Orthologs Set ID: EOG4006C9


Orthology Database
OrthoDB4
Gene Symbol(s)
CYP17A2

Phylogenetic Tree:


Transcript Architecture:


Species Transcript ID Positions
Fugu rubripes 45074 47, 227, 348, 493, 723, 810, 1026, 1196, 1300, 1539
Gasterosteus aculeatus 8821 59, 227, 348, 493, 723, 810, 1026, 1196, 1300
Oryzias latipes 8929 54, 227, 348, 489, 723, 810, 1026, 1196, 1300, 1557
Tetraodon nigroviridis 23635 493, 495, 576, 723, 810, 1026

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Fugu rubripes 45074 ENSTRUT00000026629 100125766 ENSTRUG00000010510 cyp17a2 fr2
Gasterosteus aculeatus 8821 ENSGACT00000000407 ENSGACG00000000320 cyp17a2 gasAcu1
Oryzias latipes 8929 ENSORLT00000002786 101170547 ENSORLG00000002242 cyp17a2 oryLat2
Tetraodon nigroviridis 23635 ENSTNIT00000022925 ENSTNIG00000019472 tetNig2

Species ID Accessions Entrez Gene ID Ensembl Gene Gene Symbol Build
Fugu rubripes 26522 ENSTRUP00000026522 100125766 ENSTRUG00000010510 cyp17a2 fr2
Gasterosteus aculeatus 394 ENSGACP00000000407 ENSGACG00000000320 cyp17a2 gasAcu1
Oryzias latipes 2569 ENSORLP00000002785 101170547 ENSORLG00000002242 cyp17a2 oryLat2
Tetraodon nigroviridis 22030 ENSTNIP00000022686 ENSTNIG00000019472 tetNig2

multiple sequence alignment in CLUSTALW format


Tetraodon_nigroviridis|23635 ------------------------------------------------------------
Fugu_rubripes|45074          ---ACTCCTCCA------------------GATGTTGTTCTCTTGAAGGTGACAGTCGGT
Gasterosteus_aculeatus|8821  CCTTCTCCTCCGTTTCCTCGCAGGCATGTGGACGCATCTTGTCTCCTCTCTGGCTCCCTC
Oryzias_latipes|8929         ---GCAGAACTCTTT---------------------CTCTGTGTTGCATCACAGGTGGTC
                                                                                         

Tetraodon_nigroviridis|23635 ------------------------------------------------------------
Fugu_rubripes|45074          TCCTTTCTGATATTTCGAAGACCAGTTCGAGGGTCAGAACCTGGTTCTGAGGCTGGCCCA
Gasterosteus_aculeatus|8821  GCCGTCGTTGTCTTCCTTTTCCTCGTGGCTCGGGGAATCAGACCTGCGTCC---------
Oryzias_latipes|8929         GCGCTCGTCTTCCTGAGCTATGACAGGCGCCGTGGTGAACGTCCGTCCTCTCTTCCACCA
                                                                                         

Tetraodon_nigroviridis|23635 ------------------------------------------------------------
Fugu_rubripes|45074          CCTAGAGTGAAGGTGCCCTGTATTTCCTGGGTCCCGGTGTTGGGCAGCCTGCCCTGGCTG
Gasterosteus_aculeatus|8821  ---------TCCATCACCTGCCTGCCGAGGCTGCCCGTCCTAGGAAGCCTCCCCTGGTTG
Oryzias_latipes|8929         GCCCGGAGCTCCATCCCCTGCCTTCCTCAGCTCCCCATCCTGGGCAGCCTCCCCTGGCTG
                                                                                         

Tetraodon_nigroviridis|23635 ------------------------------------------------------------
Fugu_rubripes|45074          AGAGGAGGCCGTCCTCTTCACCTCATCTTCACCCAGCTGAGCTACAGCTACGGACCTCTC
Gasterosteus_aculeatus|8821  GGGGGGGGGCTGCCCCCCCACCTCCTCTTCACCCAGCTGGCTCACAGGTACGGCCCCCTG
Oryzias_latipes|8929         GGAGGAGGCCTCCCGCCTCACCTCCTCTTCACCAAGCTGGCTCACAGGTACGGATCTCTG
                                                                                         

Tetraodon_nigroviridis|23635 ------------------------------------------------------------
Fugu_rubripes|45074          TTTGCTCTCTACCTGGGTCCTCACCTCACTGTGGTGGTAAACAACCATCAACATGCCAGA
Gasterosteus_aculeatus|8821  TTCGCGCTCCACCTCGGCCCCCACTTCACCGTGGTGGTCAACGACCACCAACACGCCAAA
Oryzias_latipes|8929         TTCGGGCTGTTCCTCGGTCCGCACTACACCGTGGTGGTGAACAGCCATCAACACGCCAAA
                                                                                         

Tetraodon_nigroviridis|23635 ------------------------------------------------------ACCGAG
Fugu_rubripes|45074          GAGGTTCTCCTGCTGAGAGGCAAGGACTTTGCTGGGCGTCCCAGAATGGTGACCACTGAC
Gasterosteus_aculeatus|8821  GAGGTCCTGCAGCAGAAAGGGAGAGACTTCGCGGGACGTTCCAGCATGGTCACCACGGAC
Oryzias_latipes|8929         GAGGTCCTGCTGCAGAGGGGGCGGGACTTTGCTGGACGGCCGAGCATGGTAACCACGGAG
                                                                                   ** ** 

Tetraodon_nigroviridis|23635 CTGCTGACCAGAGGAGGGAAGGACATCGCCTTCTCGGACTACTGCCCCCTCTTGGAGGGC
Fugu_rubripes|45074          CTGTTGACCAGAGGGGGAAAAGACATCGCCTTCTCAGATTACTGTCCACTGTGGAAGTCT
Gasterosteus_aculeatus|8821  CTGCTGATCCGAGGGGGTAAAGACATCGCCTTCTCAGACTACACCCCCCCTGTGGAAAGC
Oryzias_latipes|8929         CTGCTAACCAGAGGAGGCAAAGACATCGCATTTTCAGACTACTCTCCTCTCTGGAAGCTT
                             *** *.* *.****.** **.********.** **.** ***:  ** *    *.*.   

Tetraodon_nigroviridis|23635 CCACCGGCCGGGCTGGTCCACcactcctgcagcctctttggAGAAGGGACGCGC---GGC
Fugu_rubripes|45074          CACCGTCGG---CTCGTCCAGAACTCCTTCACTCTTTTTGGAGAGGGGACAAGT---CGC
Gasterosteus_aculeatus|8821  TGCACCGGTCGCCTCGTCCACAACTCTATCACTCTGTTTGGAAGAAAGGACCGGGTCGGC
Oryzias_latipes|8929         CACCGCCGT---CTGGTCCACAACTCCTTCACTCTGTTTGGGGAAGGAACCAGC---CGA
                               ..        ** ***** .**** : **  ** *****......... .*     *.

Tetraodon_nigroviridis|23635 CTCCAGGACATGGGT---CCCGTCGTCCACGCGCTTtgtgaggagctgctgtccagcGGG
Fugu_rubripes|45074          TTGCAGGACATGGTCCTGGCTGCAGTGGACAGTCTCTGTGAGGAGCTGTTGTCCATGGAG
Gasterosteus_aculeatus|8821  CTGCAGGACATCGTCATGTCCTCGGTGGACAGCCTGTGTGCGGAGCTGTTGTCTGGCGGG
Oryzias_latipes|8929         CTGCAGGACGCAGTGTTTTCTGCCGTTGACAGTTTGTGCTCCGAGCTGATGTCCAACGGC
                              * ******.  *      *    **  **.   * **  . ****** **** .  *. 

Tetraodon_nigroviridis|23635 GGGCGTGGCTTAGACCCGTCTCCCGCGGTCACCCGG---GTGACCAACGTGGTGTGCATG
Fugu_rubripes|45074          GGGCGTGGCTTCGACCCAGCTCCCGCGGTGACCAGGGCAGTCACTAATGTGGTGTGCATG
Gasterosteus_aculeatus|8821  CGCCAACCCTTCGACCCGTCGGCCGCAGTGACCCGGGCTGTTACCAACGTCGTGTGCACG
Oryzias_latipes|8929         TCCCGAGGCTTCGATCCGTCTGCTGCCGTCACCAGGGCTGTGACTAACGTGGTGTGCACG
                                *.:  ***.** **. *  * ** ** ***.**   ** ** ** ** ******* *

Tetraodon_nigroviridis|23635 CTGGTCTTTGGCGCTTCCTATCGCCGTGGCGACAGTGAGCTACAGGAAGTCCTCCAGTAC
Fugu_rubripes|45074          CTGGTATTTAGTGCTACCTATCGTCATGGCGATAGCGAGCTACAGGAGGTCCTCCGGTAC
Gasterosteus_aculeatus|8821  CTGGTTTTCAATGCCACGTATCGCCACGGCGACGCCGAGCTGCAGGAAGTCATGCGGTAC
Oryzias_latipes|8929         CTGGTGTTCAGCAGCACCTATCGCCACGGCGACGCAGAGCTGCAGGAAGTGATCAGCTAC
                             ***** ** .. .  :* ***** *. ***** .  *****.*****.** .* .. ***

Tetraodon_nigroviridis|23635 AACGACGGCATCGTGCAGACGATCGCTGCCGGCGGCCTGGTGGACATTTACCCCTGGATG
Fugu_rubripes|45074          AACGACGGAATCGTGCAGACGATTGCTGGAGGTGGTCTGGTGGACATTTATCCCTGGATG
Gasterosteus_aculeatus|8821  AACGACGGCATCGTGCAGACGATTGCCGCCGGAGGCCTCGTGGACATCTTCCCCTGGATG
Oryzias_latipes|8929         AACAACGGCATCGTGGAGACCATCGCCAGAGGAGGACTGGTGGACATCTACCCCTGGATG
                             ***.****.****** **** ** ** . .** ** ** ******** *: *********

Tetraodon_nigroviridis|23635 AAGGTCTTCCCTAACGAGACTCTGAGGAGACTGAAGTCGTGCATCGCCGTCAGAGACCGA
Fugu_rubripes|45074          AAAGTGTTTCCTAACAAGACTCTGAGTAAACTGAAGGCGTGCATCGCTGTCAGAGACAGA
Gasterosteus_aculeatus|8821  AAGGTGTTTCCCAACAGGTGTCTCAGGAGACTGAAGGACTGCATCCTCGTCAGAGACCGG
Oryzias_latipes|8929         AAGGTCTTCCCTAACTCCTCCCTCCGGAAGCTGAAGGAGTGCATCGCCGTCAGAGACCGG
                             **.** ** ** ***   :  ** .* *..****** . ******   *********.*.

Tetraodon_nigroviridis|23635 CTTCTGACGCGCAAACTGGAGGAGCACAAGGCCACCCTTGGCGACGGTCAACCCCGTGAC
Fugu_rubripes|45074          CTGTTGACACACAAGCTGGAGGAGCACAAGGCCACACTGACTGACAATCAACCCCGTGAC
Gasterosteus_aculeatus|8821  CTGTTGTCACGGAAACTAGAGGAGCACAAGGCCTCGCTGAGCGAGGGCGACCCCCGTGAC
Oryzias_latipes|8929         CTGCTGACCCGGAAACTGGAGGAACACAAGGCGTCCTTGGCTGAAGGTGATCCTTCCGAC
                             **  **:* *. **.**.*****.******** :*  * .  ** ..  * **    ***

Tetraodon_nigroviridis|23635 CTTCTGGACGCCCTGCTGATGGGCCAAGTCgacagggggcggagtcaggagTCTGAGGGG
Fugu_rubripes|45074          CTCCTGGATGCCCTACTGATGGGCCAAGTGGGCCGAGGCCGAAGAAAAGGCTCCGGGAGG
Gasterosteus_aculeatus|8821  CTCCTGGATGCCTTGCTCAAGGGCAAGACG---------------------CCCTCCGGC
Oryzias_latipes|8929         CTCCTGGATGCCTTGCTAAAGGGAAAGAAGGGTGGTCCAAAG---------TCACATGGT
                             ** ***** *** *.** *:***..*..                        *    .* 

Tetraodon_nigroviridis|23635 CTGGAGGATGAGACGATCACAGACGACCACGTGCTCATGACAGCAGCTGAGGCTTTCGGT
Fugu_rubripes|45074          GTGGAAGAGGACATCATCACGGAGGACCACGTGCTCATGACAGCAGCTGAAGCTTTTGGG
Gasterosteus_aculeatus|8821  TGCGAGGACGAGGGCATCACAGATGACCACGTCCTCATGACGGCGGCCGAGGCCTTCGGC
Oryzias_latipes|8929         TTGGAAGGGGAGGGGATAACGGACGACCACGTCCTGATGACGGCGGCGGAGGCTTTTGGA
                                **.*. ** .  **.**.** ******** ** *****.**.** **.** ** ** 

Tetraodon_nigroviridis|23635 GCTGGCGTGGAGACCACGTCTACCACGCTGCTGTGGATCCTGGCCTACCTCCTGCACCAC
Fugu_rubripes|45074          GCTGGAGTTGAGACGACATCGACCACACTGCTGTGGATCCTGGCCTACCTTCTGCACCAC
Gasterosteus_aculeatus|8821  GCCGGCGTGGAGACGACATCCACAACGCTGCTGTGGATCCTGGTGTACCTGCTGCACCAC
Oryzias_latipes|8929         GCCGGAGTGGAAACAACGTCCACCACGCTGCTGTGGATTCTGGCCTATCTGCTGCACCAC
                             ** **.** **.** **.** **.**.*********** ****  ** ** *********

Tetraodon_nigroviridis|23635 CCACGGgtgcaggagcaggtgcagaaggagctggacgAGCACGTGGGTCGCGAGCGCCTG
Fugu_rubripes|45074          CCACAGGTGCAGGAGCGTGTGCAGAAGGAGCTGGACGACCACGTGGGCAGCGAGAGACCA
Gasterosteus_aculeatus|8821  CCGGAGGTGCAGCAGCGCGTTCAGGAGGAGCTGGACGAGCAGGTGGGTGGCGAGCGGGCG
Oryzias_latipes|8929         CCAGAGGTCCAGCAGCGCGTGCAGAAGGAGCTGGATGAGAACGTGGGCGCCGACCGCGCC
                             **. .*** *** ***. ** ***.********** ** .* *****   *** .*    

Tetraodon_nigroviridis|23635 GTGCGTCTGTCCGATCGTGCTAAGCTAACGTATCTGGACTGTGTCATCAACGAAGGGATG
Fugu_rubripes|45074          GTGCGTGTGTCAGATCGTGCTCGGCTGACATATCTGGACTGTGTCATCAACGAAGGTATG
Gasterosteus_aculeatus|8821  GTGTCCATGTCGGACCGCGGCCGGCTGCCCTACCTGGACTGTGTCATCAACGAGGGCATG
Oryzias_latipes|8929         GCAAACCTGTCCGACCGAGGTCACCTGCCGTACCTGGACTGTGTGATCAACGAGGGAATG
                             * .    **** ** ** *  .. **..* ** *********** ********.** ***

Tetraodon_nigroviridis|23635 AGGATCTGCCCGGTCAGCCCGGTGCTGATCCCC---------------------------
Fugu_rubripes|45074          AGGATCCGCCCAGTCAGTCCAGTTCTGATCCCTCACACCGCCATGACTGACAGCAGTATC
Gasterosteus_aculeatus|8821  AGGATCCGCCCCGTGAGCCCGGTTCTGATCCCCCACAGCGCCATGACGGACAGCAGCATC
Oryzias_latipes|8929         AGGATCCGGCCGGTCAGCCCCGTGCTGATCCCCCACACCGCCATGACGGACAGCAGCATT
                             ****** * ** ** ** ** ** ********                            

Tetraodon_nigroviridis|23635 ------------------------------------------------------------
Fugu_rubripes|45074          GGAGGTCACCACATTAGCCGTGGGACACGTGTTTTGGTCAACATGTGGTCAATCCATCAC
Gasterosteus_aculeatus|8821  GGCGGTCACCCTGTCCACCGGGGGACTCGTGTTCTGGTGAACATGTGGGCGATCCACCAC
Oryzias_latipes|8929         GGAGGTCACGCGGTGCGGCGTGGGACCCGGGTTTTGGTGAACATGTGGTCGATCCACCAT
                                                                                         

Tetraodon_nigroviridis|23635 ------------------------------------------------------------
Fugu_rubripes|45074          GACTCTGCACACTGGGACAAGCCTGACTTGTTTAATCCTGATCGCTTTCGTGACCACCAG
Gasterosteus_aculeatus|8821  GACCCCCGACTCTGGGCCCGACCGGACCTGTTCCACCCAGATCGTTTCCTTGACGACCAG
Oryzias_latipes|8929         GACCCCCAAAACTGGGACAAACCGGATCTGTTCCAACCAGAACGTTTCCTTGACGACCAG
                                                                                         

Tetraodon_nigroviridis|23635 ------------------------------------------------------------
Fugu_rubripes|45074          GGTCAGCGGGTCACACCTTCATGCTTCCTGCCGTTTGGGGCGGGGCCTCGAGTCTGCGTT
Gasterosteus_aculeatus|8821  GGCCAAAGGTCCTGTCCCGCCTACTTCCTGCCGTTCGGGGCGGGCCCTCGGGTCTGCGTC
Oryzias_latipes|8929         GGCAATCGCGCCACACCTTCTTGCTTTATGCCGTTTGGAGCGGGACCTCGTGTCTGTGTT
                                                                                         

Tetraodon_nigroviridis|23635 ------------------------------------------------------------
Fugu_rubripes|45074          GGTGAATCATTGGCCAGACTGGAGCTCTTTCTCTTCCTGTCTTCGCTGCTCCAGCGAATG
Gasterosteus_aculeatus|8821  GGCGAATCGTTGGCGAGGACGGAGCTCTTCCTCTTCCTGGCCTCTCTGCTGCAGCGCATG
Oryzias_latipes|8929         GGCGAATCATTGGCCAGAATGGAGCTTTTCCTTTTCCTGTCGTCTCTGCTTCAACGAATG
                                                                                         

Tetraodon_nigroviridis|23635 ------------------------------------------------------------
Fugu_rubripes|45074          AGCTTCAGGCTGCCCAATGGGGCTTCCCCGCCAGACCTGCAGGGGCGAATGGGTGTGGTC
Gasterosteus_aculeatus|8821  AGCGTCACGCTGCCGCGCGGGGCTCCTCCCCCCAACCTGCAGGGGCGCCTGGGCGTGGTC
Oryzias_latipes|8929         AGCTTCAGGCTCCCTGAAGGGGCTCCGCCCCCTAACCTGCAGGGCCGTTTGGGCGTGGTC
                                                                                         

Tetraodon_nigroviridis|23635 ------------------------------------------------------------
Fugu_rubripes|45074          TTACAACCTGTGCCTTATAAGGTCGTTGTGACTCCCAGGGTGTCGTGGCCTGGTGTGAGA
Gasterosteus_aculeatus|8821  CTGCAGCCGTTGCCGTATAGCGTCGTGGTCACTCCGAGGGCGGGTTGGGAGGGCGGGGCC
Oryzias_latipes|8929         TTGCAGCCAATGCCTTATGAGGTTGTGGTCATTCCAAGGCCGGGGTGGGAGGGCGGGGGC
                                                                                         

Tetraodon_nigroviridis|23635 ---------------------
Fugu_rubripes|45074          GCAGCC---------------
Gasterosteus_aculeatus|8821  AAG---------------TGA
Oryzias_latipes|8929         ATTCGCCCTCTAACACCA---
                                                  

multiple sequence alignment in CLUSTALW format


Tetraodon_nigroviridis|22030 ------------------------------------------------------------
Fugu_rubripes|26522          -TPP------DVVLLKVTVGSFLIFRRPVRGSEPGSEAGPPRVKVPCISWVPVLGSLPWL
Gasterosteus_aculeatus|394   PSPPFPRRHVDASCLLSGSLAVVVFLFLVARGIRPAS------SITCLPRLPVLGSLPWL
Oryzias_latipes|2569         -AELF-------LCVASQVVALVFLSYDRRRGERPSSLPPARSSIPCLPQLPILGSLPWL
                                                                                         

Tetraodon_nigroviridis|22030 ----------------------------------------------------------TE
Fugu_rubripes|26522          RGGRPLHLIFTQLSYSYGPLFALYLGPHLTVVVNNHQHAREVLLLRGKDFAGRPRMVTTD
Gasterosteus_aculeatus|394   GGGLPPHLLFTQLAHRYGPLFALHLGPHFTVVVNDHQHAKEVLQQKGRDFAGRSSMVTTD
Oryzias_latipes|2569         GGGLPPHLLFTKLAHRYGSLFGLFLGPHYTVVVNSHQHAKEVLLQRGRDFAGRPSMVTTE
                                                                                       *:

Tetraodon_nigroviridis|22030 LLTRGGKDIAFSDYCPLLEGPPAGLVHHSCSLFGEGTR-GLQDMG-PVVHALCEELLSSG
Fugu_rubripes|26522          LLTRGGKDIAFSDYCPLWKSHRR-LVQNSFTLFGEGTS-RLQDMVLAAVDSLCEELLSME
Gasterosteus_aculeatus|394   LLIRGGKDIAFSDYTPPVESCTGRLVHNSITLFGRKDRVGLQDIVMSSVDSLCAELLSGG
Oryzias_latipes|2569         LLTRGGKDIAFSDYSPLWKLHRR-LVHNSFTLFGEGTS-RLQDAVFSAVDSLCSELMSNG
                             ** *********** *  :     **::* :***.     ***   . *.:** **:*  

Tetraodon_nigroviridis|22030 GRGLDPSPAVTR-VTNVVCMLVFGASYRRGDSELQEVLQYNDGIVQTIAAGGLVDIYPWM
Fugu_rubripes|26522          GRGFDPAPAVTRAVTNVVCMLVFSATYRHGDSELQEVLRYNDGIVQTIAGGGLVDIYPWM
Gasterosteus_aculeatus|394   RQPFDPSAAVTRAVTNVVCTLVFNATYRHGDAELQEVMRYNDGIVQTIAAGGLVDIFPWM
Oryzias_latipes|2569         SRGFDPSAAVTRAVTNVVCTLVFSSTYRHGDAELQEVISYNNGIVETIARGGLVDIYPWM
                              : :**:.**** ****** ***.::**:**:*****: **:***:*** ******:***

Tetraodon_nigroviridis|22030 KVFPNETLRRLKSCIAVRDRLLTRKLEEHKATLGDGQPRDLLDALLMGQVDRGRSQESEG
Fugu_rubripes|26522          KVFPNKTLSKLKACIAVRDRLLTHKLEEHKATLTDNQPRDLLDALLMGQVGRGRRKGSGR
Gasterosteus_aculeatus|394   KVFPNRCLRRLKDCILVRDRLLSRKLEEHKASLSEGDPRDLLDALLKGKT-------PSG
Oryzias_latipes|2569         KVFPNSSLRKLKECIAVRDRLLTRKLEEHKASLAEGDPSDLLDALLKGKKGGPK---SHG
                             *****  * :** ** ******::*******:* :.:* ******* *:        .  

Tetraodon_nigroviridis|22030 LEDETITDDHVLMTAAEAFGAGVETTSTTLLWILAYLLHHPRVQEQVQKELDEHVGRERL
Fugu_rubripes|26522          VEEDIITEDHVLMTAAEAFGAGVETTSTTLLWILAYLLHHPQVQERVQKELDDHVGSERP
Gasterosteus_aculeatus|394   CEDEGITDDHVLMTAAEAFGAGVETTSTTLLWILVYLLHHPEVQQRVQEELDEQVGGERA
Oryzias_latipes|2569         LEGEGITDDHVLMTAAEAFGAGVETTSTTLLWILAYLLHHPEVQQRVQKELDENVGADRA
                              * : **:**************************.******.**::**:***::** :* 

Tetraodon_nigroviridis|22030 VRLSDRAKLTYLDCVINEGMRICPVSPVLIP-----------------------------
Fugu_rubripes|26522          VRVSDRARLTYLDCVINEGMRIRPVSPVLIPHTAMTDSSIGGHHISRGTRVLVNMWSIHH
Gasterosteus_aculeatus|394   VSMSDRGRLPYLDCVINEGMRIRPVSPVLIPHSAMTDSSIGGHPVHRGTRVLVNMWAIHH
Oryzias_latipes|2569         ANLSDRGHLPYLDCVINEGMRIRPVSPVLIPHTAMTDSSIGGHAVRRGTRVLVNMWSIHH
                             . :***.:*.************ ********                             

Tetraodon_nigroviridis|22030 ------------------------------------------------------------
Fugu_rubripes|26522          DSAHWDKPDLFNPDRFRDHQGQRVTPSCFLPFGAGPRVCVGESLARLELFLFLSSLLQRM
Gasterosteus_aculeatus|394   DPRLWARPDLFHPDRFLDDQGQRSCPAYFLPFGAGPRVCVGESLARTELFLFLASLLQRM
Oryzias_latipes|2569         DPQNWDKPDLFQPERFLDDQGNRATPSCFMPFGAGPRVCVGESLARMELFLFLSSLLQRM
                                                                                         

Tetraodon_nigroviridis|22030 ----------------------------------------------
Fugu_rubripes|26522          SFRLPNGASPPDLQGRMGVVLQPVPYKVVVTPRVSWPGVRAA----
Gasterosteus_aculeatus|394   SVTLPRGAPPPNLQGRLGVVLQPLPYSVVVTPRAGWEGGAK-----
Oryzias_latipes|2569         SFRLPEGAPPPNLQGRLGVVLQPMPYEVVVIPRPGWEGGGIRPLTP