCCTATGCCTTCCAGCAGCCATGGCATGAGCAGTACCTCATTGATATC
Callithrix_jacchus|45121       GCGCATCTCAAGCCCTATGTGTTCCAGCAGCCCTGGCATGAACAATACCTGTTGGATGTC
Rhesus_macaque|31909           ACTCACCTCAAGCCCTATGTCTTCCAGCAGCCCTGGCATGAGCAGTACCTGCTTGATGTT
Gorilla_gorilla|249            ACGCACCTCAAGCCCTATGTCTTTCAGCAGCCCTGGCATGAGCAGTACCTGCTCGACGTT
Homo_sapiens|68743             ACGCACCTCAAGCCCTATGTCTTTCAGCAGCCCTGGCATGAGCAGTACCTGCTCGACGTT
Pan_troglodytes|29694          ACGCACCTCAAGCCCTATGTCTTTCAGCAGCCCTGGCATGAGCAGTACCTGCTCGACGTT
Loxodonta_africana|24713       GCGCACCTCAAGCCCTATGCCTTCCAGCAGCCCTGGCATGAGCAGTACCTGCTTGACGTC
Oryctolagus_cuniculus|2791     GCGCACCTCAAGCCCTATGCCTTCCAGCAGTGGTGGCATGAGCAGTACCTACTTGACGTC
Ochotona_princeps|6294         ------------------------------------------------------------
Tursiops_truncatus|8861        ------------------------------------------------------------
Bos_taurus|12729               GCCCACCTCAAGCCCCATGCCTTCCAGCAGCCGTGGTATGAGCAGTACCTACTGGACGTC
Equus_caballus|14193           ------------------------------------------------------------
Equus_caballus|14192           GCGCACCTCAAGCCCCACGCCTTCCAACAGCCATGGTATGAACAGTACCTGCTCGATGTC
Equus_caballus|14190           GCGCACCTCAAGCCCCATGCCTTCCAGCAGCCATGGTATGAACAGTACCTGCTCGATGTC
Canis_familiaris|22019         GCACACCTCAAGCCCTATGCCTTGCAGCAGCCATGGCATGAGCAGTACCTGCTGGACGTC
Canis_familiaris|22015         GCTCACCTCAAGCCCTATGCCTTGCAGCAGCCATGGCATGAGCAGTACCTGCTGGACGTC
Caenorhabditis_elegans|25270   CGAGCTCAAGTTCCTGCTATAAATCAATTAGGTTTTGTGGCACATTATTATTTAGATGTT
Caenorhabditis_elegans|14340   CCCAGGTGGACGTCTGCTGGAAAAGAATTCTCGTTTTTGAAATATTTCAATTTGGATCTA
                                                                                           

Bombyx_mori|13385              CTGGCAGCTATTGCAATGACATTGCTTATGATCAAATTGGTTATTGAAAAAACTCTCTCA
Bombyx_mori|12014              CTGGCA---GTCATATTAGCATTCTTGATTGTATTGTACAAAACTGCGAGATGTTTATTT
Gasterosteus_aculeatus|19940   GTGCTCCTTCTCTCCCTGGGTCTTCTCGGGCCCGTAGTTATCTGC---------------
Fugu_rubripes|4293             CTCCTTCTTTTTTCACTGGTGCTTTGTGGACTCGTGGTTATATGTTGTAGATGTTTTAGT
Xenopus_tropicalis|2247        ------------------------------------------------------------
Xenopus_tropicalis|2244        ATTTTATTTGTGTGTGTGTGTTTAATTGGGGCCTGTTACATTACTGTGAAGGTACTGAGG
Xenopus_tropicalis|1478        ATTTTATTTGTGTGTGTGTGTTTCATTGGGGCCTGTTACCTTACTGTGAAGGTACTGAGG
Xenopus_tropicalis|1473        ATTTTATTTGTGTGTGTGTGTTTCATTGGGGCCTGTTACCTTACTGTGAAGGTACTGAGG
Dipodomys_ordii|7215           TTCCTGTTCCTGCTGGGCTTCACTCTGGGTGTCCTGTGGCTTTGTGGGAAGCTGCTGAGC
Anolis_carolinensis|9649       TGGCTGTTTCTCTTTGCTTCACTCCTAGGCATCATCTACCTTTCTCTCAAATTCATTGAC
Ornithorhynchus_anatinus|12628 ATCTCCTTCCTTGTGGCGCTCACCCTGGCCTCCGGGTTCCTCTGTGTGATGCTGGGGAGA
Echinops_telfairi|13652        CTCTTGTTCCTGCTGGGGGTCGCCCTCGGCTCCATGTGGCTTTGTGGGAAGTTGCTGCGC
Tupaia_belangeri|13132         TTCTTGTTCCTGCTGGGGCTCACTCTGGGTGCTGGGTGGCTCTGTGGGAAGCTGCTGGCC
Felis_catus|38352              ------------------------------------------------------------
Bos_taurus|12730               ------------------------------------------------------------
Tarsius_syrichta|7332          TTCTTGTTCCTGCTGGGGTTCATCTTGGGTACCATGTGGCTTTGTGGTAAGCTTCTGGGT
Dasypus_novemcinctus|14729     TTTGCCTTCCTGCTGCTGGTCACTCTGGGCTCCATGTGGCTTTGTGGGAAGCTGCTGGGC
Choloepus_hoffmanni|10632      ------------------------------------------------------------
Mus_musculus|13539             TTCCTCTTTCTGTTAGGACTCACACTGGGTACCTTGTGGCTTAGTGTAAAGGTTCTTGTT
Rattus_norvegicus|18092        TTCCTCTTTCTGCTAGGGCTCACGCTGGGCACCGTGTGGCTTTGTGTAAAGGTTCTTGGT
Pteropus_vampyrus|14496        ------------------------------------------------------------
Otolemur_garnettii|7502        ------------------------------------------------------------
Microcebus_murinus|7068        CTCCTGTTCCTGCTGGGGCTCACTCTGGGCGCCGTGTGGCTTTGTGGGAAGCTGCTGAGG
Microcebus_murinus|19157       TTCGCGTTCCTGCTGGGGCTCAGTCTGGGCGCCGTGTGGCTTTGTGGGAAGCTGCTGGGG
Tarsius_syrichta|4797          TTCTTGTTCCTGCTGGAGCTTACTCTGGGCACCATGTGGCCTTGTAGGAAGCTACTGGGC
Rhesus_macaque|31907           TTTGTGTTTCTGCTGGGGCTCACTCTGGGCACTGTGTGGCTTTGTGGGAAGCTGCTGGGT
Homo_sapiens|68741             TTTGTGTTTCTGCTGGGGCTCACTCTGGGCACTATGTGGCTTTGTGGGAAGCTGCTGGGT
Gorilla_gorilla|244            TTTGTGTTTCTGCTGGGGCTCACTCTGGGCACTATGTGGCTTTGTGGGAAGCTGCTGGGT
Pongo_abelii|21971             TTTGTGTTTCTGCTGGGGCTCACTCTGGGCACTATGTGGCTTTGTGGGAAGCTGCTGGGT
Pan_troglodytes|29695          TTTGTGTTTCTGCTGGGGCTCACTCTGGGCACTATGTGGCTTTGTGGGAAGCTCCTGGGT
Callithrix_jacchus|45121       TTTGTGTTTCTGCTGGGGCTCACTCTGGCCACTCTGTGGCTTTGTAGGGGGCTGCTGGGC
Rhesus_macaque|31909           TTTGTGTTTCTGCTGGGGCTCACTCTGGGCACTCTATGGCTTTGTGGGAAGCTGCTGGGT
Gorilla_gorilla|249            TTTGTGTTTCTGCTGGGGCTCACTCTGGGGACTCTATGGCTTTGTGGGAAGCTGCTGGGC
Homo_sapiens|68743             TTTGTGTTTCTGCTGGGGCTCACTCTGGGGACTCTATGGCTTTGTGGGAAGCTGCTGGGC
Pan_troglodytes|29694          TTTGTGTTTCTGCTGGGGCTCACTCTGGGGACTCTATGGCTTTGTGGGAAGCTGCTGGGC
Loxodonta_africana|24713       TTCTTGTTCCTGCTGGGGATCACTCTGGGGTCCATATGGCTT------------------
Oryctolagus_cuniculus|2791     TTCTTGTTCCTGCTGGGGCTCATTCTGAGCTCTGTATGGCTCGGTGGGAAGCTTCTGGGA
Ochotona_princeps|6294         ------------------------------------------------------------
Tursiops_truncatus|8861        ------------------------------------------------------------
Bos_taurus|12729               TTCTTGTTCCTTCTGGTGGTCACCCTGGGCACCATGTGGCTCTGTGGGAAGCTTCTGGGC
Equus_caballus|14193           ------------------------------------------------------------
Equus_caballus|14192           TTCTTGTTCCTGCTGGTGCTCACCGTGGGCACCATGTGGCTCTGTGGGAAGCTGCTGGGC
Equus_caballus|14190           TTCTTGTTCCTGCTGGTGCTCACCGTGGGCACCATGTGGCTCTGTGGGAAGCTGCTG---
Canis_familiaris|22019         ATCTTGTTCCTGCTGGTGGTCACCCTGGGTACCCTGTGGCTCTGTGGGAAGCTGCTGGGC
Canis_familiaris|22015         ATCTTGTTCGTGCTGGTGGTCACCCTGGGCACCCTGTGGCTCTGTGGGAAGCTGCTGGGC
Caenorhabditis_elegans|25270   CTACTGTTTTTGTTAGTTTCTTCAATTGTTATTACATATCTTGCCATCAGCCTTCTTAAA
Caenorhabditis_elegans|14340   GTGATCATTGCAGTTTTTATATTTTTTCTGTCAATTGTCTCGACGGTACTGTTGATTAGA
                                                                                           

Bombyx_mori|13385              AGTTTCTATAAGAAG---------ACATTAAAACGGAAAGAAGAT---TAA
Bombyx_mori|12014              TTGAAGGAAAGA------------ATAACAAATAAAAAGAAAAATAATTGA
Gasterosteus_aculeatus|19940   ---TTGACTTGCTGGAAGAACAAGAACAGCAGGGACCAACACGAAAAG---
Fugu_rubripes|4293             TTGACTGCAGAGTTCCTGTGCTTTATCAAAACATTAAACAAGACA------
Xenopus_tropicalis|2247        ------------------------------------------------TGA
Xenopus_tropicalis|2244        CTATTCATCCAAAGGCTTTGTTCTGTCAGAAAGGTAAAACAAAAT---TAA
Xenopus_tropicalis|1478        CTATTCATCCAAAGGCTTTGTTCTGTTGGAAAGCTAAAACAAAAC---TGA
Xenopus_tropicalis|1473        CTATTCATCCAAAGGCTTTGCTCTGTCGGAAAGCTAAAACAAAAC---TGA
Dipodomys_ordii|7215           CTGCTGACCAGGTGGCTAAAGACAGCCAGGAAGCTGAAGAAGACA---TAA
Anolis_carolinensis|9649       TTTATTACTTCAAGGATCTGTGActcaggaaaacaaaagcaagca---taa
Ornithorhynchus_anatinus|12628 GTGGCCCGCCGCCGGCTGTGTGGACTCAGGAAGCTCAAGCAGACG---TGA
Echinops_telfairi|13652        GTGATGGCCAGCTGGCTGCGTGGGTCCCAGAAGCTGAAACAGATG---TGA
Tupaia_belangeri|13132         ATGGCGGCCAGGTGGCTGAGTGGGCCTAGGAAGCTGAAGGAGACT---TGA
Felis_catus|38352              ---------------------------------------------------
Bos_taurus|12730               ---------------------------------------------------
Tarsius_syrichta|7332          ATGGTGGCCAGGAGGCTGTGTGGGGCCACC------------------TGA
Dasypus_novemcinctus|14729     ATGGTGGCCAGGTGGCTGTGCGGGGCCAGGAAGCTGAAGCAGGCG---TGA
Choloepus_hoffmanni|10632      ---------------------------------------------------
Mus_musculus|13539             GCTGTAACCAGGTATCTGAGTATATCAAGGAAGGTCAAGCAGGCA---TAA
Rattus_norvegicus|18092        GCTGTGATGAGGTATCTGAGTGGAGCGAGGAAGGCAAAGCAGACA---TAA
Pteropus_vampyrus|14496        ---------------------------------------------------
Otolemur_garnettii|7502        ---------------------------------------------------
Microcebus_murinus|7068        GTGGTGTCCAGGTGGCTGTGTGGGGCCAGGAAGCTGAAGGAGACT---TGA
Microcebus_murinus|19157       GTGGTGTCCAGGTGGCTGCGTGGGGCCAGGAAGCTGAAGGAGACA---TGA
Tarsius_syrichta|4797          TTAGGGATCAGGTGGCTGTGTGGGGCCAGGAAACTGAAGGAGACT---TGA
Rhesus_macaque|31907           GTCGTGGTCAGGTGGCTGCGTGGGGCCAGGAAAGTGAAGAAGACA---TGA
Homo_sapiens|68741             GTGGTGGCCAGGTGGCTGCGTGGGGCCAGGAAGGTGAAGAAGACA---TGA
Gorilla_gorilla|244            GTGGTGGCCAGGTGGCTGCGTGGCGCCAGGAAAGTGAAGAAGACG---TGA
Pongo_abelii|21971             GTGGTGGCCAGGTGGCTGTGTGGGGCCAGGAAAGTGAAGAAAACA---TGA
Pan_troglodytes|29695          GTGGTGGCCAGGTGGCTGCGTGGGGCCAGGAAAGTGAAGAAGACA---TGA
Callithrix_jacchus|45121       ATGGTTGTCTGGTGGCTGCGTGGGGCCAGAAAGGTGAAGGAGACA---TAA
Rhesus_macaque|31909           ATAGCTGTCTGGTGGCTGTGTGGGGCTAGAAAGGTGAAGGAGACA---TAA
Gorilla_gorilla|249            ATGGCTGTCTGGTGGCTGCGTGGGGCCAGAAAGGTGAAGGAGACA---TAA
Homo_sapiens|68743             ATGGCTGTCTGGTGGCTGCGTGGGGCCAGAAAGGTGAAGGAGACA---TAA
Pan_troglodytes|29694          ATGGCTGTCTGGTGGCTGCGTGGGGCCAGAAAGGTGAAGGAGACA---TAA
Loxodonta_africana|24713       ---------------------------------------------------
Oryctolagus_cuniculus|2791     ACAGTGGCCAGATGCCTGTGTGGGGCCAAGAAGCTGAAAGAGATG---TGA
Ochotona_princeps|6294         ---------------------------------------------------
Tursiops_truncatus|8861        ---------------------------------------------------
Bos_taurus|12729               CTGGTGGCCAGGTGGCTGTGTGGGGCCAGGAAGCTGAAGAAGGCC---TGA
Equus_caballus|14193           ---------------------------------------------------
Equus_caballus|14192           ATGGTGGCCAGGTGGCTGTGTGGGGCCAGGAAGCTGAAGAAGGCC---TGA
Equus_caballus|14190           ---------------------------------------------------
Canis_familiaris|22019         ATGGTGGCCAGGTGGCTGTGTGGGACCAGGAAGCAGAAGAAGGCC---TGA
Canis_familiaris|22015         ATGGTGGCCAGGTGGCTGTGTGGGACCAGGAAGCAGAAGAAGGCC---TGA
Caenorhabditis_elegans|25270   AAGGTACTTGGAAAA---TGTTTGACCAAAAAAACAAAATCTGAT---TAA
Caenorhabditis_elegans|14340   CACCTGCTCGCGAAACTTGGTTTCTCTGGAGATAAGGAGAAATCTGAGTAG
                                                                                  

multiple sequence alignment in CLUSTALW format


Bombyx_mori|10100             ------------------------------------------------------------
Bombyx_mori|10287             MADDL---------------------KVAIEEIFSNPRYKEIAKETSLIYH---------
Gasterosteus_aculeatus|7779   QTLLH----GIQFGTILAGLAVLESAKILTVSLIGGSHYLLLDEISNNLHQRGHEVRMLL
Fugu_rubripes|42781           SNNRM---KTQLWMFPLLVLPLLQSAKILTVCLIGGSHYLLLDEISQNLHQHGHDVRMLL
Xenopus_tropicalis|14016      MAAGR---KSLTLGLLVQHFVLLQGAKILTVNFFGKSHYLWMDGISRILHNHGNEVTMFR
Xenopus_tropicalis|14011      ------------------------------------------------------------
Xenopus_tropicalis|26913      ------------------------------------------------------------
Xenopus_tropicalis|26895      ----------------------------KLLMFVGGSHYLWMDEISRILHNHGHQITMFL
Dipodomys_ordii|6771          MTGLR---MLNLITFFLPGILFSESAKILTMSVLXXXXXXXXXXXXXXXXXXXXXXXXXX
Anolis_carolinensis|8691      ------------------------------------------------------------
Ornithorhynchus_anatinus|5664 ------------------------------------------------------------
Echinops_telfairi|10765       ----M---AVRALSLLVTGPLLSEAAQILTLSLLGGSHYLLMDQVSQILQDHGHNVTMLQ
Tupaia_belangeri|11390        MAGQR---TLLFLGFLLPAVQFSETAKILTLVTVGGSHYLLMDRVSQILQDHGHNVSMLL
Felis_catus|3951              MAGQR---VLLLAGFLLPGFLLSEAAKILTLSLVGGSHHLLLDRVSQILQDHGHNVTMLH
Bos_taurus|1528               --------KYFPVGVFLD------------------------------------------
Tarsius_syrichta|6718         MAGRR---ALLLVGFLL-GVLLLEATKILTISSAGGSHYLLMDRVSQILQEHSHRVTMLL
Dasypus_novemcinctus|13029    -----------------------------------GSHYLLMDRISQILQDYGHDVTMLK
Choloepus_hoffmanni|9385      MPGQP---ALLLVCLLLRGVLLSEFPQILFWVXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Mus_musculus|35592            MAAHR---SWLLVSFFLLEVLLLEAAKILTISTLSASHYILMNRVSQILQGGGHDVIKLL
Rattus_norvegicus|24690       ------------------------------------------------------------
Pteropus_vampyrus|13655       MAGQREPLLLLLAGLLLPELLLSEAAKIFTMTLLGGSHYLLMSQVSQVLQDHGHNVTMFH
Otolemur_garnettii|6468       MAGQR---VLLLVGFFYPGILLSEAAKILTVSTMGGSHYLLMDRVSQILQDHGHNVTMLN
Microcebus_murinus|6005       ------------------------------------------------------------
Microcebus_murinus|16234      MAGRW---VLLLVGSLLPGILLSEAAEILTMSTLGGSHYLLMGRVAEILQDHGHHVTMLR
Tarsius_syrichta|4386         MAGQQ---ALLLVGFLLPGVLLSEAAKILTISTVGGSHYLLMDRVSQILQDHGHNVTMLN
Rhesus_macaque|23767          MAGQR---VLLLVGFLLSGVLLSEAAKILTISTLGGSHYLLLNRVSQILQEHGHNVTMLP
Homo_sapiens|19076            MVGQR---VLLLVAFLLSGVLLSEAAKILTISTLGGSHYLLLDRVSQILQEHGHNVTMLH
Gorilla_gorilla|232           MAGQR---VLLLVAFLLSGVLLSEAAKILTISTLGGSHYLLLDRVSQILQEHGHNVTMLH
Pongo_abelii|15172            MAGQR---VLLLVAFLLSGVLLSEAAKILTISTLGGSHYLLLDRVSQILQEHGHNVTMLH
Pan_troglodytes|14000         MAGQR---VLLLVAFLLSGVLLSEAAKILTISTLGGSHYLLLDRVSQILQEHGHNVTMLH
Callithrix_jacchus|36381      MAGQR---VLLLVGFLLPGVLLSEAAKILTISTV--------------------------
Rhesus_macaque|23771          MAGQR---VLLLVGFLLSGVLLSEAAKILTVSTVGGSHYLLMDRVSQILQDHGHNITMLN
Gorilla_gorilla|237           MAGQR---VLLLVGFLLPGVLLSEAAKILTISTVGGSHYLLMDRVSQILQDHGHNVTMLN
Homo_sapiens|19345            MAGQR---VLLLVGFLLPGVLLSEAAKILTISTVGGSHYLLMDRVSQILQDHGHNVTMLN
Pan_troglodytes|13983         MAGQR---VLLLVGFLLPGVLLSEAAKILTISTVGGSHYLLMDRVSQILQDHGHNVTMLN
Loxodonta_africana|7368       MAAPQ---ALFLLCFFLPGALLSEAAKILTVSLIGGSHYLLMDQVSQILQDHGHNVTLFQ
Oryctolagus_cuniculus|3972    MDGQR---ALLLGGFLLSGTLLSEAAKILTVSTLGGSHYLLVDRVSQILQDHGHNVTMLH
Ochotona_princeps|5467        KAGHR---MLLLGCFLLSGALFSDAAKILTVATLGGSHYLLVARVSQILQDHGHNVTMLH
Tursiops_truncatus|8370       MAGQQ---ALLLVGFLLPSLLLSEAAKILTLSLVGGSHFLLVNQVSQILQDHGCNVTMLL
Bos_taurus|11330              MAGQQ---ALLLFGFILPGLLFSEAAKILTVSLVGGSHFLLMHQISQILQDHGHNVTMLL
Equus_caballus|8683           ------------------------------------------------------------
Equus_caballus|8385           MMRPR---VLLLICFLLPGLLPSEAAKILTVSLVGGSHHLLMDRVSQILQDHGHNVTVLL
Equus_caballus|6958           MGSLR---ALLLISSLLPGLLLSEAAKILTLSLLGGSHFLLMDRVSQILQDHGHNVTMLL
Canis_familiaris|24633        MARQW---ALLLACLLLSGFLLSEAAKILTVSSLGGSHYLLLDRVSQILQDHGHNVTMLL
Canis_familiaris|23400        TMAGR---ALLLGGLLLPGVLLSEAARILTVSLVGGSHHLLMDQVSQILQDHHHNVIMLH
Caenorhabditis_elegans|22531  MRLGT---FIFLLTFLF--FECYSSKILIFNPIFGFSHVKFISKMADIIADHGHHVTLFQ
Caenorhabditis_elegans|17034  MRV-----LVFLLLFVLPAASCYKI--LVSVPKFGFSHMQTMGKLADILVEAGHDVTFLM
                                                                                          

Bombyx_mori|10100             -------------------------------------------------------MNHIF
Bombyx_mori|10287             -----------DRPVSPGAELVHWVEHV-----VKTR---GALHLRSPALQMPLYQKLYL
Gasterosteus_aculeatus|7779   QLGNPVITGFSYAGRADSYQMTTWSMGEDYVTEYNGW---FMEQQTQFLLG-RDNFTTFL
Fugu_rubripes|42781           QLGNPVITGFSYVGGADSYQKSAWSLGDKYIKEYNDW---FLEQQTQFLLG-RETFNNFL
Xenopus_tropicalis|14016      QIADGLLPD--YQMQESPYRLVTWSLDENYLKEYGEF-----FRNSKYNLKGSDEVSSHL
Xenopus_tropicalis|14011      ------------------------------------------------------------
Xenopus_tropicalis|26913      ------------------------------------------------------------
Xenopus_tropicalis|26895      QIGDGMLPG--KCILKGFCHDFYAELSEGASATHKER---KNFLYWGWNAT-RANSYVLL
Dipodomys_ordii|6771          XXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXXXXXXXXX
Anolis_carolinensis|8691      --------------------------------------------------------EAYL
Ornithorhynchus_anatinus|5664 -------------KRSGTYQITTWSSSEDYKRKYLKD---FEDYQEDFLQG-RNYFSRFL
Echinops_telfairi|10765       QDGISLISX--XXXXXXXXXXXXXXXXXXXXXRFMNY---FNFFVEEAFNG-XXXXXXXX
Tupaia_belangeri|11390        RRGNSLISD--FKEGQKSYEVISWFPPEDNQKEFNKC---FDFFMEEALNG-XXXXXXXX
Felis_catus|3951              QRGNSFISD--FKEKEISYQVIPWLPPEDCNKGLKNN---FDFFIEEALGG-XXXXXXXX
Bos_taurus|1528               -----------LEKEEHSFQVISWHSPGDLENEIRKR---LDLFVTEALHN-RKKSEHFV
Tarsius_syrichta|6718         HDGLVLTX---XXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXX-XETFENLL
Dasypus_novemcinctus|13029    QDALLMS----XXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXXLTFEHFL
Choloepus_hoffmanni|9385      XXXXXXX----FKEEEKSYQMITWHPPEYYRKEFMKH---LNLFLEEALHS-RLTFEDFL
Mus_musculus|35592            YEGGDIPD---FRKENSSYQVINWRLPEDQQKTFENR---WHRLIDEYAYG-RSKYHTLL
Rattus_norvegicus|24690       ----------------------------------------------------RFEHHTIV
Pteropus_vampyrus|13655       LKEGLLMSG--FKEVEKSYKVITWLAPEDCNRELKKS---VEFIIGEGLEG-RGRFENMF
Otolemur_garnettii|6468       KRGNSLMSD--FKEEE-SYQVISWLAPGAHQREI------LEFHFLEAFNG-RGIFENLL
Microcebus_murinus|6005       -----------------------------------------------------GKFSKLL
Microcebus_murinus|16234      QGGNSLISD--FKEEEKSYQVISWFPPEDYQKEFEKV---SSLFVEEGYNE-RETFQTFL
Tarsius_syrichta|4386         QEGNSLMTD--FKKEEKSYQVISWLPPKDHQKKFNKY---FDFFMEEALHG-RGISENFL
Rhesus_macaque|23767          QSGNLLIPD--IKEEEKSYQVIRWFLPEDNQKRITKH---FNSYIETALDG-RDEFECLL
Homo_sapiens|19076            QSGKFLIPD--IKEEEKSYQVIRWFSPEDHQKRIKKH---FDSYIETALDG-RKESEALV
Gorilla_gorilla|232           QSGKFLIPD--IKEEEKSYQVIRWFSPEDYQKRIKKH---FDSYIETALDGSRKEFEALV
Pongo_abelii|15172            QSGKFLIPD--IKEEEKSYQVIRWFSPEDYQKRIKKH---FDSYIETALDG-RKEFEVFV
Pan_troglodytes|14000         QSGKFLIPD--IKEEEKSYQVIRWFSPEDYQKRIKKH---FDSYIETALDG-RKEFEVFV
Callithrix_jacchus|36381      --------D--FKKEEKSYQVISWLAPEDHQREFKKS---FNFFLEETLSG-REKFENLL
Rhesus_macaque|23771          HKRGPFMPD--FKKEEKSYQVISWLAPEDHQREFKKS---FDFFLEETLGG-RGNFENLL
Gorilla_gorilla|237           YKRGPFMPD--FKKEEKSYQVISWLAPEDHQREFKKS---FDFFLEETLGG-RGKFENLL
Homo_sapiens|19345            HKRGPFMPD--FKKEEKSYQVISWLAPEDHQREFKKS---FDFFLEETLGG-RGKFENLL
Pan_troglodytes|13983         HKRGPFMPD--FKKEEKSYQVISWLAPEDHQREFKKS---FDFFLEETLGG-RGKFENLL
Loxodonta_africana|7368       QEGLSLLSD--FKEEKKTYQIIKWLPPEDYKKEFMKY---FDFFIEESFHG-RGTFEKYL
Oryctolagus_cuniculus|3972    QRGNSLMSD--FKEEPKSYQVITWLPPQDHRKEFKKC---FDFFMEEALHG-RGSFENFL
Ochotona_princeps|5467        QGGNSLMAG--FKEEEKSXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXX-XGTFENLL
Tursiops_truncatus|8370       QRGNLLPPG--FTEEEKSYKVINWFLPEDDNKEFKKS---FHFFMEETFEG-RSTFEHVL
Bos_taurus|11330              QKGNLLLPG--FKEEEKSYKVFNWFLPEDCNEEFKRS---FHSFMEKTFGG-RCKFEHFL
Equus_caballus|8683           ------------KEEEKSYQAITWLPPEDYNKEFKKY---FDFFLKEALAG-RDTFENFL
Equus_caballus|8385           QEGNVLIPG--FKEEEKSYQIVTWFPPEDDFKEFLKF---CEFFMEEALAG-RDKFENFL
Equus_caballus|6958           QRANLLIPG--FKEEEKSYQVITWLPPEDYNKEFMNF---FDSFMKDALDG-RDSFADFL
Canis_familiaris|24633        YGGDYLIPNI-LEEKESVYHVISWLLSEEHEKELKKY---FDFFMQEALQGSREAFDNLV
Canis_familiaris|23400        QKGNSLITD--FTEKETSYQVIPWFPPEDYNKRLKEY---VDYFIEEALNG-RHTFGKFL
Caenorhabditis_elegans|22531  PYHIALKNL--DGLVKNKNIEILNYHPTHYEELLKAEPQTFSFFWDSYLVG-NPVIGAFL
Caenorhabditis_elegans|17034  PVDVP------IPQNGTELAKVVLVPTTDAINEIMGHAMKSGAVANLWTHSANSKQGIMW
                                                                                          

Bombyx_mori|10100             D---LQNITIANALMTFENEDVKKLIQNTNESFDVVIAD---YIDTEVYAAFSAL-YGCP
Bombyx_mori|10287             D---LLTVVLVLLIVIYKIVTYITAFP--EESSDPNLTQIDVSSNMVALPKSYKE--SLN
Gasterosteus_aculeatus|7779   N---FMGHLSYQCDRLLGDQEMMTFLQ--KERYDITILD---AFNPCSFILARKLGTGID
Fugu_rubripes|42781           K---FMGHLSHQCDKLLENKEIITFLQ--HENYDVIILD---AFNPCSFILARKL--GVQ
Xenopus_tropicalis|14016      G---LFTHLSRQCKMIFNQTSILNLLK--EEKYDIAVID---SCNPCSFLVSEKL--GIP
Xenopus_tropicalis|14011      -------HLSRQCKMIFNQTSILNLLK--EEKYDIAVID---SFNPCSFLASEKL--GIP
Xenopus_tropicalis|26913      ------------CKMIFNQTSIINLLK--EEKYDIAVID---SFNPCSFLVSEKL--GIP
Xenopus_tropicalis|26895      A---FVGQMSRQCKMIFNQTSILNLLK--EEKYDIAVID---SFNPCSFLVSEKL--GIP
Dipodomys_ordii|6771          X---XXXXXXXXXXXXXXXXXXXXXNV--TDDFD--------SVEFCS-CIAEKL---KP
Anolis_carolinensis|8691      D---LMGHLASQCNFVLNSSKTLISLK--NEKFHLAVID---AFNPCSFLVAEKL--GLP
Ornithorhynchus_anatinus|5664 E---FMGHLATQCSFILNNSDVLDFLK--NQKLDLLVLD---AFDPCTFLIAEKI--GRP
Echinops_telfairi|10765       X---XXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXX---XXXXXXXXXXXXX--XXX
Tupaia_belangeri|11390        X---XXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXX---XXXXXXXXXXXXX--XXX
Felis_catus|3951              X---XXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXX---XXXXXXXXXXXXX--XXX
Bos_taurus|1528               N---LMETLGTRCSYLLRRRDIMDSLK--NENFDLIVVD---AFDFCSFLIAEKL--GKL
Tarsius_syrichta|6718         K---LMERFGTRCGHFLSRKDIMDSLK--NENF---------------------------
Dasypus_novemcinctus|13029    K---FMGQLGTQCNHFLRRKDILESLK--NENFDLVVAE---TFDCCSFLIAEKL--GKP
Choloepus_hoffmanni|9385      N---FMGQLGSQCNVFLRRKDIIDSLK--NENFDLVIVE---TFDYCPLLVAEKL--GKP
Mus_musculus|35592            K---IHQYFADLCSHLLSRKDIMELLQ--KENFDLVLLD---SMDLCSFLIVEKL--GKR
Rattus_norvegicus|24690       K---IHRHFGDLCNHLLSRKDIMEFLK--NANFDLVLFE---SVDYCSSLIVEKL--GKQ
Pteropus_vampyrus|13655       E---YLKSLALQCKHLL-RSDIVDSLK--NENFDLLVVE---GFDFCGFLVAEKL--GKP
Otolemur_garnettii|6468       K---VKEQLGFQCSHLLSRRDIMDSLE--NENFELVIIE---SFDYCPFLITEKL--RKP
Microcebus_murinus|6005       K---LVEQLGFQCSHLLNRRDIMDSLK--NKNFDLVIVE---SFDYCHFLIAEKL--GKP
Microcebus_murinus|16234      K---IMEELGFQCSHLLSKTEIMDSLK--NENFDLVIVE---SFDYCHFLIAEKL--GKP
Tarsius_syrichta|4386         K---FVEQMGFQCSHLLRRRDIMDSLK--NENFDMVIVE---AFDFCPFLIAEKL--GKP
Rhesus_macaque|23767          K---LMEIFGIQCSYLLSRKDIMDSLK--NENFDLVFVE---AFDFCSFLIAEKL--VKP
Homo_sapiens|19076            K---LMEIFGTQCSYLLSRKDIMDSLK--NENYDLVFVE---AFDFCSFLIAEKL--VKP
Gorilla_gorilla|232           K---LMEIFGTQCSYLLSRKDIMDSLK--NENYDLVFVE---AFDFCSFLIAEKL--VKP
Pongo_abelii|15172            K---LMEIFGTQCSYLLSRKDIMDSLK--NENFDLVFVE---AFDFCSFLIAEKL--VKP
Pan_troglodytes|14000         K---LMEIFGTQCSYLLSRKDIMDSLK--NENFDLVFVE---AFDFCSFLIAEKL--MKP
Callithrix_jacchus|36381      N---ILEYLALQCSHFLRRKDIMDSLK--NENFDMVIVE---TFDYCPFLIAEKL--EKR
Rhesus_macaque|23771          K---VLEYLALQCHHFLRRKDIMDSLK--NENFDMVIVE---TFDYCPFLIAEKL--SKP
Gorilla_gorilla|237           N---VLEYLALQCSHFLSRKDIMDSLK--NENFDMVIVE---TFDYCPFLIAEKL--GKP
Homo_sapiens|19345            N---VLEYLALQCSHFLNRKDIMDSLK--NENFDMVIVE---TFDYCPFLIAEKL--GKP
Pan_troglodytes|13983         N---VLEYLALQCSHFLNRKDIMDSLK--NENFDMVIVE---TFDYCPFLIAEKL--GKP
Loxodonta_africana|7368       K---LMEQLGIHCSHLLRRRDIVDSLK--NENFELVVVE---TFDYCPFLIAEKL--GKP
Oryctolagus_cuniculus|3972    K---VMEQLGFQCSHLLRRRDIVESLK--SENFDLVIIE---IFDYCPLLIAEKL--GKP
Ochotona_princeps|5467        K---LMEQLGFQCSHLLRRRDILESLR--SENFDLIVVE---IFDYCPLLLAEKL--GKP
Tursiops_truncatus|8370       A---ILEQLGLPCSHLLRRNDTVNSLK--NENFDLVIVE---IFDYWPFLLAEKL--GK-
Bos_taurus|11330              N---IMELLGHHCSHLLRRKDVMKSLK--NENFDLVIVE---MFDYCPFLVAEKL--GKP
Equus_caballus|8683           K---YMELQGLQCSHLLKRNDIMDSLE--NENFDLLFVD---AFDLCSPLVAEKL--GKP
Equus_caballus|8385           K---FMELLGLQCSHLLKRNDIMDSLK--NENFDLLFVE---GFDLCSLLVAEKL--GKP
Equus_caballus|6958           K---LMELLSLQCSHLLKRNDIMDSLK--NENFDLVIVE---SFDFCPFLVAEKL--GKP
Canis_familiaris|24633        K---LMEQLGIQCSNLLRRSDIMDSLK--NENFDLVFVE---AFDFCSFLIAEKL--GKP
Canis_familiaris|23400        D---FMKLLGLQCSHFLRRKDIMDILK--NENFDLVIIE---NFDYCSFLVAEKL--GKP
Caenorhabditis_elegans|22531  MPKLLGGEFKKTAMEVLSDQKLINELK--DRKFDLVIAE---TFELTGFYLAHLL--DVP
Caenorhabditis_elegans|17034  STDMIGQVSYHNTKNLIDNKALVQQMK--DEKFDIGITE---LFDFSGLAFFEVI--GLK
                                                                                          

Bombyx_mori|10100             LI---WLSS-LRTNWQTLRLIDEPT-NPAYTVS-------SISMNYPPLNFKQRIEELWA
Bombyx_mori|10287             LK-AVLEGK-A-IPL-DFDI---IHNLMNAVEMNTYQIENVSKLLNDPEQKFDVVIAEWM
Gasterosteus_aculeatus|7779   YI-AFHPGT-LNSPL-SMAL---PS-PVSYIPV-------FGSQLSDQMNTWGRAKNLFY
Fugu_rubripes|42781           YV-AFYPGS-LNGPL-SITL---PS-SIASVPV-------FGSQLSDHMNLWGRAQNLFY
Xenopus_tropicalis|14016      FI-ATHPFA-LKNAW-HSGI---PN-LLSIMPA-------YQSQLTDHMNFFERVKNVFF
Xenopus_tropicalis|14011      FI-ATHPFA-VKSPW-HSGI---PN-LLSIMPA-------YQSQLSDHMNFFERVKNVFF
Xenopus_tropicalis|26913      FI-ATHPFA-LKNAW-HSGI---PN-QLSYVPV-------FQTQLTDHMDFFERVKNVLM
Xenopus_tropicalis|26895      II-ATHPLA-LRSSW-HTGI---SS-LLSYMPV-------AHSQLTDHMDFFKRVKNVFA
Dipodomys_ordii|6771          FC-TST------AFW-QLGF---PS-PLSYVPV-------YYPLMSGEMAFWG-VKNILK
Anolis_carolinensis|8691      FI-AVYPGT-FVNAP-RAGI---PS-PLSYVPR-------AQSLLTDRMDFWERLKNCLM
Ornithorhynchus_anatinus|5664 SV-AILSTS-F-NYL-PVWH---PS-PLSYVPV-------QHSSLTDRMGFWGRVKNCLM
Echinops_telfairi|10765       XX-XXXXXX-X-XXX-XXXX---XX-XXXXXXX-------XXXXXXXXXXXXXXXXXXXX
Tupaia_belangeri|11390        XX-XXXXXX-X-XXX-XXXX---XX-XXXXXXX-------XXXXXXXXXXXXXXXXXXXX
Felis_catus|3951              XX-XXXXXX-X-XXX-XXXX---XX-XXXXXXX-------XXXXXXXXXXXXXXXXXFLM
Bos_taurus|1528               FV-SILSTL-V-SRL-DFGL---PS-PLSYVPV-------FQSFLTDHMDFWGRVKNFLM
Tarsius_syrichta|6718         ------------------------------------------------------------
Dasypus_novemcinctus|13029    FV-SVISSS-F-GVV-DFGL---PR-PVSYVPV-------FNSLLTDRMDFWGRVKNFLM
Choloepus_hoffmanni|9385      FV-FIFPNA-F-GVV-DFGL---PQ-PISYVPV-------FDSLLTDRMDFWGRVKNFLM
Mus_musculus|35592            FV-SFLPFQ-F-SYM-DFGL---PNAPLSYAPV-------YGSGLTDQMDFWGRVKNILM
Rattus_norvegicus|24690       FV-LFLAFQ-L-GFM-DFEL---QRVPLSYVPV-------YGSGLTDQMDFWGRVKNFLM
Pteropus_vampyrus|13655       FV-TTLPCT-F-GTL-DFGL---PS-PISYVPV-------FTSFLTDQMDFWGRVKNFLM
Otolemur_garnettii|6468       FV-SILTTS-F-AIL-DFGL---PS-PLSYVPV-------YSSLLTDHMDFWGRVRNFVT
Microcebus_murinus|6005       FV-SILPTT-F-GTV-HFGL---PN-SLSYVPV-------FHSSLTDHMDFWGRVKNFLT
Microcebus_murinus|16234      FV-SILTTS-F-GRL-DFGL---PS-PLSYVPV-------YNSLLTDHMDFWGRVKNFLA
Tarsius_syrichta|4386         FV-SILASS-F-GSL-DIGL---PS-PLSYVPV-------FGSLLTDHMDFWSRVKNFLM
Rhesus_macaque|23767          FV-AILPTR-F-GSL-EFGL---PS-PLSYVPV-------FHSLLTDHMDFWGRVKNFLM
Homo_sapiens|19076            FV-AILPTT-F-GSL-DFGL---PS-PLSYVPV-------FPSLLTDHMDFWGRVKNFLM
Gorilla_gorilla|232           FV-AILPTT-F-GSL-DFGL---PS-PLSYVPV-------FHSLLTDHMDFWGRVKNFLM
Pongo_abelii|15172            FV-AILPTT-F-GSL-DFGL---PS-PLSYVPV-------FHSLLTDHMDFWGRVKNFLM
Pan_troglodytes|14000         FV-AILPTT-F-GSL-DFGL---PS-PLSYVPV-------FHSLLTDHMDFWGRVKNFLM
Callithrix_jacchus|36381      FV-AILPTS-F-SSV-EFGL---PS-PLSYVPV-------FHSFLTDHMDFWGRVKNFLM
Rhesus_macaque|23771          FV-AILSTS-F-GSL-EFGL---PI-PLSYVPV-------FRSLLTDHMDFWGRVKNFLM
Gorilla_gorilla|237           FV-AILSTS-F-GSL-EFGL---PI-PLSYVPV-------FRSLLTDHMDFWGRVKNFLM
Homo_sapiens|19345            FV-AILSTS-F-GSL-EFGL---PI-PLSYVPV-------FRSLLTDHMDFWGRVKNFLM
Pan_troglodytes|13983         FV-AILSTS-F-GSL-EFGL---PI-PLSYVPV-------FRSLLTDHMDFWGRVKNFLM
Loxodonta_africana|7368       FV-SILPSS-F-GPV-DFGL---PS-PLSYVPT-------FHSLLTDRMDFWGRMKNLLM
Oryctolagus_cuniculus|3972    FV-SLLSSS-F-GTL-DFGL---PS-PLSYVPV-------FSSLLTDHMSFWGRMKNFLM
Ochotona_princeps|5467        FV-SLLASS-F-GAL-DFGL---PS-PLSYVPV-------FSSLLTDHMNFWGRVKNFLT
Tursiops_truncatus|8370       ------------------------S-PLSYVPV-------FYSLLTDHMD-WG-VKNSLM
Bos_taurus|11330              FV-AILPSA-L-GTV-DFGL---PS-PLSYVPV-------FYSLLTDQMDFWGRVKNFLM
Equus_caballus|8683           FV-SVLPTT-F-GYM-DFGL---PS-PLSYVPV-------FNSLLSDRMGFWDRVKNFLM
Equus_caballus|8385           FV-SIISTS-F-GFI-DFGL---PS-PLSYVPV-------FDSLLSDRMDFWDRVRNFLK
Equus_caballus|6958           YV-SILPSS-F-DAV-DFGQ---PR-PLSYVPT-------LHSFLTDHMDFWGRLKNFLM
Canis_familiaris|24633        FV-SILPTP-F-GSV-DLGL---PS-PVSYVPV-------FHSLLTDCMDFWSRVKNFLM
Canis_familiaris|23400        FV-SILSSS-F-GTI-DFGL---PC-PLSYVPV-------FHSLLTDHMDFWGRVKNFLM
Caenorhabditis_elegans|22531  CI-PMMSAVRYPIFNDQFGQ---PS-LLGHVPQ-------IGSAVAGEAGFYDRLNDMFR
Caenorhabditis_elegans|17034  NVMGAHTTSVFEGTLMATGA---PI-LPSFVPA-------SQTFTDDSGSILSRLNNLYM
                                                                                          

Bombyx_mori|10100             QWKWQIVK-RLYIVSQEEKIYDNHFVPFIRKRGIKPPNYEDLIYNASLVLANDHHSLGNL
Bombyx_mori|10287             FTEICVGTKGRQETLYANEIVPIIKK---R--GLVPPSFNDLLYNSSLVLSNTHVSYAAA
Gasterosteus_aculeatus|7779   SLLAPIGQELVWSTF--REVAERHFD---S--DSPPGGLEELHQGAELWAFNTDFSLEFP
Fugu_rubripes|42781           SFMAPVGQKLVWSTF--ADVAERHLE-------SPPDGLKDLHEGAELWAFNTDFSLEFP
Xenopus_tropicalis|14016      YIDSAVFDCKIHSLF--DDVIEEHFP---V--GSRPT-FVELYKKTALWMYNTDFTIEFP
Xenopus_tropicalis|14011      YIDSGECSFLVAIFL--FSYYTEVYS---KAVGSRPS-FAELYKKAALWMYNTDFTIEFP
Xenopus_tropicalis|26913      YIGSRVEESKIHSLF--DDVIEEHFP---A--GSRPT-FVELYKKTALWMYNTDVTLEFS
Xenopus_tropicalis|26895      YIGSVVVESKIHSLF--DDVIEEHFP---A--GSRPT-FVELYKKTSLWMYNTDFTIEFP
Dipodomys_ordii|6771          SVAFSMKQKKKYSTF--DNTIKQHFA---E--GSRPV-LAHLPQKTEFWFVNSDFALDFV
Anolis_carolinensis|8691      SLLSLAINNQIYDKF--DSVIRDHFP---A--RSRPA-LPELYLKAELWIYDTDFSIEFA
Ornithorhynchus_anatinus|5664 FLSFPVTQRQIQAQF--DEVIKEHFP---S--GARPS-LPDLYRKPELWMVNSDFSFEFT
Echinops_telfairi|10765       XXXXXXXXXXXXXXX--XXXXXXXXX---X--XXXXX-XXXXXXXXXXXXXXXXXXXXXX
Tupaia_belangeri|11390        XXXXXXXXXXXXXXX--XXXXXXXXX---X--XXXXX-XXXXXXXXXXXXXXXXXXXXXX
Felis_catus|3951              FFDFTMKQRQIQSAY--DNTIKEHFP---E--DSRPV-LSHLLKKAELWFVNSDFALEFA
Bos_taurus|1528               SLVFSVEQWKIHSTF--DNTIKEHFQ---E--GSRPV-LSHLLKKAELWFVSSDFAFEFA
Tarsius_syrichta|6718         ------------------------------------------------------------
Dasypus_novemcinctus|13029    SFDFSVKQWRIHSQY--EEAIREHFP---E--GSRPV-LSHLLLKAELWFINSDFAFDFS
Choloepus_hoffmanni|9385      FFDFSMKQRQIQAQY--DDAIREHFP---E--GSRPV-LSHLLLKVELWFVNSDFALDFA
Mus_musculus|35592            FFHFTKKRRDIFSQY--GNTVQEHFA---E--GSQPV-LSDLLLKAELWFVNSDFALDFA
Rattus_norvegicus|24690       FFDLSRKQREILSQY--DSTIQEHFA---E--GSRPV-LSDLLLKAELWFVNCDFAFEFA
Pteropus_vampyrus|13655       FIDLFMKQWQLLSTY--EDIIKEHFQ---E--GSRPV-LSHLLRKAELWFVNSDFAFEFA
Otolemur_garnettii|6468       FFTFSRRQWQVQSMF--DNTIKEHFP---E--GSRPV-LSHLLLKAELWFVNSDFAFDFA
Microcebus_murinus|6005       FFTFSRRQWQVQSMY--DNIIKEHFP---E--GSRPV-LSQLLLKAELWFVNSDFAFDFA
Microcebus_murinus|16234      FFTFSRRQWQVQSMY--DNTIREHFP---E--GSRPV-LSQLLLKAELWFVNSDFAFDFA
Tarsius_syrichta|4386         FFHFTRRQWQMHSKF--DNTIKEHFS---E--GSRPV-LSHLLRKSELWFVNSDFAFDFS
Rhesus_macaque|23767          FFSFSRSQWDLLSTF--DNTIKEHFP---E--GSRPV-LSHLLLKAELWFVNSDFAFDFA
Homo_sapiens|19076            FFSFSRSQWDMQSTF--DNTIKEHFP---E--GSRPV-LSHLLLKAELWFVNSDFAFDFA
Gorilla_gorilla|232           FFSFSRIQWDMQSTF--DNTIKEHFP---E--GSRPV-LSHLLLKAELWFVNSDFAFDFA
Pongo_abelii|15172            FFSFSRSQWDMQSTF--DNTIKEHFP---E--GSRPV-LSHLLLKAELWFVNSDFAFDFA
Pan_troglodytes|14000         FFSFSRSQWDMQSTF--DNTIKEHFP---E--GSRPV-LSHLLLKAELWFVNSDFAFDFA
Callithrix_jacchus|36381      FFSFCRRQWHKQSTF--DNTIQEHFT---E--DSRPV-LSHLLLKAELWFVNSDFAFDFA
Rhesus_macaque|23771          FFSFCRRQWHMQSTF--DNAIKEHFP---E--GSRPV-LSHLLLKAELWFINSDFAFDFA
Gorilla_gorilla|237           FFSFCRRQQHMQSTF--DNTIKEHFT---E--GSRPV-LSHLLLKAELWFINSDFAFDFA
Homo_sapiens|19345            FFSFCRRQQHMQSTF--DNTIKEHFT---E--GSRPV-LSHLLLKAELWFINSDFAFDFA
Pan_troglodytes|13983         FFSFCRRQQHMQSTF--DNTIKEHFT---E--GSRPV-LSHLLLKAELWFINSDFAFDFA
Loxodonta_africana|7368       FFGFSMKQRQIHSQY--DNTIREHFP---E--GSRPV-LSQLLQKAELWFVNSDFAFDFA
Oryctolagus_cuniculus|3972    FFGFSMKQWQIQSKF--DNSIKEHFQ---E--GSRPV-LSHLLQKAELWFVNSDFAFEFA
Ochotona_princeps|5467        FFGFSMKQRKLQSMF--DNSIKEHFR---E--GSRPI-LSHLLEKAELWFVNSDFAFEFA
Tursiops_truncatus|8370       FFG---------------------------------------------------------
Bos_taurus|11330              FFEFFKKQWKIQSAY--DDTIKEHFP---D--DSRPV-LSHLLTKAGLWFVNTDFAFDFA
Equus_caballus|8683           FFDFSVKQWQTHSTF--DNIIKEHFP---E--GSRPV-LSHLLKKAELWFVNTDFAFDFA
Equus_caballus|8385           FFDFSMKQWQIHSTF--DNTIKEHFP---E--GSRPV-LSHLLKKAELSLVNSDFAFDFA
Equus_caballus|6958           FLNFSMRQRQIHSKF--DNTIKEHFP---E--GSRPV-LSHLLKKAELWFVNSDFAFDFA
Canis_familiaris|24633        FFDFFMKQWQIQSTF--DKTIKEHFP---E--GARPV-LSHLLKKAELWFVNSDFALEFA
Canis_familiaris|23400        FFNFSRKQWQIQSSY--DNAIKEHFP---E--GSRPV-LSNLLKKAELWFVNSDFAFDFA
Caenorhabditis_elegans|22531  FFFMGISQEQLNKYQ--NYFIEEAIG------RPVPF-WKDLVKQSPIYITNSNPYLDYA
Caenorhabditis_elegans|17034  TYWSYQFQNKIQSFA--QKALDEHYE---K--GKAPK-IWNLVSDITWFFVNSDPIFDFP
                                                                                          

Bombyx_mori|10100             PKTPQNFKQVGGFHIS----SVVKPLDK-VLQNIMDSSKD-GVVYFSMGSAWQSKDI-PE
Bombyx_mori|10287             TRLPQNYKPIGGFHID----EEVKPLPE-VRN---------------------------S
Gasterosteus_aculeatus|7779   QPLMPYTVLVGGLL-N----KPAQPPEQ-DIELWISNFGEAGFVVVTLGSMVSSVSV--D
Fugu_rubripes|42781           QPLLPFTVLVGGLL-N----QPAKPPEQ-DLELWISSFGDAGFIIVTLGSMVSSISV--D
Xenopus_tropicalis|14016      HAFFPCSVHW----------RCIGKTSK--------------ACLTGIGALYLSVRR---
Xenopus_tropicalis|14011      HAFFPNVLYIGGVL-A----KPAKPVSQ-ELEHFISQSGEHGFILVTFGSMIPSNPL--T
Xenopus_tropicalis|26913      HPFFPNVLYIGGLL-A----KPANPVSQ-ELEDFISQSGEHGFIIVAFGSMVSSSPF--T
Xenopus_tropicalis|26895      HPLLPHVLYIGGLL-T----KPAKPVSQ-ELEHFISQSGEHGFIIVAFGSMMASSPY--T
Dipodomys_ordii|6771          RPLFPNTVYIGGIL-D----KPVMPIPQ-ELENFISNF-NSVFVLVSLGSILNWFQS--Q
Anolis_carolinensis|8691      RPLLPNTVYIGGLL-A----KPAKPLPQ-EFEDFIERTGEAGFIIVTLGSMLSSIPF--P
Ornithorhynchus_anatinus|5664 QPLLPNTVYIGGLM-A----KPGKPLPQ-EFEDFIASSGEAGFILVTLGSMVASFRV--L
Echinops_telfairi|10765       XXXXXXXXXXXXXX-X----XXXXXXXX-DLENFIAKFGDSGFILVTLGSMLHNYQI--Q
Tupaia_belangeri|11390        XXXXXXXXXXXXXX-X----XXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXX--X
Felis_catus|3951              RPLLPNTVYVGGLM-A----RPVTPVPQ-EFENFIAKFGDSGFVLVALGSMVSTFQS--Q
Bos_taurus|1528               RPLFPNTVNVGGLM-V----KPIKPVPQ-A------------------------------
Tarsius_syrichta|6718         --------------------------SR-DLEDFIAKFGDSGFVLVALGSSVNLYQT--Q
Dasypus_novemcinctus|13029    RPLLPNTVYIGGIM-A----KTSKPVSQ-DFENFIAKFGDSGFVLVALGSMSSTYQS--Q
Choloepus_hoffmanni|9385      RPLLPNTVYIGGLT-A----KATKPVPQ-XXXXXXXXXXXXXXXXXXXXXXXXXXXX--X
Mus_musculus|35592            RPLFPNTVYVGGLL-D----KPVQPIPQ-DLEDFISQFGDSGFVLVALGSVVSMIQS--K
Rattus_norvegicus|24690       RPLFPNIVYVGGLL-D----KPVQSIPQ-DLENFITQFGDSGFVLVALGTVATKFQT--K
Pteropus_vampyrus|13655       RPLLPNTVYIGGLM-A----KPTKAVPQ-EFETFIAKFGDSGFVLVVLGSMVDSFQS--Q
Otolemur_garnettii|6468       RPLLPNTVYVGGLM-A----KPTKPVPQXXXXXXXXXXXXXXXALVTMGSKVNIHF---K
Microcebus_murinus|6005       RPLLPNTVYVGGLM-A----KPTKPVPQ-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQ
Microcebus_murinus|16234      RPLLPNTIYVGGLI-A----KPTKPVPQ-XXXXXXXXXXXXXXXXXXXXXXXXXXXX--X
Tarsius_syrichta|4386         RPLLPNTVYVGGLM-A----RPXXXXXX-DLEDFIAKFGDSGFVLVALGSIVSLYQI--Q
Rhesus_macaque|23767          RPLLPNTVYVGGLM-E----KPIKPVPQ-DLENFIANFGDAGFVLVAFGSTLNTQQS--Q
Homo_sapiens|19076            RPLLPNTVYIGGLM-E----KPIKPVPQ-DLDNFIANFGDAGFVLVAFGSMLNTHQS--Q
Gorilla_gorilla|232           RPLLPNTVYIGGLM-E----KPIKPVPQ-DLENFIANFGDAGFVLVAFGSVLNTHQS--Q
Pongo_abelii|15172            RPLLPNTVYIGGLM-E----KPIKPVPQ-DLENFIANFGDAGFVLVAFGSTLNTHQS--Q
Pan_troglodytes|14000         RPLLPNTVYIGGLM-E----KPIKPVPQ-DLENFIANFGDAGFVLVAFGSTLNTHQS--Q
Callithrix_jacchus|36381      RPLLPNTVYVGGLM-E----KPIKPVPQ-DLENFIAKFGDSGFVLVTLGSMVNTCQN--R
Rhesus_macaque|23771          RPLLPNTVYVGGLM-E----KPIKPVPQ-DLENFIAKFGDSGFVLVTLGSMVNTCQN--P
Gorilla_gorilla|237           RPLLPNTVYVGGLM-E----KPIKPVPQ-DLENFIAKFGDSGFVLVTLGSMVNTCQN--P
Homo_sapiens|19345            RPLLPNTVYVGGLM-E----KPIKPVPQ-DLENFIAKFGDSGFVLVTLGSMVNTCQN--P
Pan_troglodytes|13983         RPLLPNTVYVGGLM-E----KPIKPVPQ-DLENFIAKFGDSGFVLVTLGSMVNTCQY--P
Loxodonta_africana|7368       RPLLPNTVYVGGLM-A----KPIKPVPQ-DLENFIAKFGDSGFILVSMGSMLSTYQT--Q
Oryctolagus_cuniculus|3972    RPLNPNTVYIGGLM-V----KPIKPVSQ-DLENFIAKYGDSGFVLVALGSMVSTYQT--W
Ochotona_princeps|5467        RPLNPNTVYVGGLM-V----KPIKPIPQ-DLENFIAKFGDSGFILVALGSMVSTYET--Q
Tursiops_truncatus|8370       ------------------------------------------------------------
Bos_taurus|11330              RPLLPNTVCIGGLM-S----KPVKPVSQ-EFENFITKFGDSGFVLVSLGSMVSFIRS--Q
Equus_caballus|8683           QPLLPNTVYVGGLM-A----KPVKAVPQ--------------------------------
Equus_caballus|8385           RPLLPNTVYVGGLM-A----KPVKAVPP-EFENFIAKFGDSGFILVALGSVVNIFQS--Q
Equus_caballus|6958           RPLLPNTVYVGGLM-A----KPVKAVPQ-EFENFIAKFGDSGFVLVALGSMISGSSS--Q
Canis_familiaris|24633        RPLLPNTVYVGGLM-V----RPVKPVPQ-EFENFIAKFGDSGFVLVALGSLVNLYQS--Q
Canis_familiaris|23400        RPLLPNTVYVGGLM-A----RPVKPVPQ-EFENFIAKFGDSGFVLVALGSMVSTVQT--Q
Caenorhabditis_elegans|22531  VPSTAAIVQVGGITMDLKKLKQVGELPE-EYENILKEREST--VLISFGSVIRSYEM-PE
Caenorhabditis_elegans|17034  KPLPQNIVEIAGIS-V----PEIKPVGK-EWDEILSKRSKN--VLVSFGSIASPTTM-PE
                                                                                          

Bombyx_mori|10100             HIVNELLKVFGNLKQ-TVIWKFEKNL----NDLPKNVHIVQWAPQTSILAHPNCLLFISH
Bombyx_mori|10287             ETEIQNHNGAA---------------------------------------HPNCVLFITH
Gasterosteus_aculeatus|7779   SLLVELVAGFSRIPQ-GVIWRYDPERWPSHLDRPPNLRLMDWLPLNDLLGHKKVRVFVTH
Fugu_rubripes|42781           PLLTELVAGFSQVPQ-GVLWRYDPQRWPSHLDRPSNLRLVDWLPLNDLLGHTKARLFITH
Xenopus_tropicalis|14016      ------------------AWVYPCDIWLHDTIQSTH------------------------
Xenopus_tropicalis|14011      EFVKEMNDGFAKIPQ-KVIWRYRISEWPKELQLAPNVKIMNWIPQNDLLGHPKARLLVTH
Xenopus_tropicalis|26913      EFVKEMNDGFAKIPQ-KVIWRYRISEWPKEVQLAPNVKIMDWISQNDLLGHPKARLLVTH
Xenopus_tropicalis|26895      EFVKEMNDGFAKIPQ-KVIWRYRISEWPKELQLAPNVKIMNWIPQNDLLGHPKAHLLVTH
Dipodomys_ordii|6771          TLLEEMNNTLALLPQ-GLIWNC-SSLWPNNFKLATNVKIMDWIPQNDLLAHPSIRVFVTH
Anolis_carolinensis|8691      HLLKEINNGFAQLPQ-GVLWRYQASRWPKEIKLAPNVKLAEWLPQNDLLGHPKVQLFVTH
Ornithorhynchus_anatinus|5664 EVMKEMNAGFALLPQ-AVIWRFQLSQWPKEVPLATNVKIVEWLPQNDLLAHPKAKLLVTH
Echinops_telfairi|10765       DILKEMNKAFAHRPQ-GVIWRYKTSEWPKDVQLAANVKLVDWLPQSDLLAHPSIRLFVTH
Tupaia_belangeri|11390        XXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHSSIRLFVTH
Felis_catus|3951              ELLREMNSAFAHLSQ-GVIWKYKPSHWPKDVKLAANVKIVDWLPQNDLLAHPRIRLFVTH
Bos_taurus|1528               ---EGEEAVYT----------------------------------TDPICHSSVH-----
Tarsius_syrichta|6718         EILKEMNSAFSHLPQ-GVIWNCQHSH-PNDVNLSANVKIMDWFPQSDLLAHPNIHLFVTH
Dasypus_novemcinctus|13029    EIL-EMNSAFAXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPSIRLFVTH
Choloepus_hoffmanni|9385      XXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPSIRLFVTH
Mus_musculus|35592            EIIKEMNSAFAHLPQ-GVLWTCKSSHWPKDVSLAPNVKIMDWLPQIDLLAHPSIRLFVTH
Rattus_norvegicus|24690       EIIKEMNNAFAHLPQ-GVIWACKDSHWPKDVTLAPNVKIMDWLPQTDLLAHPSIRLFVTH
Pteropus_vampyrus|13655       NVLKEMNSAFAHLPQ-GVIWRYKSSHWPKDIKLSANVKMVDWLPQNDLLAHPRIRLFVTH
Otolemur_garnettii|6468       EVLKELNRAFPHLPQ-GVIWRCKHSHWPKDVNVAPNVKLMEWLPQSDLLA----------
Microcebus_murinus|6005       EVLKEMNSAFAHLRQ-GVIWKCKHSHWPKDVNVSTNVKLMDWLPQSDLLAHPSIRLFVTH
Microcebus_murinus|16234      XXXXXXXXXXXXXXX-XXXWKCKHSHWPKDANVSTNVKLMDWLPQRDLLAHPSIRLLVTH
Tarsius_syrichta|4386         KILKEMDSAFAHLPQ-GVIWNCQNSLWPNDVNLSLNVIINDLLSQTDLLAHPRIWLFVIH
Rhesus_macaque|23767          EVLKKMHSAFSHLPQ-GVIWKCQSSHWPKDVHLATNVKIVDWLPQSDLLAHPSIRLFVTH
Homo_sapiens|19076            EVLKKMHNAFAHLPQ-GVIWTCQSSHWPRDVHLATNVKIVDWLPQSDLLAHPSIRLFVTH
Gorilla_gorilla|232           EDLKKMHSAFAHLPQ-GVIWTCQSSHWPRDVHLATNVKIVDWLPQSDLLAHPSIRLFVTH
Pongo_abelii|15172            EDLKKMHSAFAHLPQ-GVIWKCQSSHWPKDVHLATNVKIVDWLPQSDLLAHPSICLFVTH
Pan_troglodytes|14000         EDLKKMHSAFAHLPQ-GVIWKCQSSHWPKDVHLATNVKIVDWLPQSDLLAHPSIRLFVTH
Callithrix_jacchus|36381      EIFEEMNNAFAHLSQ-GVIWKCQYSHLPKDVHLAANVKIVDWLPQSDLLAHPSIRLFVTH
Rhesus_macaque|23771          EIFKEMNNAFAYLPQ-GVIWKCQCSHWPKEVQLAANVKIVDWLPQSDLLAHPSIRLFVTH
Gorilla_gorilla|237           EIFKEMNNAFAHLPQ-GVIWKCQCSHWPEDVHLAANVKIVDWLPQSDLLAHPSIRLFVTH
Homo_sapiens|19345            EIFKEMNNAFAHLPQ-GVIWKCQCSHWPKDVHLAANVKIVDWLPQSDLLAHPSIRLFVTH
Pan_troglodytes|13983         EIFKEMNNAFAHLPQ-GVIWKCQCSHWPKDVHLAANVKIVDWLPQSDLLAHPSIRLFVTH
Loxodonta_africana|7368       EIIKEMNSAFAHLPQ-GVIWRYKHSHWPKDVQLAANVKIVDWLPQSDLLAHSSIRLFVTH
Oryctolagus_cuniculus|3972    EVLQEMNSAFAQLSQ-GVIWKCKHSHWTKGVKLAENVKIMDWLPQNDLLAHPNIRLFVTH
Ochotona_princeps|5467        EILKEMNSAFAQLSQ-GVIWKCKHSHWNKDVKWAPNVKVMDWLPQSDLLAHPSIRLFVTH
Tursiops_truncatus|8370       -------------------------------------------------SHPHVHLFVTH
Bos_taurus|11330              EVLKEMNAAFAHLPQ-GVIWKYNPSHWPKDIKLAPNVKIVHWLPQNDLLGHPRIRLFVSH
Equus_caballus|8683           ------------------------------------------------------------
Equus_caballus|8385           YVFKEMNRAFAHLPQ-GVIWKCNPSHWPEDIKLAENVKIVDWLPQSDLLAHPRIRLFVTH
Equus_caballus|6958           EFLKEMNTAFAHLPQ-GVLWRCKPSHWPKDIKLAANVKIVDWLPQSDLLAHPHIRLFVTH
Canis_familiaris|24633        EVLREMNDAFAHLSQ-GVIWKCNPSHWPKDVKLAANVKIVDWLPQNDLLAHPRIRLFVTH
Canis_familiaris|23400        ELLREMNGAFANLSQ-GVIWKCNP-YWPKEIKLAANVKIVNWLPQNDLLAHPHIRLFVTH
Caenorhabditis_elegans|22531  SFKAGLIKVFESLPDVTFIWKYEKDDLEFQKRLPKNVHLKKWIPQPSLLADKRVKLFITH
Caenorhabditis_elegans|17034  AVKKSIVDAFAAFPDVTFIWKYDDTESKLTAHLD-NVHIVKWMPQNDLLADKRISMFWTH
                                                                                          

Bombyx_mori|10100             GGLLSSTEAIHFGVPIIGIPIFYDQFVNIQKAVISGYGIQVKLNYEL-PKSLEKALGEML
Bombyx_mori|10287             GGLLSTIESIHFGVPIIAIPVFGDQFINVEWSVRKGFGKRVDLSYTL-AEDLKVAIEEVF
Gasterosteus_aculeatus|7779   GGQNSLFQAVYHAVPVLGIPLFGDQFDNMVRAKTKGLGLTIKPTHIT-RELLSSTIQTLS
Fugu_rubripes|42781           GGQNSLLQAVYHAVPVLAIPLFGDQFDNVVRAETKGLGLSIKPTLIT-RERLRSAIQTLM
Xenopus_tropicalis|14016      ------------------------------------------------------------
Xenopus_tropicalis|14011      GGVNSVQEAIYHGVPMVAIPLFFDQFDNAVRIKAKHLGTFIPSDQLK-AEKLANAIRHVI
Xenopus_tropicalis|26913      GGINSVQEAIYHGVPMVAIPLFGDQFDNAVRIKAKHLGTFILPGQLK-AEDFANAIRHVI
Xenopus_tropicalis|26895      GGINSVQEAIYHGVPMVAIPLFGDQFDNAVRIKAKHLGTFIPKDQLK-AEKFADAIRHVI
Dipodomys_ordii|6771          GGINSINEAIQHGVPMVGIPVNADQPINMFHVEAKNLGVSLSLINLT-AETLALKVKQVI
Anolis_carolinensis|8691      GGLNSLMEAVYHGVPVVGIPLFGDQHDNMIRVEARSMGLSVSIDQLE-ADSFGSAMKQVI
Ornithorhynchus_anatinus|5664 GGINSVMEAIHHGVPMVGIPLFGDQFDNMVRVEAKTLGVTVPVTQLK-AEMFAHTMKRVI
Echinops_telfairi|10765       GGQNSIMEAIQHGVPVVGIPLFGDQPENLVRVEAKHLGVTMSLKQLK-AETLARKMKQVM
Tupaia_belangeri|11390        GGQNSIMEAIQHGVPMVGIPLFGDQPENMVRVEARKLGVSLQLKELK-ADTLALKMKQVI
Felis_catus|3951              GGMNSIMEAIQHGVPMVGIPLFGDQPENLVRVEAKKFGVSIPLKQIK-EETLAVKMKQVI
Bos_taurus|1528               --------------PSPCLPEL--------------------------------------
Tarsius_syrichta|6718         GGQNSIMETIQYGVPIVGIPVNGDQHDNMVQVVAKNFGVSIQLKQVT-ADTLTLKMKQVI
Dasypus_novemcinctus|13029    GGQNSIMEAIQYGVPMVGIPFFGDQPDNLVRVEAKNFGVSIQLKELK-AEILVLKMKQVM
Choloepus_hoffmanni|9385      GGQNSILEAIQHGVPMVGIPFFGDQAENMLRVEAKNFGVSIQLKQLK-AETLALKMKQVI
Mus_musculus|35592            GGMNSVMEAVHHGVPMVGIPFFGDQPENMVRVEAKNLGVSIQLQTLK-AESFLLTMKEVI
Rattus_norvegicus|24690       GGMNSVNEAIQHGVPMVGILFFSDQPENMIRVEAKTIGVSIQIQTLK-AETFARTMKEVI
Pteropus_vampyrus|13655       GGLNSIMEAIQHAVPIVGLPIFADQPGNMVRVEAKKFGVSISFKQIK-AETLALTMKQVI
Otolemur_garnettii|6468       ------------------------------------------------------------
Microcebus_murinus|6005       GGQNSIMEAIRHGVPMVGIPVFGDQLENMVRVEAKNLGVSINLKELK-AETLTLKMEQVM
Microcebus_murinus|16234      GGQNSIMEAIQHGVPMVGIPVFGDQPENMVRVEAKKFGVSINLKELK-AETLALKMEQVI
Tarsius_syrichta|4386         GGQNSLMEAIQYGVPFVGIPVFGDT-ENIVRVEAKKFCVSIELQMLK-AETLALKMKQVI
Rhesus_macaque|23767          GGQNSVMEAIRHGVPMVGLPVNGDQHGNMVRVVARNYGVSIQLNQVT-ADTLTLMLKQVI
Homo_sapiens|19076            GGQNSVMEAIRHGVPMVGLPVNGDQHGNMVRVVAKNYGVSIRLNQVT-ADTLTLTMKQVI
Gorilla_gorilla|232           GGQNSVMEAIRHGVPMVGLPVNGDQHGNMVRVVAKNYGVSIQLNQVT-ADTLTLTMKQVI
Pongo_abelii|15172            GGQNSVMEAIRHGVPMVGLPVNGDQHGNMVRVVAKNYGVSIRLNQVT-ADTLTLMMKQVI
Pan_troglodytes|14000         GGQNSVMEAIRHGVPMVGLPVNGDQHGNMVRVVAKNYGVSIRLNQVT-ADTLTLTMKQVI
Callithrix_jacchus|36381      GGQNSIMEAIQHGVPMVGIPVFGDQPENMIRVEAKKFGVSISLKKLK-AETLALKMKQIM
Rhesus_macaque|23771          GGQNSIMEAIQHGVPMVGIPLFGDQPENMVRVEAKNFGVSIQLKKLK-AETLALKMKQIM
Gorilla_gorilla|237           GGQNSIMEAIQHGVPVVGIPLFGDQPENMVRVEAKKFGVSIQLKKLK-AETLALKMKQIM
Homo_sapiens|19345            GGQNSIMEAIQHGVPMVGIPLFGDQPENMVRVEAKKFGVSIQLKKLK-AETLALKMKQIM
Pan_troglodytes|13983         GGQNSIMEAIQHGVPMVGIPLFGDQPENMVRVEAKKFGVSIQLKKLK-AETLALKMKQIM
Loxodonta_africana|7368       GGQNSIMEAIQHGVPMVGIPLFGDQPENLLRVEAKNLGVSVQINQLK-ARTLALKMKQVI
Oryctolagus_cuniculus|3972    GGQNSIMEAIQYGVPMVGIPLFGDQPENIVRVEAKKLGVSIQLHNLK-AETLALTMKQVI
Ochotona_princeps|5467        GGQNSIMEAIQHGVHMVGIPLFGDQPENIVRIEAKKLGVSIQLHNLK-AETLALMMKQVI
Tursiops_truncatus|8370       GGINSVMEAIQHGLPMVEIPLFGDQPENLLRVDAKNFGVSIQLKQIK-AETLALNMKQVI
Bos_taurus|11330              GGMNSIMEAIQHGVPMVGIPLFGDQHENLLRVKAKKFGVSIQLKQIK-AETLALKMKQVI
Equus_caballus|8683           ------------------------------------------------------------
Equus_caballus|8385           GGINSIMEAIQHGVPMVGIPFFGDQPENLFRVEAKNFGVSIQVKQIK-AETLALKMKQVI
Equus_caballus|6958           GGINSIMEAIQHGVPMVGIPVFGDQPENLFRVEAKNFGVSIQLKQIK-AETLSLKMKQVI
Canis_familiaris|24633        GGMNSIMEAIQHGVPMVGIPVLGDQPENLVRVEAKKFGVSIQLQQIK-AETLALKMKQVI
Canis_familiaris|23400        GGMNSIMEAIQHGVPMVGIPLFGDQPENLVRVEAKKFGVSIQLQQIK-AETLALKMKQVI
Caenorhabditis_elegans|22531  GGLGSTMEVAYTGKPAIVVPIFGDQHHNAVMLARHGGAVAYDKFDLKNGEKLTAVVHEMI
Caenorhabditis_elegans|17034  GGMGSLMESAQKSVPLVVVPIFGDQMRNAQIAKRHGVALIYDKMDLSNTKKLIGALKEVL
                                                                                          

Bombyx_mori|10100             SDKKYREKAKQLSLIFHDRPVSPGAELVHWVEHVVKTRGALHLRSPALHVPFYQKLYLDL
Bombyx_mori|10287             ANPRYKEIAKETSLIYHDRPVSPGAELVHWVEHVVKTRGALHLRSPALFVPLYQKLYLDV
Gasterosteus_aculeatus|7779   QDIRFKSSALSLSRIHKSHPVPPALRLTQWVEHILQSGGGAHLRPASLTQPWYQRYLLDL
Fugu_rubripes|42781           HDRRFKSSALSLSRIHRSHPIPPALRLIHWVEHILHSRGGAHLKPASLTLPWYQRYMLDL
Xenopus_tropicalis|14016      ------------------------------------------------------------
Xenopus_tropicalis|14011      EDKSYKNSAMHFSLIQRSQPFPKEQQIVRWVEHIVTVGGANHLIPYSYQQPLYQQYLLDV
Xenopus_tropicalis|26913      EDESYKNSAMHFSLIQRSQPFPKEQQIVRWVEHIVTVGGANHLIPYSYQQPLYQQYLLDV
Xenopus_tropicalis|26895      EDKSYKKSIERLNVIQRSQPFPKEQQIVRWVEHIVTVGGANHLIPYSYQQPLYQQYLLDV
Dipodomys_ordii|6771          EDKRYKSAAVAASIIRHSQPFTPVQRLVGWIDHILQNKGAEHLRPYTFQQPWTELHLLNI
Anolis_carolinensis|8691      RHQRYKSAAKTLSTILQSHPFPPEQRLAGWIEHILTVGSGAHLHPYAFHQEWYQQYLLDV
Ornithorhynchus_anatinus|5664 EDRRYKSSAVAASTIRRSHPFPPAQRLVGWIDHILQTGGGDHLRPFAFQQPWYEQYMLDV
Echinops_telfairi|10765       EDKRYKSAAMAASIIRRSHPLSPSQRLVGWINHILQTGNGAHLKPFVFQQPWYEQYLLDV
Tupaia_belangeri|11390        EDKRYKSAAVAASVIRRSHPVSPSQKLVGWIDHILQTGGAAHLKPYAFQQPWHEQYLLDV
Felis_catus|3951              EDK---------------------------------------------------------
Bos_taurus|1528               ------------------------------------------------------------
Tarsius_syrichta|6718         EDKKHKSAAVAASIIRRSHPLTPAQRLVGWTDHILQTRGVAHLKPYVFQQPWHE-YLLDV
Dasypus_novemcinctus|13029    EDKRFRSAAVAASIIRRSHPLSPAQRLVGWIDHILMTGGSAHLKPYAFQQPWHEQYLLDV
Choloepus_hoffmanni|9385      EDK---------------------------------------------------------
Mus_musculus|35592            EDQRYKTAAMASKVIRQSHPLTPAQRLVGWIDHILQTGGAAHLKPYAFQQPWHEQYMLDV
Rattus_norvegicus|24690       EDKRYKSAAMASKIIRHSHPLTPSQRLEGWIDHILQTGGAAHLKPYAFQQPWHEQYLLDV
Pteropus_vampyrus|13655       EDK---------------------------------------------------------
Otolemur_garnettii|6468       ------------------------------------------------------------
Microcebus_murinus|6005       EDKRYKSAAVAASVIRRSHPPDPAQRLVGWIDHILQTGGAAHLKPYAFQQPWHEQYLLDV
Microcebus_murinus|16234      EDERYKSAAVAASVIRRSHPLTPAQRLVGWIDHILQTGGSAHLKPYAFQQPWHEQYLLDV
Tarsius_syrichta|4386         EDQRYKSAAVVASIIRRSHPLSPTQQLVGWTDHILQTGGATDLKSYAFQQSWHEQYLLDI
Rhesus_macaque|23767          EDKRYKSAVAAASVILRSQPLSPAQRLVGWIDHILQTQGAAHLKPYAFQQPWHEQYLIDV
Homo_sapiens|19076            EDKRYKSAVVAASVILHSQPLSPAQRLVGWIDHILQTGGATHLKPYAFQQPWHEQYLIDV
Gorilla_gorilla|232           EDKRYKSAVVAASVILHSQPLSPAQRLVGWINHILQTGGAAHLKPYAFQQPWHEQYLIDI
Pongo_abelii|15172            EDKRYKSAVVAASVILHSQPLSPAQRLVGWIDHILQTGGAAHLKPYAFQQPWHEQYLIDV
Pan_troglodytes|14000         EDKRYKSAVVAASVILHSQPLSPAQRLVGWIDHILQTGGAAHLKPYAFQQPWHEQYLIDI
Callithrix_jacchus|36381      EDKRYKSAAVAASVILRSHPLSPTQRLVGWIDHVLKTGGAAHLKPYVFQQPWHEQYLLDV
Rhesus_macaque|23771          EDKRYKSAAVAASIILRSHPLSPTQRLVGWIDHILQTGGATHLKPYVFQQPWHEQYLLDV
Gorilla_gorilla|237           EDKRYKSAAVTASVILRSHPLSPTQRLVGWIDHVLQTGGATHLKPYVFQQPWHEQYLLDV
Homo_sapiens|19345            EDKRYKSAAVAASVILRSHPLSPTQRLVGWIDHVLQTGGATHLKPYVFQQPWHEQYLLDV
Pan_troglodytes|13983         EDKRYKSAAVAASVILRSHPLSPTQRLVGWIDHVLQTGGATHLKPYVFQQPWHEQYLLDV
Loxodonta_africana|7368       EEKRYKSAAMAASIIRRSHPLSPSQRLVGWINHILQTGGGAHLKPYAFQQPWHEQYLLDV
Oryctolagus_cuniculus|3972    EDKRYKAAAVSASVVRCSHPLTPSQRLVGWVDHILQTRGAAHLKPYAFQQWWHEQYLLDV
Ochotona_princeps|5467        EDK---------------------------------------------------------
Tursiops_truncatus|8370       EDK---------------------------------------------------------
Bos_taurus|11330              EDKRYKSAAEAASIIRRSQPLTPAQRLVGWINHILQTGGAAHLKPHAFQQPWYEQYLLDV
Equus_caballus|8683           ------------------------------------------------------------
Equus_caballus|8385           EDKRYKSAAVAASIIRRSHPLTPAQRLVGWTNHILQTGGAAHLKPHAFQQPWYEQYLLDV
Equus_caballus|6958           EDKRYKSAAVAASIIRRSHPLTPAQRLVGWTNHILQTGGAAHLKPHAFQQPWYEQYLLDV
Canis_familiaris|24633        EDKRYKSAAVAASIIRSSHPLTPAQRLVGWIDHILQTGGAAHLKPYALQQPWHEQYLLDV
Canis_familiaris|23400        EDKRYKSAAVAASIIRSSHPLTPTQRLVGWIDHILQTGGAAHLKPYALQQPWHEQYLLDV
Caenorhabditis_elegans|22531  SSTKYQENAEALQHVLFNQPIDPKMNFLNHLDFAIKFPNHRAQVPAINQLGFVAHYYLDV
Caenorhabditis_elegans|17034  ENPEYKKSAELLARILATERFSPRQKIIDTVEMAGRFGQMPRWTSAGKEFSFLKYFNLDL
                                                                                          

Bombyx_mori|10100             LAAIAMTLLMIKLVIEKTLSSFYKK---TLKRKED-
Bombyx_mori|10287             LA-VILAFLIVLYKTARCLFLKER----ITNKKKNN
Gasterosteus_aculeatus|7779   VLLLSLGLLGPVVIC------LTCWKNKNSRDQHEK
Fugu_rubripes|42781           LLLFSLVLCGLVVICCRCFSLTAEFLCFIKTLNKT-
Xenopus_tropicalis|14016      ------------------------------------
Xenopus_tropicalis|14011      ILFVCVCLIGACYITVKVLRLFIQRLCSVRKVKQN-
Xenopus_tropicalis|26913      ILFVCVCFIGACYLTVKVLRLFIQRLCSVGKLKQN-
Xenopus_tropicalis|26895      ILFVCVCFIGACYLTVKVLRLFIQRLCSVGKLKQN-
Dipodomys_ordii|6771          FLFLLGFTLGVLWLCGKLLSLLTRWLKTARKLKKT-
Anolis_carolinensis|8691      WLFLFASLLGIIYLSLKFIDFITSRICDSGKQKQA-
Ornithorhynchus_anatinus|5664 ISFLVALTLASGFLCVMLGRVARRRLCGLRKLKQT-
Echinops_telfairi|10765       LLFLLGVALGSMWLCGKLLRVMASWLRGSQKLKQM-
Tupaia_belangeri|11390        FLFLLGLTLGAGWLCGKLLAMAARWLSGPRKLKET-
Felis_catus|3951              ------------------------------------
Bos_taurus|1528               ------------------------------------
Tarsius_syrichta|6718         FLFLLGFILGTMWLCGKLLGMVARRLCGAT------
Dasypus_novemcinctus|13029    FAFLLLVTLGSMWLCGKLLGMVARWLCGARKLKQA-
Choloepus_hoffmanni|9385      ------------------------------------
Mus_musculus|35592            FLFLLGLTLGTLWLSVKVLVAVTRYLSISRKVKQA-
Rattus_norvegicus|24690       FLFLLGLTLGTVWLCVKVLGAVMRYLSGARKAKQT-
Pteropus_vampyrus|13655       ------------------------------------
Otolemur_garnettii|6468       ------------------------------------
Microcebus_murinus|6005       LLFLLGLTLGAVWLCGKLLRVVSRWLCGARKLKET-
Microcebus_murinus|16234      FAFLLGLSLGAVWLCGKLLGVVSRWLRGARKLKET-
Tarsius_syrichta|4386         FLFLLELTLGTMWPCRKLLGLGIRWLCGARKLKET-
Rhesus_macaque|23767          FVFLLGLTLGTVWLCGKLLGVVVRWLRGARKVKKT-
Homo_sapiens|19076            FVFLLGLTLGTMWLCGKLLGVVARWLRGARKVKKT-
Gorilla_gorilla|232           FVFLLGLTLGTMWLCGKLLGVVARWLRGARKVKKT-
Pongo_abelii|15172            FVFLLGLTLGTMWLCGKLLGVVARWLCGARKVKKT-
Pan_troglodytes|14000         FVFLLGLTLGTMWLCGKLLGVVARWLRGARKVKKT-
Callithrix_jacchus|36381      FVFLLGLTLATLWLCRGLLGMVVWWLRGARKVKET-
Rhesus_macaque|23771          FVFLLGLTLGTLWLCGKLLGIAVWWLCGARKVKET-
Gorilla_gorilla|237           FVFLLGLTLGTLWLCGKLLGMAVWWLRGARKVKET-
Homo_sapiens|19345            FVFLLGLTLGTLWLCGKLLGMAVWWLRGARKVKET-
Pan_troglodytes|13983         FVFLLGLTLGTLWLCGKLLGMAVWWLRGARKVKET-
Loxodonta_africana|7368       FLFLLGITLGSIWL----------------------
Oryctolagus_cuniculus|3972    FLFLLGLILSSVWLGGKLLGTVARCLCGAKKLKEM-
Ochotona_princeps|5467        ------------------------------------
Tursiops_truncatus|8370       ------------------------------------
Bos_taurus|11330              FLFLLVVTLGTMWLCGKLLGLVARWLCGARKLKKA-
Equus_caballus|8683           ------------------------------------
Equus_caballus|8385           FLFLLVLTVGTMWLCGKLLGMVARWLCGARKLKKA-
Equus_caballus|6958           FLFLLVLTVGTMWLCGKLL-----------------
Canis_familiaris|24633        ILFLLVVTLGTLWLCGKLLGMVARWLCGTRKQKKA-
Canis_familiaris|23400        ILFVLVVTLGTLWLCGKLLGMVARWLCGTRKQKKA-
Caenorhabditis_elegans|22531  LLFLLVSSIVITYLAISLLKKVLGK-CLTKKTKSD-
Caenorhabditis_elegans|17034  VIIAVFIFFLSIVSTVLLIRHLLAKLGFSGDKEKSE