Orthologs Set ID: EOG4006C8


Orthology Database
OrthoDB4
Gene Symbol(s)

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Culex quinquefasciatus 1242
Tribolium castaneum 9802

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Culex quinquefasciatus 1242 CPIJ009301-RA 6041605 CPIJ009301 CpipJ1
Tribolium castaneum 9802 GLEAN_05621 Tcas3.0

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Culex quinquefasciatus 6570 CPIJ009301 CpipJ1
Tribolium castaneum 5490 GLEAN_05621 Tcas3.0

multiple sequence alignment in CLUSTALW format


Culex_quinquefasciatus|1242 ATGAGCCTCAACGCGATATGTTACCCGCTGCTATTGGCGGTGTTCTCCTACCGGACCGTC
Tribolium_castaneum|9802    ATGAAGTTAATTACCGTGGTA------------------------------------ATA
                            ****.  *.*: .* .*.  :                                    .*.

Culex_quinquefasciatus|1242 AGCGGCCAGTTCACCAGCCTTGCAGCTGATCTAACACCACCATCA---------------
Tribolium_castaneum|9802    ATCGGTGTGTTTACTGTAACTTCGGCCATCCGCGTTCCGCCATCATGGCCGAAGAAGCAA
                            * ***  :*** ** . .. * *.** .: * .. :**.******               

Culex_quinquefasciatus|1242 CCACTGCAGCAGCACCACCAACAAAATACACTAGCGCAGCAAAGTCCTCTCCATGTGCCA
Tribolium_castaneum|9802    AACCTACAACACGTGCAAAAATTCAGGACAGTTCGACCGAGTGTTGGCAGTGAAATTGGT
                            ...**.**.**  : **..** :.*. *** *:  .*.*..:. *   .   *:.*   :

Culex_quinquefasciatus|1242 TCCCAAAATTTTCCCCAATCACCACTATCCGTCCCAGCCCAGATTCCATCCTTCCCAAGC
Tribolium_castaneum|9802    TACCGGACGCGGCCACATGTTACTCAAACACAACACCATAAAACCAACAGTCGGAAGAAA
                            *.**..*.    **.**:  :.*:*:*:*. :.*.. . .*.*  ...:     ...*..

Culex_quinquefasciatus|1242 CTGTCATCCCCATCAGCTCCAAACAACCTGCTGAGTTCCAATTTCCCAACTACCCATCAA
Tribolium_castaneum|9802    TACCAGCCGAGGATGCAGCGACATCCTAACCTGGAAAGAAGCGCTCCGAAGACC---GAA
                             :  .. * . .: . . * *.* .. .: ***..:: .*.    **.*. ***    **

Culex_quinquefasciatus|1242 TTCCCAGTCCAACAGTTCCCAACCAAACCACCTCCTCAACTTCCTCCAGCGCTG---CAA
Tribolium_castaneum|9802    TTCAAGGCCAGCGCCTCGACCAACGACTGGAAACCGATTTTCCCAGCGCATTTGTTCCAA
                            ***...* *... . *  .*.*.*.*.  ...:** .:: * **: *. .  **   ***

Culex_quinquefasciatus|1242 TCACAGCTTCCAGTTCAGCTTGCGCCTCACCTGCAACAACAGATTCCGTTCCAGCTACAG
Tribolium_castaneum|9802    CAGGAACTGAAGAACTTCAAAGAACCCTTCATCCGGGAAACAGAACATGGGAAAAAATCA
                             .. *.** ....:  : .::*..**  :*.* *.. **....::*.    .*..:* ..

Culex_quinquefasciatus|1242 CCTCAGTTC------------------AACGTCAACTTGCCACCTGCGCTACAACCGAAT
Tribolium_castaneum|9802    CCACTTTATAAGAACTATCGAGACGATAAAACACACGAGCCGAGCTATGGCACACAAAGT
                            **:*: *:                   **.. ..** :***..   .   ...**..*.*

Culex_quinquefasciatus|1242 CAGCAATCCCATCTACTTCCACCACAGTTACCTGCGCAACTACCCAGTCAATACCCTCCA
Tribolium_castaneum|9802    GTAAAAGAACGACACATACACAGGGAAACACCAAAAAACGAGTATGACGTGGTTCCGGAC
                             :..** ..*.:*:..*:*... . *.: ***:....*. :. . ..  :. : **  ..

Culex_quinquefasciatus|1242 ATCCCTGCTAATACCAACTTTCCA------------------------------------
Tribolium_castaneum|9802    GTCCCAACACGGCCGATTTATCCGGGAGAAGGACAGTGGGCCAAAAAAGGGATCAAACAC
                            .****:.*:.. .* *: *:***.                                    

Culex_quinquefasciatus|1242 AGACCA---ATACCAACGTCAAAGTTTCCACCGCTAACTTCTTCGAAAAATATCTCTAAT
Tribolium_castaneum|9802    CGGCCCTTTATCAGCAAACACCGATTTGCAAAACTTGAAGATGACTCCGAA---------
                            .*.**.   **.. .*.. .....*** **...**:..: .* . :...*:         

Culex_quinquefasciatus|1242 GAAGTTACACGAGGTCCAAAAACACTGCAAATGATTGGCTCCAACAACCCTTTCATGCTG
Tribolium_castaneum|9802    ------GACGAAAGACCAGAGGGTTATGAAGTTTTCGAGCAAAATAAAAAA---CTGTTT
                                  ... .*.*:***.*.. : :  **.* :* *.  ..** **...:   .** * 

Culex_quinquefasciatus|1242 CACAAAATATCGGACAACCTACGACCCGGAAGCACCACTTGGTACTACAGAAAGAACAAC
Tribolium_castaneum|9802    GATAGGCAAAAAGCCCAGTTTAGG------GACACCATTGACCAGTTCCCACGAAATCAC
                             * *...:*:..*.*.*  *:.*.      ..***** * .  * *:*. *...** .**

Culex_quinquefasciatus|1242 AAGCTAATGAAGAACACTCCACCGTCAAAGTCCAGCTTTCCACCTCCAGCTTCACCGCTA
Tribolium_castaneum|9802    AAGCTAGGGGCCTACAGGCAACCACCAGAAGAGGAAGATAAAGAAGCGGAGGATGAAGAG
                            ******. *.. :***  *.***. **.*. . ... :*..* .: *.*.  .: .. :.

Culex_quinquefasciatus|1242 CAAACGAGTCCGAACGCACTCCAACAGTATCACCAGCTGTCACAATTTGCATCGCTGAGC
Tribolium_castaneum|9802    GAAGAAGAAACGGAGGATTACGATGAAGAAGAAGAAGAAGAACAAGACCGAGGATTTGTT
                             **.....:.**.* *.: :* *: *. *: *. *. :. .**** :   *  . * .  

Culex_quinquefasciatus|1242 CCTCCTAGCACAACTTACAACTTCAACAATCCAAGTACCTCGTTTACTAGTCCGACTACT
Tribolium_castaneum|9802    ---CCAATGAAACTATACACACAAGTCCGACGGAGCGAATCCGCGGAACACCTCCCGAGA
                               **:*  *.*. :****.. :..:*..:* .** ...**    ..:.. *  .* * :

Culex_quinquefasciatus|1242 TCATTCAACAGTCCG---------------------------------AGTTCTTCGTTC
Tribolium_castaneum|9802    CTCGTCGAAGACCCCCGATTGCGAGAAGTGATCAAGGATTCAAAAATCCAAACTGTCTAC
                              . **.*... **                                  ..::**   *:*

Culex_quinquefasciatus|1242 GCCAGTACTTCATTCAGCAGT---CCAAGTACCTCATTAAACAGCCCGAGTACTTCGTTT
Tribolium_castaneum|9802    ACCGAAGAAGGGTACGAAGATATCGCCTACGACCACGCCGGTCATGAGAAAACGGCCGAA
                            .**..:..:  .*:*.....*    *.:. ..* ..  ... ..  .**.:**  *  ::

Culex_quinquefasciatus|1242 GCCAGTACTTCATTCAACAGTCCAAGTACTTCATTCAGCAGTTCTTCATTGAATAGCCCG
Tribolium_castaneum|9802    CAAGACGAAGGTTTCGCCGAATTTGATAAAGAGATAGAAAAAGAAAAACAACGTCGGAAG
                             .... ..:  :***..*..:  :..**.: ..:*....*.: .::.* :...*.* ..*

Culex_quinquefasciatus|1242 AGTACTTCATTCAACAGTCCGACTTCTACATTCAATCAACAAACTACATCATTCAACATC
Tribolium_castaneum|9802    GATAAGGAGGAATCGGGAGATAGCGAAACTGCCGGCTCGCAACACAAAACCGTCAACAAA
                            ..**.  .. :.:. .*: . *   .:**:  *..  ..***.. *.*:*. ******:.

Culex_quinquefasciatus|1242 CCAAGT------------------------TCTACATTCAACCAACCCAGTTCCTCATTA
Tribolium_castaneum|9802    CCGGTCAAAATGAAGAAAGACAACTTTATGAAGACTGAACAAATCCAAACGGCGTCGCTC
                            **..                          :. **: :..*..:.*..*   * **. *.

Culex_quinquefasciatus|1242 AACCAGCAAAGTCAAACCTTGAACCCGTTGAGTCAATTTAATCAACTCACACAACTCCAT
Tribolium_castaneum|9802    AAAGACCAAGCCGGAGGCAACACCGAACTGGAGATTTTAAGCGAGATTAAGGTCTTGGCA
                            **. * ***.   .*. *:: *.* .. **.. .::**:*.  *..* *.. :. *  .:

Culex_quinquefasciatus|1242 TCAACAAATCAACAGAATCAACAAAATCAGTTCTCAAGCAGTTCTCTGAATATACCTCTG
Tribolium_castaneum|9802    AGCCCCGAAAATGGCACCAAGACGCACAAGTACGTCAAAATT---------GTGCCCAAA
                            : ..*..*:.*: . *. .*.....* .***:*  .*..* *         .*.** .:.

Culex_quinquefasciatus|1242 AATACGAATTACAATCAACTTAACCATGTGAACCAGCAACCAAGTATACTGAACCAAGTC
Tribolium_castaneum|9802    ATGTACAAATATGATAGAATAAAC------GACACAAGGCCTGAAATGGTGTCTATGGAG
                            *: :. **:** .**..*.*:***      .**......**:..:**. **:. .:.*: 

Culex_quinquefasciatus|1242 AGCAGCAACTCCGACTCGCTTAGACAATTACAGCTGGCAAACCTTTTGAACCAGCTGAAC
Tribolium_castaneum|9802    AGTGTAGTGAGGGAACACTTCCGGCGG---AGATTCAAACGCTACACTAATGACTAC---
                            ** . ..: :  **. .  * .*.*..   ... * ..*..* : :  **  *  :    

Culex_quinquefasciatus|1242 CAATCGAACCCACCACCTTTTCTCCAGAATCAGGGATACTCGGGCAACGTGAAA---CCA
Tribolium_castaneum|9802    ------------CCCAAAATTGAGGTCGATACCGCCTTTATCGATAAGATCAAGCACGAC
                                        **...::** :  : .**.. * .*: :  *. ** .* **.    ..

Culex_quinquefasciatus|1242 ATCACCAATCCACTGATTCCACAGGAAATCTTCAACAGCCCAGAATTCCACATACAACCA
Tribolium_castaneum|9802    ATACCCAAACCATTGATAGTTAGGGTGAAACCAAAATACCCCTATTATAACAACAAGGCA
                            **..****:*** ****:  :..**:.*:.  .**.:.***. *:*: .***:..*. **

Culex_quinquefasciatus|1242 ATCAGTATCCCCTCTCCGAATTCCCCGCACTTTGAAACGGTCCGCAATCAGGTGAGCTTC
Tribolium_castaneum|9802    ATA---------AATCCCGACTCCCCT---------------------------------
                            **.         :.*** .* *****                                  

Culex_quinquefasciatus|1242 CTGAAGGCCAAACACAAACAATTCTTCGACCAGCAAGGTCCCAAACAGCAGAAGCCGTCG
Tribolium_castaneum|9802    ------CTTCGTTACGCGGAGGATCTTGACAACATT---CCGAAGAAAACTGAGGACGAA
                                     ..: **... *. :  * ***.* .::   ** **..*... .** .  ..

Culex_quinquefasciatus|1242 TTCAACAACTTCGGACAACACCATCAGCAGCAGCACCAGCAACAGCATCAGTCCCAACAT
Tribolium_castaneum|9802    TTCGCGTTCTACAACCAAGCTGATAAGATCCAATGTGAGGAAGTGCAAAGTAACGTAGAC
                            ***.. ::**:*...*** .  **.**.: **. .  ** ** :***:.. :.* :* * 

Culex_quinquefasciatus|1242 CCG---CCAAAACTCTACTTTGACCAGTTTAATCAACCGGAAAAGACATGGCTCGAGCAA
Tribolium_castaneum|9802    CCGATCCCTGCAAGGGTCAAAAACACCAACGATGATCCTGACAATGCT------------
                            ***   **:..*.   :*:::.**.. :: .** *:** **.** .*:            

Culex_quinquefasciatus|1242 CTTCAGCAGTTATCAAATTCTCTCTTTGACCAGCCTCAGTCCCCGCCGGTCCATCAT---
Tribolium_castaneum|9802    ------GACGAAACATCAGGCGTGCAAGAATTGCCACAAACCCCAAGATTAAGAAATCTC
                                   *  :*:**:.:    *  ::**. :***:**.:****.. . *...:.**   

Culex_quinquefasciatus|1242 ------CATCTCCACATCCAGGCGCCACAACCCTTCCAACCCAAGCCGCAGGCTCAGCCG
Tribolium_castaneum|9802    GGCGATAAAATCGACTGTTTCAAGGTGAAATATTTCGGCGAAAACCCCCTTGATAGCCCC
                                  .*:.** **:   : ..*  ..** . *** .. ..** ** *: *.*.. ** 

Culex_quinquefasciatus|1242 CTGGTACAATCGCAACAGAACCCACCCCAGCAACCTGCTCCCGTGTACGGTCCACCAAAG
Tribolium_castaneum|9802    TTTTTCAAGGAGAAGGACATCGGACCCGTGGTT---------------------------
                             *  *..*. .*.*. * *:*  **** :* ::                           

Culex_quinquefasciatus|1242 CCCCCAAAACCCCTGAAACACGTCTTC---GAGATCAACCAAACCACTCAGAAACCGAAC
Tribolium_castaneum|9802    ---------CCACTTTTCAACATATTCAGCAAAGTGACGAGCATTGACGTGAAACCT---
                                     **.** ::..**.*.***   .*..* *. ...*  ..  :******    

Culex_quinquefasciatus|1242 ATCAACCAGATTCAGCTGACCACCAGGAAACCGCCGCATCCAGTCCAGCAACCACAAAGC
Tribolium_castaneum|9802    ---AACGAAATTCCGGTCGAAGAAAAACGTAGCTATTCGTCGAAAATTTCGGTGCGCAAA
                               *** *.****.* * ......*....:.   .  .  *..:..:  ..  .*..*..

Culex_quinquefasciatus|1242 AGTCTACTGCCAGCTTCCTGGAACACCGGACACCGT------GCGCCGGTCATT---GAC
Tribolium_castaneum|9802    GAACTGACACAAGACGACAACCATTTAGGGGTAAATATCTTGAGCGATGTTATTGGACAG
                            ..:**.. .*.**.  .*:. .* : .**. :...*      .   . ** ***    * 

Culex_quinquefasciatus|1242 TACGACCAGTACAGTTCCCCGAAGAAGGTACTCCCAGTTCAGAACGACTTTGTCGGCTTC
Tribolium_castaneum|9802    TTTGAAAAAGTTACGACGCCGAAACCCGAAATGGAAAACCAGACTGAA------------
                            *: **..*. : *  :* *****... *:*.*  .*.: ****. **.            

Culex_quinquefasciatus|1242 CCACCGGCGAAAGGATCGATCAAGAACGAGCTGAACTTTATCAGCACGTGGGAAAAGGCG
Tribolium_castaneum|9802    ---------------------GCAGCGACAATTTCCATCATCACGACTCCGAAATACACA
                                                 ..... ....* :.*:* ****  **   *.**:* .*.

Culex_quinquefasciatus|1242 ATCGGAATCATCCACAAGAACGACCACGATTCGGAGAAAGGACACACGATTCTCTCCTCG
Tribolium_castaneum|9802    ATTGACTTGAAACCCAAACACATCTAT---------------CACCAAATCGAACTGTTG
                            ** *..:* *:.*.***..**.:* *                ***...**  :.   * *

Culex_quinquefasciatus|1242 GGCGATACCGACGACTTCAAGAAGATTGACAATGGTCACAATTCCACC---------CAG
Tribolium_castaneum|9802    GACCATCTGCCGTACCAGGAAAAAATTGATACTGGCGTTACTTCAACCGTATTTCCCTTG
                            *.* **.   .  ** : .*.**.***** *.***  : *.***.***          :*

Culex_quinquefasciatus|1242 AATGAGGAAGAGTCCAGCAATGTTGAGGTGATTAGCGGCGATAAGTCACACTTCCAACCT
Tribolium_castaneum|9802    AACCACCGTCAGAGTAAAAGCATAGAGGAAGTGAGTGGGGTTAGCGACGGTACTGTTAAC
                            **  *  .: **:  *..*. .*:****:..* ** ** *:**.  .. . :   ::.. 

Culex_quinquefasciatus|1242 GAGGCTAAGGAGGAGAAGCCGCAG------------AAAAAGAAGAAGGCTCACGGGAAG
Tribolium_castaneum|9802    ACGAGTGAGGAAACGGCCCCGGAGAGTCAAGCCTTGAGGAAGCGGCGGCGGCGGTTGAAG
                            ..*. *.****...*.. *** **            *..***..*..*   *.   ****

Culex_quinquefasciatus|1242 AAGCGGCCG------ATGAAGAAACACCGTGAAATGGAAGAAACATCTGAGGGTACGAAC
Tribolium_castaneum|9802    CCTCGCCCAAGCCTCCAAAGGCGCAAAAGGCCCTATCACCACGTTTTTGACATCAATAGA
                            .. ** **.      .:.*.*....*..*  ..::  *. *.. :* *** .  *. *..

Culex_quinquefasciatus|1242 AGCGTGGAAGGGGAGGAGAACAAATCGGCGGAACCGAGCCTGGCGGAAAGTGAAGCCCAG
Tribolium_castaneum|9802    TTCATTCCGACGCATACGTACAATCATCTGAACCGAATCATCCGGACTAGTACTGTGGTA
                            : *.*  ... * * ..*:****: .   *.*.* .* *.*   *..:***..:*   :.

Culex_quinquefasciatus|1242 CAGTACAGGTCGAGAAGGAAGCGAGATCTAGCGGCGGTTGAGGTGAGTCCGGAGAACGCC
Tribolium_castaneum|9802    CCCAAGCGAAGCGTCAAGAGTGAAGTGCATTACAAAAACGAGATCAAACCAGAC------
                            *. :* .*.:  . .*.**.  .**: *:: . ....: ***.* *.:**.**       

Culex_quinquefasciatus|1242 AACACCGCTGCACCGCTGATAATCGTTGCGGAGGATACGCCGGAACCGTTGGTAGCACCC
Tribolium_castaneum|9802    ------------------------------------------------------------
                                                                                        

Culex_quinquefasciatus|1242 GAAACGGAACAACCAGTTACCGAAGTCGTAAGCCAAGCAACGGAGAAACCAACGAACGAA
Tribolium_castaneum|9802    GAGCAACTGAATGTTTTTGCCGACGTTATCAATAATATCAAAAACTCGAGCCGAGACCCG
                            **.... :..*:  : **.****.** .*.*. .*:. .*...* :... .. ..** ..

Culex_quinquefasciatus|1242 CGATCGGTGGGAACATCGGTAGATGATTCGTTAGCTTTGGACGATTCTTCCGAGGTAGAG
Tribolium_castaneum|9802    CAACAAATCGCCGCGTCGTCGTCAAGTCGAATCGGAGTCAAGCTGAACGTTGTGGAAAAT
                            *.* ...* * ..*.***  . .:..*  .:*.* : * .*  : :.    *:**:*.* 

Culex_quinquefasciatus|1242 TGGATCTCGGGAGAGGAAGTGGATGACGAAGAATTACCGCACCCGGAAGCATTGGTGTTT
Tribolium_castaneum|9802    TAC---------CAAAAAATTACCGACGAAAAT---------------------------
                            *.           *..**.* .. ******.*:                           

Culex_quinquefasciatus|1242 GACGATTACGATGGTAGCTAT---------------------------------CTGGAT
Tribolium_castaneum|9802    GAGGACAGTGACGGTTTTTATTCAAGCACAACCACGGTGGCACCAAGAGGGACCATCAAA
                            ** ** :. ** ***:  ***                                 .* .*:

Culex_quinquefasciatus|1242 TATGAAGCGTACGCG---CCGAGTGAGTTCCAGGCTCGTTCGGACAACTTTATCTTCGAG
Tribolium_castaneum|9802    TACTCGTCGTACAGACACAAAGACGAGCTAGCGGACCAATACGAAAATCTTGAACTCTTG
                            **  .. *****. .   ..... *** *. .**. *.:*. **.**  **.:. ** :*

Culex_quinquefasciatus|1242 GAGCTTGATGGAACT---ACACAGCTGCCTCATGCACTGCCGTTCATCGCCGAACAAGTT
Tribolium_castaneum|9802    AAAGTGAACAGGAAATTGACAACCACGACCACGTCGGAGCCGTTCTTT------------
                            .*. * .* .*.*.:   ***.. . *.* ..  *. :*******:*             

Culex_quinquefasciatus|1242 GGGAACGTTACGATTGTGATTCAGCCAGAAGCTTTGGTTGATCCCAGGAGTCTACACGGA
Tribolium_castaneum|9802    GGCAACACGAGGATTGCGACTGAAGAGGAAGAT------GAGTCGGAAGACAGCACTGAT
                            ** ***.  * ***** ** * *. ..****.*      **  * ..... . ... *.:

Culex_quinquefasciatus|1242 AGGGAGTTGATGCTGTTTTTGGAGGAGGCGATTCGGAACTCTTCCCGTTTTCTTCCG---
Tribolium_castaneum|9802    AAAGTCGTCGGTTTGATGCCGCCAGACCCCAGTCGCTACAAAACGATTTTCAGCCCAAGG
                            *..*:  * .   **:*   * ..**  * * *** :**:.::* . *** .  **.   

Culex_quinquefasciatus|1242 ------GATGAGGCCGAGGATCGTAGCTTTGATGTTGTG------GAACCACCGACGGAT
Tribolium_castaneum|9802    GTGGTTGAGGAGGTGAAAATGAACACGTTTCTTGTCGTGGGAATGAAACCACCGTCACCC
                                  ** ****  .*..: .. *  *** :*** ***      .********:*. . 

Culex_quinquefasciatus|1242 GTGATCAAG---TTTCCGTACTATGATCGCACGGAGGAACCGATCAACGTAGATTCCGCG
Tribolium_castaneum|9802    AAACAGAAAGTTTACGTATATTCTGATTTTAAAGCACGCCCTCACGGGAAAAGGAAGCAC
                            .:..: **.   *:   .** *.****   *..*.. ..** .:*.. .:*.. :.  . 

Culex_quinquefasciatus|1242 CTGCGGTTTGCTGAAAATCTGACTACCTTCTCGAAAGGGTTGTATAAATCGAAGAGCGCG
Tribolium_castaneum|9802    AGTTACTTGAGGAGGGGCAAGAGAAGTGCGCAAAGACCCGCGTATTCGGAAGTTGTGAGA
                            .   . ** .  ..... .:** :*      ..*.*     ****:.. ...: .  . .

Culex_quinquefasciatus|1242 AACCTGTGCAACGAGGTAGATATTGAACTGGATGAGGAACCCGCTGAATCAGGTCCGGAT
Tribolium_castaneum|9802    AATCGGAACAAACCGATTGATGTTGAGGACGATACAGAAGTCAAAGTTGAGGAAGACGAT
                            ** * *:.***. .*.*:***.****. : ***...***  *..:*:: ..*.: . ***

Culex_quinquefasciatus|1242 GGGTTTAAACCGGTTCGG---AGGCTGAAACGATTGGGAGAAAAGATTGACTGCTTGAAG
Tribolium_castaneum|9802    GATTACGTCCCCCATCGTCCTAAGCACTATCACTACGATGAAAAAACCGGACGCATTGTT
                            *. *: .:.**  :***    *.**: :*:*..*: *.:*****.*  *.. **:* .: 

Culex_quinquefasciatus|1242 AATAAGAATTTTGGCAAGGAACCACTGGATAATCCGCTGTTCAAGGAGGAGTTTGTAGGC
Tribolium_castaneum|9802    ---------TACGATAAAGTTGCGACAGAAGCACCA------GAGGAGGAATATATCGAG
                                     *: *. **.*:: *.. .**:..:**.      .*******.*:*.*.*. 

Culex_quinquefasciatus|1242 GTTGCACGTTCCGCTCCGGATGGGCTTCCTACTCCGCAACCACAGCCGGATCCTTCCGTG
Tribolium_castaneum|9802    GTTACAGAAGCC---------------CCTCTTCCCAAACCTACCAGACGTAATTCAGTC
                            ***.** .: **               ***. *** .****:.. . . .*..***.** 

Culex_quinquefasciatus|1242 GCTGTATTCAGTGATGTGATCCGCTTGATCAAGCAACATTTGACCGAGGAGCACAAACAA
Tribolium_castaneum|9802    ACG---------------------------------------ACACCAAAGTTTGAGGAA
                            .*                                        **. ...** : .*. **

Culex_quinquefasciatus|1242 CACACTCGAGATGTTTCCCAGGTCCTAGCACCGAGACAGCTAAACTTGTCCGATGTAAAG
Tribolium_castaneum|9802    TACACA---------------------GGTCCTTCGTTTGTCGACTTTGTGAAAAAGTTG
                             ****:                     * :** : . :  *..****    .*:.:.::*

Culex_quinquefasciatus|1242 ACCACCTCACCGAACAATGCCGTACTGGAGCAGCTTCGACTGGGCAAAAGAAGGATT---
Tribolium_castaneum|9802    AAAAGTGACCCGAAGTATCAGGAAATCACCGATCCTCCGACTACTGAAAAAAGGGCAGAG
                            *..*   ..***** :** . *:*.* ..  * * ** ..  .  .***.****. :   

Culex_quinquefasciatus|1242 ---CTACCAAAACCAACCAAGACCGTCGAGGAGGTTAAACATGAAGTGAATCAAACTGCG
Tribolium_castaneum|9802    GATGCAACAACACCGACCACAACGGCGAAAGCCGTT---------------TCGACAGAT
                                 *.***.***.****..** *  .*.*. ***                ..**:*. 

Culex_quinquefasciatus|1242 CCCAGCGAACAGCATCCGCTGCGGATAGTGTTTCCCAGAAGGCTGAACTTTACGAAAACT
Tribolium_castaneum|9802    CCGCCAGAATTTTTGAGCATTTTAGCCAAAGTTAGAAGCGATTCCGGTTACAAACCCATC
                            ** . .*** :  : .  .*   .. ..:. **. .**...    .. *: *.....*  

Culex_quinquefasciatus|1242 TACGAGGAAGCGAAGAAGGTTTCGTTGGCGAAGCTGACACAAACCAAACTGGCAGAGCAG
Tribolium_castaneum|9802    GAAGATGAGAAAGCAAAA---------GCTAAGACAACCACGACTGAAGCACCGGAAGAA
                             *.** **.......**.         ** ***. .**....** .**  . *.**. *.

Culex_quinquefasciatus|1242 GAAAAGACGAAGCAAAAGCTGAACGAAACACGGACAGATCATAACATTTACAAAGCGTCA
Tribolium_castaneum|9802    GAGGAACAGGAAAGTCAAATAGAGAACGTCCAG---------------------------
                            **..*...*.*...:.*..*..* .*.. .*.*                           

Culex_quinquefasciatus|1242 CTGGCCCGGAAGCTGAACTTTGACAAGATAGAAAAGCTGAAGACGCCAATGAGTCAGCGG
Tribolium_castaneum|9802    ---------------------------------------AATTCACCAGGGGGCCAAATC
                                                                   ** :*.***. *.* **..  

Culex_quinquefasciatus|1242 CGAGACTCGAATGTAGAGCAGCTGTATGATTCAACG---------CCGAAACTGGTGAGC
Tribolium_castaneum|9802    AGTGGTTCCAACTAC---CAGATTTTCGACATAACTGAGTATTTGCCGAAAGTGAAAACG
                            .*:*. ** **  :.   ***.* *: ** : ***          ****** **.:.*  

Culex_quinquefasciatus|1242 TACCATCCAAGGTCTAATATATTTGACATCTCCACGTACTATCCCAAGCAAACGTACGAT
Tribolium_castaneum|9802    TACAGTCCGCGAACTTCGATT---------------------------------------
                            ***..***..*.:**:. **:                                       

Culex_quinquefasciatus|1242 GAGCTGTACAGCTTTCCGAGTGTAGACGGCAAGGAGAAGGGATTTGCATCTAAAAACTTT
Tribolium_castaneum|9802    GACTATTCGAAGTACAAGACAATTGAACGGGCTAATCCTCCAACTCGGAATAATCCTGAC
                            **  : *. *. *: ..** :.*:**. * .. .* ..   *: *  .:.***:..  : 

Culex_quinquefasciatus|1242 AGAACTTTGGAGCGAGAAGCGGATGAGTTGTTGGAAAGCGTCAGGAGGGATCGGGACAAG
Tribolium_castaneum|9802    CAAGACCCGGAAAAACAGACAAGTCAAGTA------CCAATTATGGAAGATAGAAAGTCG
                            ..*..   ***...* *..*...* *. *.      . ..* * *...***.*..* :.*

Culex_quinquefasciatus|1242 GCTGAAAAAAGGATTGTCAATACGGGTCGATCCAACCGGGAACACCAGGATTACACTCAG
Tribolium_castaneum|9802    GAGGAAGAAGCTGAAATTAATCCTGTGATGAGTGAAAGTAAACACGAAGATGTGGAGCCT
                            *. ***.**.  .::.* ***.* *  . .:  .*..* .***** *.*** : .. *. 

Culex_quinquefasciatus|1242 GACAGACCGTACGGCACCAGCTATTCCCCTCTTTACAAAGAGTTCCAGGCGCTATCAACT
Tribolium_castaneum|9802    AAAACCACGACTGAAGTTTCTTTAAGT---------------------ACTACAACCACC
                            .*.* ..**:. *...  :  *:::                       .* . *:*.** 

Culex_quinquefasciatus|1242 TTGAAGAAGGCTCGACATGTTGATGATCAAAAGAAACCACCCTCGCTGAATCAGCTGATC
Tribolium_castaneum|9802    AGAAAAGTCGTCCGAACGCGGACTCGAGGGAGCAGGAGGCCGGCT---------------
                            : .**..: *  ***..    ..* .: ..*. *... .**  *                

Culex_quinquefasciatus|1242 AATTTCTACTCTCAGCAAAGCGACAGTTTCAGCAGCAACCAGCGTTCGTACACAGTCCCG
Tribolium_castaneum|9802    ---------CAAAGGGCCACCACCCAAGTTCCTGTCAGTACTACCATAACGGAACCACCT
                                      .:..* ..* *..*..: * .  . **. .. .  : .:. ..*  .** 

Culex_quinquefasciatus|1242 AAGGCGCATGGCAACTTACCAATCTTCGACGTGTCGACCTTTTACCCTCGCTACTCAACT
Tribolium_castaneum|9802    CAAGTACACCACGATAAACCA---------CGAAGGACTTTCCCCAGAAGGCAGCGCACG
                            .*.* .**  .*.* ::****           .: *** **  .*. :.*  *   .** 

Culex_quinquefasciatus|1242 CGGGTACAT---------------------GACGAATCCCAGGAACTGCATGATTTG---
Tribolium_castaneum|9802    AGGATACGAGTCCCTAAACCTACAACGGAAACGGAAACACAGGAAACCGTCACCGTTAAA
                            .**.***.:                     .. ***:*.******.   : ..  *    

Culex_quinquefasciatus|1242 GTTACGAAACGAAGAGATTCCAAGATTAATCTGGAAGATTTGGAAGCTCTGCAAGCACCA
Tribolium_castaneum|9802    GTCATCCGTCGAAGACAC---------------------------------CAATCCCCA
                            ** *  ..:****** *                                  *** *.***

Culex_quinquefasciatus|1242 CCCAAAGAAACTTTTCAAAGCGCGCGACAACTGGACAAGAAGGCCAAGAACGTGACACCG
Tribolium_castaneum|9802    CCCGAAACTTCAAACAAGACAGTA------GTTTCCAGAAAAATAGACAACGTTGAAGTG
                            ***.**..::*::: .*.* .* .       *  .**..**.. ..* ***** ..*  *

Culex_quinquefasciatus|1242 GCACCACCTCGGGACGACATT------------GCGGACTTTTTCGAGGAACCGCTAGCT
Tribolium_castaneum|9802    TTCCAAGAATACGACAAAACGCATAAACACGGTGGCAACTACCGGCGCGAAAATGACGGA
                              .*.* .: . ***.*.*              *  .***:     . ***..  :.* :

Culex_quinquefasciatus|1242 CAGCCGACCAGTTCGACGCCTTCGATTGTCCCCAAAGAAGAGCATCACACGTTCAAAAAG
Tribolium_castaneum|9802    AGCGAGACGAAAAAAACACATAATGTT------AGAAGACTGACTGATATTGTTCAAAAA
                            ..  .*** *.::..**.*.*:. .**      *.*..* :*..* * *   * .****.

Culex_quinquefasciatus|1242 GCCGAACCCTCGCTCCCGGAT---GATCTGCCAAAGACGGACAAGGCCGCGCTGGACCAA
Tribolium_castaneum|9802    CCTGCAGCCTTTTACACTGACCCTAAGCTACCGAAAAAAGTCAACCAGTTGATGGAGGTG
                             * *.* ***   :*.* **    .* **.**.**.*..*:***  .   *.****  :.

Culex_quinquefasciatus|1242 ACCATTGCCCAAGCTTCCGTGAAAAAAGCCCTCGCCGATCCGCCCAAATCCGCCGGTCGC
Tribolium_castaneum|9802    AAGATTGACGACGCTGAGGTTGCGGAAGAAGGGGAAGAAAATAGAAATGAAGACGGCGGA
                            *. ****.* *.*** . ** ....***..   *..**:.. . .**: ..*.***  *.

Culex_quinquefasciatus|1242 CGGAAACACCTC---------AAACGCAAACCAAAGATCCTGAAGCGACCCCTCATCAAG
Tribolium_castaneum|9802    GATTATGACTTTGAAGGGTCCGAGGAGAAGACGACGACGACGAAGAAGCCGTTTTTTGTA
                             . :*: ** *          .*. . **..*.*.**  . ****...**  * :* .:.

Culex_quinquefasciatus|1242 TACCGTCGGAAGAAGAAACTGCTCAAGTACTACCAC---------TAG
Tribolium_castaneum|9802    AAAGATCCCAGCAAAAGATTG------TATTATTATGCTCCTATTTAA
                            :*. .**  *. **.*.* **      ** **  *          **.

multiple sequence alignment in CLUSTALW format


Culex_quinquefasciatus|6570 MSLNAICYPLLLAVFSYRTVSGQFTSLAADLTPPS-----PLQQHHQQNTLAQQSPLHVP
Tribolium_castaneum|5490    MKLITVV------------IIGVFTVTSAIRVPPSWPKKQNLQHVQKFRTVRPSVGSEIG
                            *.* ::             : * **  :*  .***      **: :: .*:  .   .: 

Culex_quinquefasciatus|6570 SQNFPQSPLSVPAQIPSFPSLSSPSAPNNLLSSNFPTTHQFPVQQFPTKPPPQLPPAL-Q
Tribolium_castaneum|5490    YRTRPHVTQTQHHKTNSRKKYQPRMQRHPNLERSAPKT-EFKASASTNDWKPIFPAHLFQ
                             :. *: . :   :  *  . ..    :  *. . *.* :* ..  ...  * :*. * *

Culex_quinquefasciatus|6570 SQLPVQLAPHLQQQIPFQLQPQF------NVNLPPALQPNQQSHLLPPQLPAQLPSQYPP
Tribolium_castaneum|5490    QELKNFKEPFIRETEHGKKSPLYKNYRDDKTHEPSYGTQSVKERHIHRETPKNEYDVVPD
                            .:*     *.:::    : .* :      :.: *.    . :.: :  : * :  .  * 

Culex_quinquefasciatus|6570 IPANTNFP------------RP-IPTSKFPPLTSSKNISNEVTRGPKTLQMIGSNNPFML
Tribolium_castaneum|5490    VPTRPIYPGEGQWAKKGIKHRPFISKHRFAKLEDDSE-----DERPEGYEVFEQNKK-LF
                            :*:.. :*            ** *.. :*. * ...:      . *:  ::: .*:  ::

Culex_quinquefasciatus|6570 HKISDNLRPGSTTWYYRKNNKLMKNTPPSKSSFPPPASPLQTSPNALQQYHQLSQFASLS
Tribolium_castaneum|5490    DRQKAQFR--DTIDQFPRNHKLGAYRQPPEEEDKEAEDEEEEETEDYDEEEEEEQDRGFV
                            .: . ::*  .*   : :*:**     *.:..   . .  : ..:  :: .: .*  .: 

Culex_quinquefasciatus|6570 PPSTTYNFNNPSTSFTSPTTSFNSP-----------SSSFASTSFSS-PSTSLNSPSTSF
Tribolium_castaneum|5490    -PMKLYTQVRRSESAEHLPRLVEDPRLREVIKDSKIQTVYTEEGYEDIAYDHAGHEKTAE
                             * . *.  . * *    .  .:.*           .: ::. .:.. .    .  .*: 

Culex_quinquefasciatus|6570 ASTSFNSPSTSFSSSSLNSPSTSFNSPTSTFNQQTTSFNIPS--------STFNQPSSSL
Tribolium_castaneum|5490    QDEGFAEFDKEIEKEKQRRKDKEESGDSETAGSQHKTVNKPVKMKKDNFMKTEQIQTASL
                             . .* . ...:.... .  ... .. :.* ..* .:.* *         .* :  ::**

Culex_quinquefasciatus|6570 NQQSQTLNPLSQFNQLTQLHSTNQQNQQNQFSSSSLNIPLNTNYNQLNHVNQQPSILNQV
Tribolium_castaneum|5490    KDQAGGNTELEILSEIKVLASPENGTKTHKYVKI---VPKMYKYDRIN--DTRPEMVSME
                            ::*:   . *. :.::. * *.:: .: ::: .    :*   :*:::*  : :*.::.  

Culex_quinquefasciatus|6570 SSNSDSLRQLQLANLLNQLNQSNPPPFLQNQGYSGNVK-PITNPLIPQEIFNSPEFHIQP
Tribolium_castaneum|5490    SVVREHFRR-RFKRYTNDY-----PKIEVDTAFIDKIKHDIPKPLIVRVKPKYPYYNNKA
                            *   : :*: :: .  *:      * :  : .: .::*  *.:*** :   : * :: :.

Culex_quinquefasciatus|6570 ISIPSPNSPHFETVRNQVSFLKAKHKQFFDQQGPKQQKPSFNNFGQHHQQQHQQQHQSQH
Tribolium_castaneum|5490    I---NPDSP-------------LRYAEDLDNI-PKKTEDEFAFYNQADKIQCEEVQSNVD
                            *   .*:**              :: : :*:  **: : .*  :.* .: * :: :.. .

Culex_quinquefasciatus|6570 P-PKLYFDQFNQPEKTWLEQLQQLSNSLFDQPQSPPVHH---HLHIQAPQPFQPKPQAQP
Tribolium_castaneum|5490    PIPARVKNTNDDPDNA------DETSGVQELPQTPRLRNLGDKIDCFKVKYFGENPLDSP
                            * *    :  ::*:::      : :..: : **:* :::   ::.    : *  :*  .*

Culex_quinquefasciatus|6570 LVQSQQNPPQQPAPVYGPPKPPKPLKHVF-EINQTTQKPNINQIQLTTRKPPHPVQQPQS
Tribolium_castaneum|5490    FFKEKDIGPVV------------PLFNIFSKVTSIDVKP--NEIPVEEKRSYSSKISVRK
                            :.:.::  *              ** ::* ::..   **  *:* :  ::.  .  . :.

Culex_quinquefasciatus|6570 SLLPASWNTGHR--APVI-DYDQYSSPKKVLPVQNDFVGFPPAKGSIKNELNFISTWEKA
Tribolium_castaneum|5490    ELTQDDNHLGVNILSDVIGQFEKVTTPKPEMENQTE-----------AATISIITTPKYT
                            .*   . : * .  : ** :::: ::**  :  *.:              :.:*:* : :

Culex_quinquefasciatus|6570 IGIIHKNDHDSEKGHTILSSGDTDDFKKIDNGHNST---QNEEESSNVEVISGDKSHFQP
Tribolium_castaneum|5490    IDLKPKHIY-----HQIELLDHLPYQEKIDTGVTSTVFPLNHRQSKSIEEVSGVSDGTVN
                            *.:  *: :     * *   ..    :***.* .**    *..:*..:* :** ..    

Culex_quinquefasciatus|6570 EAKEEKPQ----KKKKAHGKKRP--MKKHREMEETSEGTNSVEGEENKSAEPSLAESEAQ
Tribolium_castaneum|5490    TSEETAPESQALRKRRRRLKPRPSLQRRKRPYHHVFDINRFIPTHTYNHLNRIIRTSTVV
                             ::*  *:    :*:: : * **   :::*  ... : .. :  .  :  :  :  * . 

Culex_quinquefasciatus|6570 QYRSRRKRDLAAVEVSPENANTAAPLIIVAEDTPEPLVAPETEQPVTEVVSQATEKPTNE
Tribolium_castaneum|5490    PKRSVKSEVHYKNEIKPD----------------------EQLNVFADVINNIKNSSRDP
                              ** :..     *:.*:                      *  : .::*:.: .:.. : 

Culex_quinquefasciatus|6570 RSVGTSVDDSLALDDSSEVEWISGEEVDDEELPHPEALVFDDYDGSY-----------LD
Tribolium_castaneum|5490    QQIAASSSSRIGVKLNVVENY---QKITDEN---------EDSDGFYSSTTTVAPRGTIK
                            :.:.:* .. :.:. .   ::   ::: **:         :* ** *           :.

Culex_quinquefasciatus|6570 YEAYA-PSEFQARSDNFIFEELDGT-TQLPHALPFIAEQVGNVTIVIQPEALVDPRSLHG
Tribolium_castaneum|5490    YSSYRHKDELADQYENLELLKVNRKLTTTTTSEPFF----GNTRIATEEED--ESEDSTD
                            *.:*   .*:  : :*: : ::: . *  . : **:    **. *. : *   :...  .

Culex_quinquefasciatus|6570 RELMLFLEEAIRNSSRFLP---DEAEDRSFDVV--EPPTDVIK-FPYYDRTEEPINVDSA
Tribolium_castaneum|5490    KVVGLMPPDPSRYKTIFSPRVVEEVKMNTFLVVGMKPPSPKQKVYVYSDFKARPHGKRKH
                            : : *:  :. * .: * *   :*.: .:* **  :**:   * : * * . .* .  . 

Culex_quinquefasciatus|6570 LRFAENLTTFSKGLYKSKSANLCNEVDIELDEEPAESGPDGFKPVR-RLKRLGEKIDCLK
Tribolium_castaneum|5490    SYLRRGKRSAQRPAYSEVVRNRNKPIDVEDDTEVKVEEDDDYVPHRPKHYHYDEKTGRIV
                              : ..  : .:  *..   *  : :*:* * *   .  *.: * * :  : .** . : 

Culex_quinquefasciatus|6570 NKNFGKEPLDNPLFKEEFVGVARSAPDGLPTPQPQPDPSVAVFSDVIRLIKQHLTEEHKQ
Tribolium_castaneum|5490    ---YDKVATEAP--EEEYIEVTEA-----PLPKPTRRNSVT-------------TPKFEE
                               :.* . : *  :**:: *:.:     * *:*    **:             * :.::

Culex_quinquefasciatus|6570 HTRDVSQVLAPRQLNLSDVKTTSPNNAVLEQLRLGKRRI--LPKPTKTVEEVKHEVNQTA
Tribolium_castaneum|5490    YT-------GPSFVDFVKKLKSDPKYQEITDPPTTEKRAEDATTPTTTAKAV-----STD
                            :*       .*  ::: .  .:.*:   : :    ::*    ..**.*.: *     .* 

Culex_quinquefasciatus|6570 PSEQHPLRIVFPRRLNFTKTYEEAKKVSLAKLTQTKLAEQEKTKQKLNETRTDHNIYKAS
Tribolium_castaneum|5490    PPEFLSILAKVRSDSGYKPIEDEKAK---AKTTTTEAPEEEEQESQIENVQ---------
                            *.*  .:   .    .:.   :*  *   ** * *: .*:*: :.::::.:         

Culex_quinquefasciatus|6570 LARKLNFDKIEKLKTPMSQRRDSNVEQLYDST---PKLVSYHPRSNIFDISTYYPKQTYD
Tribolium_castaneum|5490    -------------NSPGGQISGSNY-QIFDITEYLPKVKTYSPRTSI-------------
                                         ::* .*  .**  *::* *   **: :* **:.*             

Culex_quinquefasciatus|6570 ELYSFPSVDGKEKGFASKNFRTLEREADELLESVRRDRDKAEKRIVNTGRSNREHQDYTQ
Tribolium_castaneum|5490    DYSKYKTIERANPPTRNNPDQDPEKQTSQV--PIMEDRKSEEEAEINPVMSESKHEDVEP
                            :  .: :::  :    .:  :  *:::.::  .: .**.. *:  :*.  *: :*:*   

Culex_quinquefasciatus|6570 DRPYGTSYSPLYKEFQALSTLKKARHVDDQKKPPSLNQLINFYSQQSDSFSSNQRSYTVP
Tribolium_castaneum|5490    KTTTEVSLS-------TTTTRKVVRTRTRGSRRPA--------QRATTQVPVSTTITEPP
                            . .  .* *       : :* * .*     .: *:        .: : ... .      *

Culex_quinquefasciatus|6570 KAHGNLPIFDVSTFYPRYSTRVH-------DESQELHDL-VTKRRDSKINLEDLEALQAP
Tribolium_castaneum|5490    QVHHDKP---RRTFPRRQRTRIRVPKPTTETETQETVTVKVIRRRH-----------QSP
                            :.* : *     **  *  **::        *:**   : * :**.           *:*

Culex_quinquefasciatus|6570 PKETFQSARQLDKKAKNVTPAPPRDDI----ADFFEEPLAQPTSSTPSIVPKEEHHTFKK
Tribolium_castaneum|5490    PETSNKTV--VSRKIDNVEVFQEYDKTHKHGGNYRRENDGSETKKTHNV--RRLTDIVQK
                            *: : ::.  :.:* .**      *.     .:: .*  .. *..* .:  :.  . .:*

Culex_quinquefasciatus|6570 AEPSLPD-DLPKTDKAALDQTIAQASVKKALADPPKSAGRRKHL---KRKPKILKRPLIK
Tribolium_castaneum|5490    PAAFYTDPKLPKKVNQLMEVKIDDAEVAEEGEENRNEDGGDYDFEGSEEKTTTTKKPFFV
                            . .  .* .***. :  :: .* :*.* :   :  :. *   .:   :.*..  *:*:: 

Culex_quinquefasciatus|6570 YRRKKKLLKYYH---
Tribolium_castaneum|5490    KDPSKRL--YYYAPI
                               .*:*  **: